data_5B60 # _entry.id 5B60 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5B60 pdb_00005b60 10.2210/pdb5b60/pdb WWPDB D_1300000595 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5K5W PDB . unspecified 5B5X PDB . unspecified 5B5Y PDB . unspecified 5B5Z PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5B60 _pdbx_database_status.recvd_initial_deposition_date 2016-05-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jin, S.' 1 'Sun, J.' 2 'Wunder, T.' 3 'Tang, D.' 4 'Mueller-Caja, O.M.' 5 'Gao, Y.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 113 _citation.language ? _citation.page_first 14716 _citation.page_last 14721 _citation.title 'Structural insights into the LCIB protein family reveals a new group of beta-carbonic anhydrases' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1616294113 _citation.pdbx_database_id_PubMed 27911826 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jin, S.' 1 ? primary 'Sun, J.' 2 ? primary 'Wunder, T.' 3 ? primary 'Tang, D.' 4 ? primary 'Cousins, A.B.' 5 ? primary 'Sze, S.K.' 6 ? primary 'Mueller-Cajar, O.' 7 ? primary 'Gao, Y.G.' 8 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 101.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5B60 _cell.details ? _cell.formula_units_Z ? _cell.length_a 68.550 _cell.length_a_esd ? _cell.length_b 66.110 _cell.length_b_esd ? _cell.length_c 69.060 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5B60 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PtLCIB4 S47R mutant' 30377.990 1 ? S47R ? ? 2 non-polymer man 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer man 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 24 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSQDPNSNVTLTAVKKAFPDALTNAELVAMVSKRLSQFGYHKYNTLLATSLCRDEVTRPLEQDFGEVYGKHFT MGGLAGFPFGGLTGFGAMAGHIPDGGSCLLIYGSHVGVSWEGKWGTVARRGREKGGACCGSAVAAAQAVTQAYQATLDES SSSSSSSATSTPVYRYSNDPLDAQQGYVRDMLRPYAATLSEAEDVMVTLPVSVYDAQQKLVTRILDEGSNHIDGDGQIAV VGGIQINTPKEMSDFFVVRRFCIRDSSGNMVENFMPLTAGRE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSQDPNSNVTLTAVKKAFPDALTNAELVAMVSKRLSQFGYHKYNTLLATSLCRDEVTRPLEQDFGEVYGKHFT MGGLAGFPFGGLTGFGAMAGHIPDGGSCLLIYGSHVGVSWEGKWGTVARRGREKGGACCGSAVAAAQAVTQAYQATLDES SSSSSSSATSTPVYRYSNDPLDAQQGYVRDMLRPYAATLSEAEDVMVTLPVSVYDAQQKLVTRILDEGSNHIDGDGQIAV VGGIQINTPKEMSDFFVVRRFCIRDSSGNMVENFMPLTAGRE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 GLN n 1 11 ASP n 1 12 PRO n 1 13 ASN n 1 14 SER n 1 15 ASN n 1 16 VAL n 1 17 THR n 1 18 LEU n 1 19 THR n 1 20 ALA n 1 21 VAL n 1 22 LYS n 1 23 LYS n 1 24 ALA n 1 25 PHE n 1 26 PRO n 1 27 ASP n 1 28 ALA n 1 29 LEU n 1 30 THR n 1 31 ASN n 1 32 ALA n 1 33 GLU n 1 34 LEU n 1 35 VAL n 1 36 ALA n 1 37 MET n 1 38 VAL n 1 39 SER n 1 40 LYS n 1 41 ARG n 1 42 LEU n 1 43 SER n 1 44 GLN n 1 45 PHE n 1 46 GLY n 1 47 TYR n 1 48 HIS n 1 49 LYS n 1 50 TYR n 1 51 ASN n 1 52 THR n 1 53 LEU n 1 54 LEU n 1 55 ALA n 1 56 THR n 1 57 SER n 1 58 LEU n 1 59 CYS n 1 60 ARG n 1 61 ASP n 1 62 GLU n 1 63 VAL n 1 64 THR n 1 65 ARG n 1 66 PRO n 1 67 LEU n 1 68 GLU n 1 69 GLN n 1 70 ASP n 1 71 PHE n 1 72 GLY n 1 73 GLU n 1 74 VAL n 1 75 TYR n 1 76 GLY n 1 77 LYS n 1 78 HIS n 1 79 PHE n 1 80 THR n 1 81 MET n 1 82 GLY n 1 83 GLY n 1 84 LEU n 1 85 ALA n 1 86 GLY n 1 87 PHE n 1 88 PRO n 1 89 PHE n 1 90 GLY n 1 91 GLY n 1 92 LEU n 1 93 THR n 1 94 GLY n 1 95 PHE n 1 96 GLY n 1 97 ALA n 1 98 MET n 1 99 ALA n 1 100 GLY n 1 101 HIS n 1 102 ILE n 1 103 PRO n 1 104 ASP n 1 105 GLY n 1 106 GLY n 1 107 SER n 1 108 CYS n 1 109 LEU n 1 110 LEU n 1 111 ILE n 1 112 TYR n 1 113 GLY n 1 114 SER n 1 115 HIS n 1 116 VAL n 1 117 GLY n 1 118 VAL n 1 119 SER n 1 120 TRP n 1 121 GLU n 1 122 GLY n 1 123 LYS n 1 124 TRP n 1 125 GLY n 1 126 THR n 1 127 VAL n 1 128 ALA n 1 129 ARG n 1 130 ARG n 1 131 