data_5BZG # _entry.id 5BZG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5BZG WWPDB D_1000210185 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5BZC PDB . unspecified 5BZE PDB . unspecified 5BZF PDB . unspecified 5BZH PDB . unspecified 5BZI PDB . unspecified 5BZJ PDB . unspecified 5BZM PDB . unspecified 5BZN PDB . unspecified 5BZO PDB . unspecified 5BZQ PDB . unspecified 5BZP PDB . unspecified 5BZR PDB . unspecified 5BZS PDB . unspecified 5BZT PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5BZG _pdbx_database_status.recvd_initial_deposition_date 2015-06-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, L.K.' 1 'Finzel, B.C.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the murine cd44 hyaluronan binding domain complex with a small molecule' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Liu, L.K.' 1 primary 'Finzel, B.C.' 2 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 118.2050 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5BZG _cell.details ? _cell.formula_units_Z ? _cell.length_a 30.9870 _cell.length_a_esd ? _cell.length_b 81.7440 _cell.length_b_esd ? _cell.length_c 32.2360 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5BZG _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CD44 antigen' 16855.803 1 ? 'H23M; Q24N' 'HYALURONAN BINDING DOMAIN, UNP RESIDUES 21-171' ? 2 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 1 ? ? ? ? 3 non-polymer syn 2-methyl-1,2,3,4-tetrahydroisoquinolin-5-amine 162.232 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Extracellular matrix receptor III,ECMR-III,GP90 lymphocyte homing/adhesion receptor,HUTCH-I,Hermes antigen,Hyaluronate receptor,Lymphocyte antigen 24,Ly-24,Phagocytic glycoprotein 1,PGP-1,Phagocytic glycoprotein I,PGP-I ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICA ANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDI ; _entity_poly.pdbx_seq_one_letter_code_can ;MNQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICA ANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 GLN n 1 4 ILE n 1 5 ASP n 1 6 LEU n 1 7 ASN n 1 8 VAL n 1 9 THR n 1 10 CYS n 1 11 ARG n 1 12 TYR n 1 13 ALA n 1 14 GLY n 1 15 VAL n 1 16 PHE n 1 17 HIS n 1 18 VAL n 1 19 GLU n 1 20 LYS n 1 21 ASN n 1 22 GLY n 1 23 ARG n 1 24 TYR n 1 25 SER n 1 26 ILE n 1 27 SER n 1 28 ARG n 1 29 THR n 1 30 GLU n 1 31 ALA n 1 32 ALA n 1 33 ASP n 1 34 LEU n 1 35 CYS n 1 36 GLN n 1 37 ALA n 1 38 PHE n 1 39 ASN n 1 40 SER n 1 41 THR n 1 42 LEU n 1 43 PRO n 1 44 THR n 1 45 MET n 1 46 ASP n 1 47 GLN n 1 48 MET n 1 49 LYS n 1 50 LEU n 1 51 ALA n 1 52 LEU n 1 53 SER n 1 54 LYS n 1 55 GLY n 1 56 PHE n 1 57 GLU n 1 58 THR n 1 59 CYS n 1 60 ARG n 1 61 TYR n 1 62 GLY n 1 63 PHE n 1 64 ILE n 1 65 GLU n 1 66 GLY n 1 67 ASN n 1 68 VAL n 1 69 VAL n 1 70 ILE n 1 71 PRO n 1 72 ARG n 1 73 ILE n 1 74 HIS n 1 75 PRO n 1 76 ASN n 1 77 ALA n 1 78 ILE n 1 79 CYS n 1 80 ALA n 1 81 ALA n 1 82 ASN n 1 83 HIS n 1 84 THR n 1 85 GLY n 1 86 VAL n 1 87 TYR n 1 88 ILE n 1 89 LEU n 1 90 VAL n 1 91 THR n 1 92 SER n 1 93 ASN n 1 94 THR n 1 95 SER n 1 96 HIS n 1 97 TYR n 1 98 ASP n 1 99 THR n 1 100 TYR n 1 101 CYS n 1 102 PHE n 1 103 ASN n 1 104 ALA n 1 105 SER n 1 106 ALA n 1 107 PRO n 1 108 PRO n 1 109 GLU n 1 110 GLU n 1 111 ASP n 1 112 CYS n 1 113 THR n 1 114 SER n 1 115 VAL n 1 116 THR n 1 117 ASP n 1 118 LEU n 1 119 PRO n 1 120 ASN n 1 121 SER n 1 122 PHE n 1 123 ASP n 1 124 GLY n 1 125 PRO n 1 126 VAL n 1 127 THR n 1 128 ILE n 1 129 THR n 1 130 ILE n 1 131 VAL n 1 132 ASN n 1 133 ARG n 1 134 ASP n 1 135 GLY n 1 136 THR n 1 137 ARG n 1 138 TYR n 1 139 SER n 1 140 LYS n 1 141 LYS n 1 142 GLY n 1 143 GLU n 1 144 TYR n 1 145 ARG n 1 146 THR n 1 147 HIS n 1 148 GLN n 1 149 GLU n 1 150 ASP n 1 151 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 151 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Cd44, Ly-24' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CD44_MOUSE _struct_ref.pdbx_db_accession P15379 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HQQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICA ANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDI ; _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5BZG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P15379 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 171 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 23 _struct_ref_seq.pdbx_auth_seq_align_end 173 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5BZG MET A 1 ? UNP P15379 HIS 21 'engineered mutation' 23 1 1 5BZG ASN A 2 ? UNP P15379 GLN 22 'engineered mutation' 24 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4X6 non-polymer . 2-methyl-1,2,3,4-tetrahydroisoquinolin-5-amine ? 'C10 H14 N2' 162.232 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5BZG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG MME 5000, MES, (NH4)2SO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type NOIR-1 _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-01-29 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 4.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 4.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 19.588 _reflns.entry_id 5BZG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.160 _reflns.d_resolution_low 9.64 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7318 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 94.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs 0.993 _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.787 _reflns.pdbx_Rmerge_I_obs 0.116 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.930 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.135 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 27713 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.160 2.210 ? 2.760 ? 919 575 ? 328 57.000 ? ? 0.806 ? 0.401 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.481 ? 0 1 1 ? ? 2.210 2.270 ? 4.650 ? 2069 549 ? 539 98.200 ? ? 0.907 ? 0.304 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.352 ? 0 2 1 ? ? 2.270 2.340 ? 4.540 ? 2042 542 ? 524 96.700 ? ? 0.920 ? 0.314 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.365 ? 0 3 1 ? ? 2.340 2.410 ? 4.620 ? 1911 506 ? 499 98.600 ? ? 0.913 ? 0.298 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.346 ? 0 4 1 ? ? 2.410 2.490 ? 4.790 ? 1936 520 ? 500 96.200 ? ? 0.952 ? 0.289 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.335 ? 0 5 1 ? ? 2.490 2.580 ? 5.720 ? 1883 497 ? 486 97.800 ? ? 0.939 ? 0.252 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.292 ? 0 6 1 ? ? 2.580 2.670 ? 6.050 ? 1706 460 ? 442 96.100 ? ? 0.948 ? 0.224 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.259 ? 0 7 1 ? ? 2.670 2.780 ? 6.810 ? 1749 451 ? 449 99.600 ? ? 0.960 ? 0.203 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.235 ? 0 8 1 ? ? 2.780 2.910 ? 8.390 ? 1635 441 ? 428 97.100 ? ? 0.968 ? 0.169 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.197 ? 0 9 1 ? ? 2.910 3.050 ? 11.130 ? 1611 420 ? 416 99.000 ? ? 0.989 ? 0.116 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.135 ? 0 10 1 ? ? 3.050 3.210 ? 14.020 ? 1462 400 ? 385 96.200 ? ? 0.990 ? 0.094 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.110 ? 0 11 1 ? ? 3.210 3.410 ? 16.020 ? 1455 373 ? 374 100.0 ? ? 0.993 ? 0.080 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.093 ? 0 12 1 ? ? 3.410 3.650 ? 18.740 ? 1341 363 ? 351 96.700 ? ? 0.996 ? 0.064 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.074 ? 0 13 1 ? ? 3.650 3.940 ? 23.040 ? 1247 328 ? 327 99.700 ? ? 0.997 ? 0.051 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.060 ? 0 14 1 ? ? 3.940 4.310 ? 26.040 ? 1112 299 ? 293 98.000 ? ? 0.997 ? 0.048 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.056 ? 0 15 1 ? ? 4.310 4.820 ? 28.640 ? 1027 277 ? 275 99.300 ? ? 