GLY n 1 132 ARG n 1 133 GLU n 1 134 LYS n 1 135 GLY n 1 136 GLY n 1 137 ALA n 1 138 CYS n 1 139 CYS n 1 140 GLY n 1 141 SER n 1 142 ALA n 1 143 VAL n 1 144 ALA n 1 145 ALA n 1 146 ALA n 1 147 GLN n 1 148 ALA n 1 149 VAL n 1 150 THR n 1 151 GLN n 1 152 ALA n 1 153 TYR n 1 154 GLN n 1 155 ALA n 1 156 THR n 1 157 LEU n 1 158 ASP n 1 159 GLU n 1 160 SER n 1 161 SER n 1 162 SER n 1 163 SER n 1 164 SER n 1 165 SER n 1 166 SER n 1 167 SER n 1 168 ALA n 1 169 THR n 1 170 SER n 1 171 THR n 1 172 PRO n 1 173 VAL n 1 174 TYR n 1 175 ARG n 1 176 TYR n 1 177 SER n 1 178 ASN n 1 179 ASP n 1 180 PRO n 1 181 LEU n 1 182 ASP n 1 183 ALA n 1 184 GLN n 1 185 GLN n 1 186 GLY n 1 187 TYR n 1 188 VAL n 1 189 ARG n 1 190 ASP n 1 191 MET n 1 192 LEU n 1 193 ARG n 1 194 PRO n 1 195 TYR n 1 196 ALA n 1 197 ALA n 1 198 THR n 1 199 LEU n 1 200 SER n 1 201 GLU n 1 202 ALA n 1 203 GLU n 1 204 ASP n 1 205 VAL n 1 206 MET n 1 207 VAL n 1 208 THR n 1 209 LEU n 1 210 PRO n 1 211 VAL n 1 212 SER n 1 213 VAL n 1 214 TYR n 1 215 ASP n 1 216 ALA n 1 217 GLN n 1 218 GLN n 1 219 LYS n 1 220 LEU n 1 221 VAL n 1 222 THR n 1 223 ARG n 1 224 ILE n 1 225 LEU n 1 226 ASP n 1 227 GLU n 1 228 GLY n 1 229 SER n 1 230 ASN n 1 231 HIS n 1 232 ILE n 1 233 ASP n 1 234 GLY n 1 235 ASP n 1 236 GLY n 1 237 GLN n 1 238 ILE n 1 239 ALA n 1 240 VAL n 1 241 VAL n 1 242 GLY n 1 243 GLY n 1 244 ILE n 1 245 GLN n 1 246 ILE n 1 247 ASN n 1 248 THR n 1 249 PRO n 1 250 LYS n 1 251 GLU n 1 252 MET n 1 253 SER n 1 254 ASP n 1 255 PHE n 1 256 PHE n 1 257 VAL n 1 258 VAL n 1 259 ARG n 1 260 ARG n 1 261 PHE n 1 262 CYS n 1 263 ILE n 1 264 ARG n 1 265 ASP n 1 266 SER n 1 267 SER n 1 268 GLY n 1 269 ASN n 1 270 MET n 1 271 VAL n 1 272 GLU n 1 273 ASN n 1 274 PHE n 1 275 MET n 1 276 PRO n 1 277 LEU n 1 278 THR n 1 279 ALA n 1 280 GLY n 1 281 ARG n 1 282 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 282 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Phaeodactylum tricornutum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2850 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5B60 _struct_ref.pdbx_db_accession 5B60 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5B60 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 282 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5B60 _struct_ref_seq.db_align_beg -12 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 269 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -12 _struct_ref_seq.pdbx_auth_seq_align_end 269 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5B60 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.53 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.35 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '200 mM sodium chloride, 100 mM Bis-Tris, 25% w/v PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-02-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5B60 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 67.8 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15494 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.32 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5B60 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.200 _refine.ls_d_res_low 47.159 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15400 _refine.ls_number_reflns_R_free 770 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.40 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2503 _refine.ls_R_factor_R_free 0.2537 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2501 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.64 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5B5Y _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.48 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.29 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1603 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 1629 _refine_hist.d_res_high 2.200 _refine_hist.d_res_low 47.159 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 ? 1631 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.272 ? 2213 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.082 ? 556 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.073 ? 258 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 287 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2002 2.3380 . . 132 2419 100.00 . . . 0.3242 . 0.3495 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3380 2.5185 . . 137 2430 99.00 . . . 0.2760 . 0.2814 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5185 2.7720 . . 108 2442 99.00 . . . 0.2341 . 0.2856 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7720 3.1730 . . 140 2434 99.00 . . . 0.3192 . 0.2803 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1730 3.9973 . . 132 2426 100.00 . . . 0.2551 . 0.2407 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9973 47.1695 . . 121 2479 99.00 . . . 0.2191 . 0.2228 . . . . . . . . . . # _struct.entry_id 5B60 _struct.title 'Crystal structure of PtLCIB4 S47R mutant, a homolog of the limiting CO2-inducible protein LCIB' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5B60 _struct_keywords.text 'metalloenzyme, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 16 ? PHE A 25 ? VAL A 3 PHE A 12 1 ? 10 HELX_P HELX_P2 AA2 ASN A 31 ? GLN A 44 ? ASN A 18 GLN A 31 1 ? 14 HELX_P HELX_P3 AA3 ASP A 61 ? VAL A 63 ? ASP A 48 VAL A 50 5 ? 3 HELX_P HELX_P4 AA4 THR A 64 ? TYR A 75 ? THR A 51 TYR A 62 1 ? 12 HELX_P HELX_P5 AA5 GLY A 83 ? PHE A 87 ? GLY A 70 PHE A 74 5 ? 5 HELX_P HELX_P6 AA6 GLY A 90 ? GLY A 100 ? GLY A 77 GLY A 87 1 ? 11 HELX_P HELX_P7 AA7 CYS A 139 ? ALA A 152 ? CYS A 126 ALA A 139 1 ? 14 HELX_P HELX_P8 AA8 ASP A 182 ? ARG A 193 ? ASP A 169 ARG A 180 1 ? 12 HELX_P HELX_P9 AA9 TYR A 195 ? ALA A 202 ? TYR A 182 ALA A 189 1 ? 8 HELX_P HELX_P10 AB1 ASP A 204 ? GLY A 228 ? ASP A 191 GLY A 215 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 59 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 46 A ZN 301 1_555 ? ? ? ? ? ? ? 2.392 ? ? metalc2 metalc ? ? A HIS 115 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 102 A ZN 301 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc3 metalc ? ? A CYS 139 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 126 A ZN 301 1_555 ? ? ? ? ? ? ? 2.248 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 301 A HOH 419 1_555 ? ? ? ? ? ? ? 2.241 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id CYS _struct_mon_prot_cis.label_seq_id 138 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id CYS _struct_mon_prot_cis.auth_seq_id 125 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 CYS _struct_mon_prot_cis.pdbx_label_seq_id_2 139 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 CYS _struct_mon_prot_cis.pdbx_auth_seq_id_2 126 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 6.06 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 29 ? THR A 30 ? LEU A 16 THR A 17 AA1 2 PHE A 255 ? ARG A 264 ? PHE A 242 ARG A 251 AA1 3 ILE A 238 ? ASN A 247 ? ILE A 225 ASN A 234 AA1 4 SER A 107 ? GLY A 117 ? SER A 94 GLY A 104 AA1 5 THR A 52 ? SER A 57 ? THR A 39 SER A 44 AA1 6 HIS A 78 ? THR A 80 ? HIS A 65 THR A 67 AA2 1 LEU A 29 ? THR A 30 ? LEU A 16 THR A 17 AA2 2 PHE A 255 ? ARG A 264 ? PHE A 242 ARG A 251 AA2 3 MET A 270 ? ASN A 273 ? MET A 257 ASN A 260 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 29 ? N LEU A 16 O PHE A 256 ? O PHE A 243 AA1 2 3 O PHE A 255 ? O PHE A 242 N ILE A 246 ? N ILE A 233 AA1 3 4 O ALA A 239 ? O ALA A 226 N LEU A 110 ? N LEU A 97 AA1 4 5 O LEU A 109 ? O LEU A 96 N LEU A 53 ? N LEU A 40 AA1 5 6 N THR A 56 ? N THR A 43 O PHE A 79 ? O PHE A 66 AA2 1 2 N LEU A 29 ? N LEU A 16 O PHE A 256 ? O PHE A 243 AA2 2 3 N ILE A 263 ? N ILE A 250 O GLU A 272 ? O GLU A 259 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 301 ? 