0.998 ? 0.041 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.048 ? 0 16 1 ? ? 4.820 5.570 ? 24.550 ? 917 250 ? 247 98.800 ? ? 0.996 ? 0.051 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.059 ? 0 17 1 ? ? 5.570 6.820 ? 21.520 ? 785 212 ? 208 98.100 ? ? 0.997 ? 0.056 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.065 ? 0 18 1 ? ? 6.820 9.640 ? 27.870 ? 587 161 ? 157 97.500 ? ? 0.997 ? 0.041 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.049 ? 0 19 1 ? ? 9.640 ? ? 35.740 ? 319 96 ? 90 93.800 ? ? 0.999 ? 0.025 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.029 ? 0 20 1 ? ? # _refine.aniso_B[1][1] -1.2300 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.8200 _refine.aniso_B[2][2] 0.9800 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.5200 _refine.B_iso_max 43.160 _refine.B_iso_mean 12.2740 _refine.B_iso_min 2.000 _refine.correlation_coeff_Fo_to_Fc 0.9260 _refine.correlation_coeff_Fo_to_Fc_free 0.8750 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5BZG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1900 _refine.ls_d_res_low 9.64 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6800 _refine.ls_number_reflns_R_free 378 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.3200 _refine.ls_percent_reflns_R_free 5.3000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1935 _refine.ls_R_factor_R_free 0.2416 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1910 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2110 _refine.ls_wR_factor_R_work 0.1682 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3670 _refine.pdbx_overall_ESU_R_Free 0.2340 _refine.pdbx_solvent_vdw_probe_radii 1.4000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.8670 _refine.overall_SU_ML 0.1530 _refine.overall_SU_R_Cruickshank_DPI 0.3669 _refine.overall_SU_R_free 0.2339 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8573 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1900 _refine_hist.d_res_low 9.64 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 1213 _refine_hist.pdbx_number_residues_total 150 _refine_hist.pdbx_B_iso_mean_ligand 31.84 _refine_hist.pdbx_B_iso_mean_solvent 9.42 _refine_hist.pdbx_number_atoms_protein 1171 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.021 1279 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.321 1.956 1750 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 6.642 5.000 161 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.068 23.934 61 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.105 15.000 200 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.828 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.093 0.200 194 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.021 998 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.534 1.500 788 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.998 2.000 1292 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.700 3.000 491 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.815 4.500 458 ? r_scangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.1900 _refine_ls_shell.d_res_low 2.2470 _refine_ls_shell.number_reflns_all 499 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 31 _refine_ls_shell.number_reflns_R_work 468 _refine_ls_shell.percent_reflns_obs 98.6200 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2890 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2000 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5BZG _struct.title 'Crystal structure of the murine CD44 hyaluronan binding domain complex with a small molecule' _struct.pdbx_descriptor 'CD44 antigen' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5BZG _struct_keywords.text 'Link module, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 27 ? PHE A 38 ? SER A 49 PHE A 60 1 ? 12 HELX_P HELX_P2 AA2 THR A 44 ? LYS A 54 ? THR A 66 LYS A 76 1 ? 