4 'binding site for residue ZN A 301' AC2 Software A CL 302 ? 3 'binding site for residue CL A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 59 ? CYS A 46 . ? 1_555 ? 2 AC1 4 HIS A 115 ? HIS A 102 . ? 1_555 ? 3 AC1 4 CYS A 139 ? CYS A 126 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 419 . ? 1_555 ? 5 AC2 3 SER A 119 ? SER A 106 . ? 1_555 ? 6 AC2 3 TRP A 120 ? TRP A 107 . ? 1_555 ? 7 AC2 3 ALA A 128 ? ALA A 115 . ? 1_555 ? # _atom_sites.entry_id 5B60 _atom_sites.fract_transf_matrix[1][1] 0.014588 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002836 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015126 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014751 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S ZN # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -12 ? ? ? A . n A 1 2 GLY 2 -11 ? ? ? A . n A 1 3 HIS 3 -10 ? ? ? A . n A 1 4 HIS 4 -9 ? ? ? A . n A 1 5 HIS 5 -8 ? ? ? A . n A 1 6 HIS 6 -7 ? ? ? A . n A 1 7 HIS 7 -6 ? ? ? A . n A 1 8 HIS 8 -5 ? ? ? A . n A 1 9 SER 9 -4 ? ? ? A . n A 1 10 GLN 10 -3 ? ? ? A . n A 1 11 ASP 11 -2 ? ? ? A . n A 1 12 PRO 12 -1 ? ? ? A . n A 1 13 ASN 13 0 ? ? ? A . n A 1 14 SER 14 1 ? ? ? A . n A 1 15 ASN 15 2 ? ? ? A . n A 1 16 VAL 16 3 3 VAL VAL A . n A 1 17 THR 17 4 4 THR THR A . n A 1 18 LEU 18 5 5 LEU LEU A . n A 1 19 THR 19 6 6 THR THR A . n A 1 20 ALA 20 7 7 ALA ALA A . n A 1 21 VAL 21 8 8 VAL VAL A . n A 1 22 LYS 22 9 9 LYS LYS A . n A 1 23 LYS 23 10 10 LYS LYS A . n A 1 24 ALA 24 11 11 ALA ALA A . n A 1 25 PHE 25 12 12 PHE PHE A . n A 1 26 PRO 26 13 13 PRO PRO A . n A 1 27 ASP 27 14 14 ASP ASP A . n A 1 28 ALA 28 15 15 ALA ALA A . n A 1 29 LEU 29 16 16 LEU LEU A . n A 1 30 THR 30 17 17 THR THR A . n A 1 31 ASN 31 18 18 ASN ASN A . n A 1 32 ALA 32 19 19 ALA ALA A . n A 1 33 GLU 33 20 20 GLU GLU A . n A 1 34 LEU 34 21 21 LEU LEU A . n A 1 35 VAL 35 22 22 VAL VAL A . n A 1 36 ALA 36 23 23 ALA ALA A . n A 1 37 MET 37 24 24 MET MET A . n A 1 38 VAL 38 25 25 VAL VAL A . n A 1 39 SER 39 26 26 SER SER A . n A 1 40 LYS 40 27 27 LYS LYS A . n A 1 41 ARG 41 28 28 ARG ARG A . n A 1 42 LEU 42 29 29 LEU LEU A . n A 1 43 SER 43 30 30 SER SER A . n A 1 44 GLN 44 31 31 GLN GLN A . n A 1 45 PHE 45 32 32 PHE PHE A . n A 1 46 GLY 46 33 33 GLY GLY A . n A 1 47 TYR 47 34 34 TYR TYR A . n A 1 48 HIS 48 35 35 HIS HIS A . n A 1 49 LYS 49 36 36 LYS LYS A . n A 1 50 TYR 50 37 37 TYR TYR A . n A 1 51 ASN 51 38 38 ASN ASN A . n A 1 52 THR 52 39 39 THR THR A . n A 1 53 LEU 53 40 40 LEU LEU A . n A 1 54 LEU 54 41 41 LEU LEU A . n A 1 55 ALA 55 42 42 ALA ALA A . n A 1 56 THR 56 43 43 THR THR A . n A 1 57 SER 57 44 44 SER SER A . n A 1 58 LEU 58 45 45 LEU LEU A . n A 1 59 CYS 59 46 46 CYS CYS A . n A 1 60 ARG 60 47 47 ARG ARG A . n A 1 61 ASP 61 48 48 ASP ASP A . n A 1 62 GLU 62 49 49 GLU GLU A . n A 1 63 VAL 63 50 50 VAL VAL A . n A 1 64 THR 64 51 51 THR THR A . n A 1 65 ARG 65 52 52 ARG ARG A . n A 1 66 PRO 66 53 53 PRO PRO A . n A 1 67 LEU 67 54 54 LEU LEU A . n A 1 68 GLU 68 55 55 GLU GLU A . n A 1 69 GLN 69 56 56 GLN GLN A . n A 1 70 ASP 70 57 57 ASP ASP A . n A 1 71 PHE 71 58 58 PHE PHE A . n A 1 72 GLY 72 59 59 GLY GLY A . n A 1 73 GLU 73 60 60 GLU GLU A . n A 1 74 VAL 74 61 61 VAL VAL A . n A 1 75 TYR 75 62 62 TYR TYR A . n A 1 76 GLY 76 63 63 GLY GLY A . n A 1 77 LYS 77 64 64 LYS LYS A . n A 1 78 HIS 78 65 65 HIS HIS A . n A 1 79 PHE 79 66 66 PHE PHE A . n A 1 80 THR 80 67 67 THR THR A . n A 1 81 MET 81 68 68 MET MET A . n A 1 82 GLY 82 69 69 GLY GLY A . n A 1 83 GLY 83 70 70 GLY GLY A . n A 1 84 LEU 84 71 71 LEU LEU A . n A 1 85 ALA 85 72 72 ALA ALA A . n A 1 86 GLY 86 73 73 GLY GLY A . n A 1 87 PHE 87 74 74 PHE PHE A . n A 1 88 PRO 88 75 75 PRO PRO A . n A 1 89 PHE 89 76 76 PHE PHE A . n A 1 90 GLY 90 77 77 GLY GLY A . n A 1 91 GLY 91 78 78 GLY GLY A . n A 1 92 LEU 92 79 79 LEU LEU A . n A 1 93 THR 93 80 80 THR THR A . n A 1 94 GLY 94 81 81 GLY GLY A . n A 1 95 PHE 95 82 82 PHE PHE A . n A 1 96 GLY 96 83 83 GLY GLY A . n A 1 97 ALA 97 84 84 ALA ALA A . n A 1 98 MET 98 85 85 MET MET A . n A 1 99 ALA 99 86 86 ALA ALA A . n A 1 100 GLY 100 87 87 GLY GLY A . n A 1 101 HIS 101 88 88 HIS HIS A . n A 1 102 ILE 102 89 89 ILE ILE A . n A 1 103 PRO 103 90 90 PRO PRO A . n A 1 104 ASP 104 91 91 ASP ASP A . n A 1 105 GLY 105 92 92 GLY GLY A . n A 1 106 GLY 106 93 93 GLY GLY A . n A 1 107 SER 107 94 94 SER SER A . n A 1 108 CYS 108 95 95 CYS CYS A . n A 1 109 LEU 109 96 96 LEU LEU A . n A 1 110 LEU 110 97 97 LEU LEU A . n A 1 111 ILE 111 98 98 ILE ILE A . n A 1 112 TYR 112 99 99 TYR TYR A . n A 1 113 GLY 113 100 100 GLY GLY A . n A 1 114 SER 114 101 101 SER SER A . n A 1 115 HIS 115 102 102 HIS HIS A . n A 1 116 VAL 116 103 103 VAL VAL A . n A 1 117 GLY 117 104 104 GLY GLY A . n A 1 118 VAL 118 105 105 VAL VAL A . n A 1 119 SER 119 106 106 SER SER A . n A 1 120 TRP 120 107 107 TRP TRP A . n A 1 121 GLU 121 108 108 GLU GLU A . n A 1 122 GLY 122 109 109 GLY GLY A . n A 1 123 LYS 123 110 110 LYS LYS A . n A 1 124 TRP 124 111 111 TRP TRP A . n A 1 125 GLY 125 112 112 GLY GLY A . n A 1 126 THR 126 113 113 THR THR A . n A 1 127 VAL 127 114 114 VAL VAL A . n A 1 128 ALA 128 115 115 ALA ALA A . n A 1 129 ARG 129 116 ? ? ? A . n A 1 130 ARG 130 117 ? ? ? A . n A 1 131 GLY 131 118 ? ? ? A . n A 1 132 ARG 132 119 ? ? ? A . n A 1 133 GLU 133 120 ? ? ? A . n A 1 134 LYS 134 121 ? ? ? A . n A 1 135 GLY 135 122 ? ? ? A . n A 1 136 GLY 136 123 123 GLY GLY A . n A 1 137 ALA 137 124 124 ALA ALA A . n A 1 138 CYS 138 125 125 CYS CYS A . n A 1 139 CYS 139 126 126 CYS CYS A . n A 1 140 GLY 140 127 127 GLY GLY A . n A 1 141 SER 141 128 128 SER SER A . n A 1 142 ALA 142 129 129 ALA ALA A . n A 1 143 VAL 143 130 130 VAL VAL A . n A 1 144 ALA 144 131 131 ALA ALA A . n A 1 145 ALA 145 132 132 ALA ALA A . n A 1 146 ALA 146 133 133 ALA ALA A . n A 1 147 GLN 147 134 134 GLN GLN A . n A 1 148 ALA 148 135 135 ALA ALA A . n A 1 149 VAL 149 136 136 VAL VAL A . n A 1 150 THR 150 137 137 THR THR A . n A 1 151 GLN 151 138 138 GLN GLN A . n A 1 152 ALA 152 139 139 ALA ALA A . n A 1 153 TYR 153 140 140 TYR TYR A . n A 1 154 GLN 154 141 141 GLN GLN A . n A 1 155 ALA 155 142 ? ? ? A . n A 1 156 THR 156 143 ? ? ? A . n A 1 157 LEU 157 144 ? ? ? A . n A 1 158 ASP 158 145 ? ? ? A . n A 1 159 GLU 159 146 ? ? ? A . n A 1 160 SER 160 147 ? ? ? A . n A 1 161 SER 161 148 ? ? ? A . n A 1 162 SER 162 149 ? ? ? A . n A 1 163 SER 163 150 ? ? ? A . n A 1 164 SER 164 151 ? ? ? A . n A 1 165 SER 165 152 ? ? ? A . n A 1 166 SER 166 153 ? ? ? A . n A 1 167 SER 167 154 ? ? ? A . n A 1 168 ALA 168 155 ? ? ? A . n A 1 169 THR 169 156 ? ? ? A . n A 1 170 SER 170 157 ? ? ? A . n A 1 171 THR 171 158 ? ? ? A . n A 1 172 PRO 172 159 ? ? ? A . n A 1 173 VAL 173 160 ? ? ? A . n A 1 174 TYR 174 161 ? ? ? A . n A 1 175 ARG 175 162 ? ? ? A . n A 1 176 TYR 176 163 ? ? ? A . n A 1 177 SER 177 164 ? ? ? A . n A 1 178 ASN 178 165 ? ? ? A . n A 1 179 ASP 179 166 166 ASP ASP A . n A 1 180 PRO 180 167 167 PRO PRO A . n A 1 181 LEU 181 168 168 LEU LEU A . n A 1 182 ASP 182 169 169 ASP ASP A . n A 1 183 ALA 183 170 170 ALA ALA A . n A 1 184 GLN 184 171 171 GLN GLN A . n A 1 185 GLN 185 172 172 GLN GLN A . n A 1 186 GLY 186 173 173 GLY GLY A . n A 1 187 TYR 187 174 174 TYR TYR A . n A 1 188 VAL 188 175 175 VAL VAL A . n A 1 189 ARG 189 176 176 ARG ARG A . n A 1 190 ASP 190 177 177 ASP ASP A . n A 1 191 MET 191 178 178 MET MET A . n A 1 192 LEU 192 179 179 LEU LEU A . n A 1 193 ARG 193 180 180 ARG ARG A . n A 1 194 PRO 194 181 181 PRO PRO A . n A 1 195 TYR 195 182 182 TYR TYR A . n A 1 196 ALA 196 183 183 ALA ALA A . n A 1 197 ALA 197 184 184 ALA ALA A . n A 1 198 THR 198 185 185 THR THR A . n A 1 199 LEU 199 186 186 LEU LEU A . n A 1 200 SER 200 187 187 SER SER A . n A 1 201 GLU 201 188 188 GLU GLU A . n A 1 202 ALA 202 189 189 ALA ALA A . n A 1 203 GLU 203 190 190 GLU GLU A . n A 1 204 ASP 204 191 191 ASP ASP A . n A 1 205 VAL 205 192 192 VAL VAL A . n A 1 206 MET 206 193 193 MET MET A . n A 1 207 VAL 207 194 194 VAL VAL A . n A 1 208 THR 208 195 195 THR THR A . n A 1 209 LEU 209 196 196 LEU LEU A . n A 1 210 PRO 210 197 197 PRO PRO A . n A 1 211 VAL 211 198 198 VAL VAL A . n A 1 212 SER 212 199 199 SER SER A . n A 1 213 VAL 213 200 200 VAL VAL A . n A 1 214 TYR 214 201 201 TYR TYR A . n A 1 215 ASP 215 202 202 ASP ASP A . n A 1 216 ALA 216 203 203 ALA ALA A . n A 1 217 GLN 217 204 204 GLN GLN A . n A 1 218 GLN 218 205 205 GLN GLN A . n A 1 219 LYS 219 206 206 LYS LYS A . n A 1 220 LEU 220 207 207 LEU LEU A . n A 1 221 VAL 221 208 208 VAL VAL A . n A 1 222 THR 222 209 209 THR THR A . n A 1 223 ARG 223 210 210 ARG ARG A . n A 1 224 ILE 224 211 211 ILE ILE A . n A 1 225 LEU 225 212 212 LEU LEU A . n A 1 226 ASP 226 213 213 ASP ASP A . n A 1 227 GLU 227 214 214 GLU GLU A . n A 1 228 GLY 228 215 215 GLY GLY A . n A 1 229 SER 229 216 ? ? ? A . n A 1 230 ASN 230 217 ? ? ? A . n A 1 231 HIS 231 218 ? ? ? A . n A 1 232 ILE 232 219 ? ? ? A . n A 1 233 ASP 233 220 ? ? ? A . n A 1 234 GLY 234 221 ? ? ? A . n A 1 235 ASP 235 222 ? ? ? A . n A 1 236 GLY 236 223 ? ? ? A . n A 1 237 GLN 237 224 224 GLN GLN A . n A 1 238 ILE 238 225 225 ILE ILE A . n A 1 239 ALA 239 226 226 ALA ALA A . n A 1 240 VAL 240 227 227 VAL VAL A . n A 1 241 VAL 241 228 228 VAL VAL A . n A 1 242 GLY 242 229 229 GLY GLY A . n A 1 243 GLY 243 230 230 GLY GLY A . n A 1 244 ILE 244 231 231 ILE ILE A . n A 1 245 GLN 245 232 232 GLN GLN A . n A 1 246 ILE 246 233 233 ILE ILE A . n A 1 247 ASN 247 234 234 ASN ASN A . n A 1 248 THR 248 235 235 THR THR A . n A 1 249 PRO 249 236 236 PRO PRO A . n A 1 250 LYS 250 237 237 LYS LYS A . n A 1 251 GLU 251 238 238 GLU GLU A . n A 1 252 MET 252 239 239 MET MET A . n A 1 253 SER 253 240 240 SER SER A . n A 1 254 ASP 254 241 241 ASP ASP A . n A 1 255 PHE 255 242 242 PHE PHE A . n A 1 256 PHE 256 243 243 PHE PHE A . n A 1 257 VAL 257 244 244 VAL VAL A . n A 1 258 VAL 258 245 245 VAL VAL A . n A 1 259 ARG 259 246 246 ARG ARG A . n A 1 260 ARG 260 247 247 ARG ARG A . n A 1 261 PHE 261 248 248 PHE PHE A . n A 1 262 CYS 262 249 249 CYS CYS A . n A 1 263 ILE 263 250 250 ILE ILE A . n A 1 264 ARG 264 251 251 ARG ARG A . n A 1 265 ASP 265 252 252 ASP ASP A . n A 1 266 SER 266 253 253 SER SER A . n A 1 267 SER 267 254 254 SER SER A . n A 1 268 GLY 268 255 255 GLY GLY A . n A 1 269 ASN 269 256 256 ASN ASN A . n A 1 270 MET 270 257 257 MET MET A . n A 1 271 VAL 271 258 258 VAL VAL A . n A 1 272 GLU 272 259 259 GLU GLU A . n A 1 273 ASN 273 260 260 ASN ASN A . n A 1 274 PHE 274 261 261 PHE PHE A . n A 1 275 MET 275 262 262 MET MET A . n A 1 276 PRO 276 263 ? ? ? A . n A 1 277 LEU 277 264 ? ? ? A . n A 1 278 THR 278 265 ? ? ? A . n A 1 279 ALA 279 266 ? ? ? A . n A 1 280 GLY 280 267 ? ? ? A . n A 1 281 ARG 281 268 ? ? ? A . n A 1 282 GLU 282 269 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 500 ZN ZN A . C 3 CL 1 302 502 CL CL A . D 4 HOH 1 401 23 HOH HOH A . D 4 HOH 2 402 3 HOH HOH A . D 4 HOH 3 403 20 HOH HOH A . D 4 HOH 4 404 9 HOH HOH A . D 4 HOH 5 405 4 HOH HOH A . D 4 HOH 6 406 7 HOH HOH A . D 4 HOH 7 407 13 HOH HOH A . D 4 HOH 8 408 8 HOH HOH A . D 4 HOH 9 409 17 HOH HOH A . D 4 HOH 10 410 11 HOH HOH A . D 4 HOH 11 411 6 HOH HOH A . D 4 HOH 12 412 22 HOH HOH A . D 4 HOH 13 413 5 HOH HOH A . D 4 HOH 14 414 30 HOH HOH A . D 4 HOH 15 415 18 HOH HOH A . D 4 HOH 16 416 10 HOH HOH A . D 4 HOH 17 417 12 HOH HOH A . D 4 HOH 18 418 15 HOH HOH A . D 4 HOH 19 419 2 HOH HOH A . D 4 HOH 20 420 1 HOH HOH A . D 4 HOH 21 421 31 HOH HOH A . D 4 HOH 22 422 32 HOH HOH A . D 4 HOH 23 423 36 HOH HOH A . D 4 HOH 24 424 26 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2760 ? 1 MORE -111 ? 1 'SSA (A^2)' 17470 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 -13.1772692207 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 67.7911732889 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 59 ? A CYS 46 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 115 ? A HIS 102 ? 1_555 104.5 ? 2 SG ? A CYS 59 ? A CYS 46 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 139 ? A CYS 126 ? 1_555 114.1 ? 3 NE2 ? A HIS 115 ? A HIS 102 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 139 ? A CYS 126 ? 1_555 107.0 ? 4 SG ? A CYS 59 ? A CYS 46 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 419 ? 1_555 113.3 ? 5 NE2 ? A HIS 115 ? A HIS 102 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 419 ? 1_555 95.9 ? 6 SG ? A CYS 139 ? A CYS 126 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 419 ? 1_555 118.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-12-07 2 'Structure model' 1 1 2017-01-18 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' diffrn_source 2 4 'Structure model' chem_comp_atom 3 4 'Structure model' chem_comp_bond 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.compound_details ? _pdbx_entry_details.entry_id 5B60 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;The sequence database of this protein is BAV00141 in GenBank. The residues (-12)-1 are N-terminal expression tags. This structure is S47R mutant. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 49 ? ? NH2 A ARG 52 ? ? 1.77 2 1 O A MET 262 ? ? O A HOH 401 ? ? 1.81 3 1 OG1 A THR 235 ? ? O A HOH 402 ? ? 1.97 4 1 O A THR 235 ? ? O A HOH 402 ? ? 2.04 5 1 OE1 A GLN 232 ? ? O A HOH 403 ? ? 2.15 6 1 O A GLY 63 ? ? O A HOH 404 ? ? 2.16 7 1 OG A SER 240 ? ? O A HOH 405 ? ? 2.16 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 47 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 THR _pdbx_validate_symm_contact.auth_seq_id_2 67 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_556 _pdbx_validate_symm_contact.dist 2.02 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 72 ? ? 66.76 -3.62 2 1 ASP A 169 ? ? -149.05 47.25 3 1 PRO A 236 ? ? -39.73 151.77 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 9 ? CG ? A LYS 22 CG 2 1 Y 1 A LYS 9 ? CD ? A LYS 22 CD 3 1 Y 1 A LYS 9 ? CE ? A LYS 22 CE 4 1 Y 1 A LYS 9 ? NZ ? A LYS 22 NZ 5 1 Y 1 A LYS 10 ? CG ? A LYS 23 CG 6 1 Y 1 A LYS 10 ? CD ? A LYS 23 CD 7 1 Y 1 A LYS 10 ? CE ? A LYS 23 CE 8 1 Y 1 A LYS 10 ? NZ ? A LYS 23 NZ 9 1 Y 1 A ASP 91 ? CG ? A ASP 104 CG 10 1 Y 1 A ASP 91 ? OD1 ? A ASP 104 OD1 11 1 Y 1 A ASP 91 ? OD2 ? A ASP 104 OD2 12 1 Y 1 A TRP 107 ? CG ? A TRP 120 CG 13 1 Y 1 A TRP 107 ? CD1 ? A TRP 120 CD1 14 1 Y 1 A TRP 107 ? CD2 ? A TRP 120 CD2 15 1 Y 1 A TRP 107 ? NE1 ? A TRP 120 NE1 16 1 Y 1 A TRP 107 ? CE2 ? A TRP 120 CE2 17 1 Y 1 A TRP 107 ? CE3 ? A TRP 120 CE3 18 1 Y 1 A TRP 107 ? CZ2 ? A TRP 120 CZ2 19 1 Y 1 A TRP 107 ? CZ3 ? A TRP 120 CZ3 20 1 Y 1 A TRP 107 ? CH2 ? A TRP 120 CH2 21 1 Y 1 A GLU 108 ? CG ? A GLU 121 CG 22 1 Y 1 A GLU 108 ? CD ? A GLU 121 CD 23 1 Y 1 A GLU 108 ? OE1 ? A GLU 121 OE1 24 1 Y 1 A GLU 108 ? OE2 ? A GLU 121 OE2 25 1 Y 1 A LYS 110 ? CG ? A LYS 123 CG 26 1 Y 1 A LYS 110 ? CD ? A LYS 123 CD 27 1 Y 1 A LYS 110 ? CE ? A LYS 123 CE 28 1 Y 1 A LYS 110 ? NZ ? A LYS 123 NZ 29 1 Y 1 A GLN 138 ? CG ? A GLN 151 CG 30 1 Y 1 A GLN 138 ? CD ? A GLN 151 CD 31 1 Y 1 A GLN 138 ? OE1 ? A GLN 151 OE1 32 1 Y 1 A GLN 138 ? NE2 ? A GLN 151 NE2 33 1 Y 1 A GLN 141 ? CG ? A GLN 154 CG 34 1 Y 1 A GLN 141 ? CD ? A GLN 154 CD 35 1 Y 1 A GLN 141 ? OE1 ? A GLN 154 OE1 36 1 Y 1 A GLN 141 ? NE2 ? A GLN 154 NE2 37 1 Y 1 A TYR 174 ? CG ? A TYR 187 CG 38 1 Y 1 A TYR 174 ? CD1 ? A TYR 187 CD1 39 1 Y 1 A TYR 174 ? CD2 ? A TYR 187 CD2 40 1 Y 1 A TYR 174 ? CE1 ? A TYR 187 CE1 41 1 Y 1 A TYR 174 ? CE2 ? A TYR 187 CE2 42 1 Y 1 A TYR 174 ? CZ ? A TYR 187 CZ 43 1 Y 1 A TYR 174 ? OH ? A TYR 187 OH 44 1 Y 1 A GLU 188 ? CG ? A GLU 201 CG 45 1 Y 1 A GLU 188 ? CD ? A GLU 201 CD 46 1 Y 1 A GLU 188 ? OE1 ? A GLU 201 OE1 47 1 Y 1 A GLU 188 ? OE2 ? A GLU 201 OE2 48 1 Y 1 A GLU 190 ? CG ? A GLU 203 CG 49 1 Y 1 A GLU 190 ? CD ? A GLU 203 CD 50 1 Y 1 A GLU 190 ? OE1 ? A GLU 203 OE1 51 1 Y 1 A GLU 190 ? OE2 ? A GLU 203 OE2 52 1 Y 1 A LYS 237 ? CG ? A LYS 250 CG 53 1 Y 1 A LYS 237 ? CD ? A LYS 250 CD 54 1 Y 1 A LYS 237 ? CE ? A LYS 250 CE 55 1 Y 1 A LYS 237 ? NZ ? A LYS 250 NZ 56 1 Y 1 A GLU 238 ? CG ? A GLU 251 CG 57 1 Y 1 A GLU 238 ? CD ? A GLU 251 CD 58 1 Y 1 A GLU 238 ? OE1 ? A GLU 251 OE1 59 1 Y 1 A GLU 238 ? OE2 ? A GLU 251 OE2 60 1 Y 1 A ASP 252 ? CG ? A ASP 265 CG 61 1 Y 1 A ASP 252 ? OD1 ? A ASP 265 OD1 62 1 Y 1 A ASP 252 ? OD2 ? A ASP 265 OD2 63 1 Y 1 A SER 254 ? OG ? A SER 267 OG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -12 ? A MET 1 2 1 Y 1 A GLY -11 ? A GLY 2 3 1 Y 1 A HIS -10 ? A HIS 3 4 1 Y 1 A HIS -9 ? A HIS 4 5 1 Y 1 A HIS -8 ? A HIS 5 6 1 Y 1 A HIS -7 ? A HIS 6 7 1 Y 1 A HIS -6 ? A HIS 7 8 1 Y 1 A HIS -5 ? A HIS 8 9 1 Y 1 A SER -4 ? A SER 9 10 1 Y 1 A GLN -3 ? A GLN 10 11 1 Y 1 A ASP -2 ? A ASP 11 12 1 Y 1 A PRO -1 ? A PRO 12 13 1 Y 1 A ASN 0 ? A ASN 13 14 1 Y 1 A SER 1 ? A SER 14 15 1 Y 1 A ASN 2 ? A ASN 15 16 1 Y 1 A ARG 116 ? A ARG 129 17 1 Y 1 A ARG 117 ? A ARG 130 18 1 Y 1 A GLY 118 ? A GLY 131 19 1 Y 1 A ARG 119 ? A ARG 132 20 1 Y 1 A GLU 120 ? A GLU 133 21 1 Y 1 A LYS 121 ? A LYS 134 22 1 Y 1 A GLY 122 ? A GLY 135 23 1 Y 1 A ALA 142 ? A ALA 155 24 1 Y 1 A THR 143 ? A THR 156 25 1 Y 1 A LEU 144 ? A LEU 157 26 1 Y 1 A ASP 145 ? A ASP 158 27 1 Y 1 A GLU 146 ? A GLU 159 28 1 Y 1 A SER 147 ? A SER 160 29 1 Y 1 A SER 148 ? A SER 161 30 1 Y 1 A SER 149 ? A SER 162 31 1 Y 1 A SER 150 ? A SER 163 32 1 Y 1 A SER 151 ? A SER 164 33 1 Y 1 A SER 152 ? A SER 165 34 1 Y 1 A SER 153 ? A SER 166 35 1 Y 1 A SER 154 ? A SER 167 36 1 Y 1 A ALA 155 ? A ALA 168 37 1 Y 1 A THR 156 ? A THR 169 38 1 Y 1 A SER 157 ? A SER 170 39 1 Y 1 A THR 158 ? A THR 171 40 1 Y 1 A PRO 159 ? A PRO 172 41 1 Y 1 A VAL 160 ? A VAL 173 42 1 Y 1 A TYR 161 ? A TYR 174 43 1 Y 1 A ARG 162 ? A ARG 175 44 1 Y 1 A TYR 163 ? A TYR 176 45 1 Y 1 A SER 164 ? A SER 177 46 1 Y 1 A ASN 165 ? A ASN 178 47 1 Y 1 A SER 216 ? A SER 229 48 1 Y 1 A ASN 217 ? A ASN 230 49 1 Y 1 A HIS 218 ? A HIS 231 50 1 Y 1 A ILE 219 ? A ILE 232 51 1 Y 1 A ASP 220 ? A ASP 233 52 1 Y 1 A GLY 221 ? A GLY 234 53 1 Y 1 A ASP 222 ? A ASP 235 54 1 Y 1 A GLY 223 ? A GLY 236 55 1 Y 1 A PRO 263 ? A PRO 276 56 1 Y 1 A LEU 264 ? A LEU 277 57 1 Y 1 A THR 265 ? A THR 278 58 1 Y 1 A ALA 266 ? A ALA 279 59 1 Y 1 A GLY 267 ? A GLY 280 60 1 Y 1 A ARG 268 ? A ARG 281 61 1 Y 1 A GLU 269 ? A GLU 282 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 ZN ZN ZN N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Singapore National Research Foundation' _pdbx_audit_support.country Singapore _pdbx_audit_support.grant_number NRF-RF2009-RF001-267 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CHLORIDE ION' CL 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5B5Y _pdbx_initial_refinement_model.details ? #