11 HELX_P HELX_P3 AA3 CYS A 79 ? HIS A 83 ? CYS A 101 HIS A 105 5 ? 5 HELX_P HELX_P4 AA4 HIS A 147 ? ILE A 151 ? HIS A 169 ILE A 173 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 112 SG ? ? A CYS 32 A CYS 134 1_555 ? ? ? ? ? ? ? 2.059 ? disulf2 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 101 SG ? ? A CYS 57 A CYS 123 1_555 ? ? ? ? ? ? ? 2.026 ? disulf3 disulf ? ? A CYS 59 SG ? ? ? 1_555 A CYS 79 SG ? ? A CYS 81 A CYS 101 1_555 ? ? ? ? ? ? ? 2.080 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 85 ? ILE A 88 ? GLY A 107 ILE A 110 AA1 2 VAL A 68 ? ARG A 72 ? VAL A 90 ARG A 94 AA1 3 GLY A 62 ? PHE A 63 ? GLY A 84 PHE A 85 AA1 4 ASP A 98 ? PHE A 102 ? ASP A 120 PHE A 124 AA1 5 VAL A 15 ? LYS A 20 ? VAL A 37 LYS A 42 AA1 6 GLN A 3 ? VAL A 8 ? GLN A 25 VAL A 30 AA1 7 PHE A 122 ? ASN A 132 ? PHE A 144 ASN A 154 AA1 8 ARG A 137 ? GLU A 143 ? ARG A 159 GLU A 165 AA2 1 ARG A 11 ? TYR A 12 ? ARG A 33 TYR A 34 AA2 2 GLU A 110 ? ASP A 111 ? GLU A 132 ASP A 133 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 85 ? O GLY A 107 N ARG A 72 ? N ARG A 94 AA1 2 3 O VAL A 69 ? O VAL A 91 N GLY A 62 ? N GLY A 84 AA1 3 4 N PHE A 63 ? N PHE A 85 O TYR A 100 ? O TYR A 122 AA1 4 5 O THR A 99 ? O THR A 121 N VAL A 18 ? N VAL A 40 AA1 5 6 O GLU A 19 ? O GLU A 41 N ASN A 7 ? N ASN A 29 AA1 6 7 N LEU A 6 ? N LEU A 28 O VAL A 131 ? O VAL A 153 AA1 7 8 N ILE A 128 ? N ILE A 150 O LYS A 140 ? O LYS A 162 AA2 1 2 N ARG A 11 ? N ARG A 33 O ASP A 111 ? O ASP A 133 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A DMS 201 ? 9 'binding site for residue DMS A 201' AC2 Software A 4X6 202 ? 8 'binding site for residue 4X6 A 202' AC3 Software A SO4 203 ? 6 'binding site for residue SO4 A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 CYS A 10 ? CYS A 32 . ? 1_556 ? 2 AC1 9 GLY A 66 ? GLY A 88 . ? 1_555 ? 3 AC1 9 ASN A 67 ? ASN A 89 . ? 1_555 ? 4 AC1 9 CYS A 112 ? CYS A 134 . ? 1_556 ? 5 AC1 9 THR A 113 ? THR A 135 . ? 1_556 ? 6 AC1 9 SER A 114 ? SER A 136 . ? 1_556 ? 7 AC1 9 ARG A 133 ? ARG A 155 . ? 1_556 ? 8 AC1 9 ASP A 134 ? ASP A 156 . ? 1_556 ? 9 AC1 9 HOH E . ? HOH A 306 . ? 1_555 ? 10 AC2 8 ASN A 7 ? ASN A 29 . ? 1_555 ? 11 AC2 8 VAL A 8 ? VAL A 30 . ? 1_555 ? 12 AC2 8 THR A 9 ? THR A 31 . ? 1_555 ? 13 AC2 8 GLU A 19 ? GLU A 41 . ? 1_555 ? 14 AC2 8 ASP A 46 ? ASP A 68 . ? 1_655 ? 15 AC2 8 VAL A 131 ? VAL A 153 . ? 1_555 ? 16 AC2 8 ARG A 133 ? ARG A 155 . ? 1_555 ? 17 AC2 8 HOH E . ? HOH A 313 . ? 1_555 ? 18 AC3 6 ARG A 11 ? ARG A 33 . ? 1_555 ? 19 AC3 6 PHE A 16 ? PHE A 38 . ? 1_555 ? 20 AC3 6 PHE A 38 ? PHE A 60 . ? 1_555 ? 21 AC3 6 SER A 40 ? SER A 62 . ? 1_555 ? 22 AC3 6 ASN A 103 ? ASN A 125 . ? 1_555 ? 23 AC3 6 VAL A 115 ? VAL A 137 . ? 1_555 ? # _atom_sites.entry_id 5BZG _atom_sites.fract_transf_matrix[1][1] 0.032289 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.017169 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012195 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.035250 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 23 ? ? ? A . n A 1 2 ASN 2 24 24 ASN ASN A . n A 1 3 GLN 3 25 25 GLN GLN A . n A 1 4 ILE 4 26 26 ILE ILE A . n A 1 5 ASP 5 27 27 ASP ASP A . n A 1 6 LEU 6 28 28 LEU LEU A . n A 1 7 ASN 7 29 29 ASN ASN A . n A 1 8 VAL 8 30 30 VAL VAL A . n A 1 9 THR 9 31 31 THR THR A . n A 1 10 CYS 10 32 32 CYS CYS A . n A 1 11 ARG 11 33 33 ARG ARG A . n A 1 12 TYR 12 34 34 TYR TYR A . n A 1 13 ALA 13 35 35 ALA ALA A . n A 1 14 GLY 14 36 36 GLY GLY A . n A 1 15 VAL 15 37 37 VAL VAL A . n A 1 16 PHE 16 38 38 PHE PHE A . n A 1 17 HIS 17 39 39 HIS HIS A . n A 1 18 VAL 18 40 40 VAL VAL A . n A 1 19 GLU 19 41 41 GLU GLU A . n A 1 20 LYS 20 42 42 LYS LYS A . n A 1 21 ASN 21 43 43 ASN ASN A . n A 1 22 GLY 22 44 44 GLY GLY A . n A 1 23 ARG 23 45 45 ARG ARG A . n A 1 24 TYR 24 46 46 TYR TYR A . n A 1 25 SER 25 47 47 SER SER A . n A 1 26 ILE 26 48 48 ILE ILE A . n A 1 27 SER 27 49 49 SER SER A . n A 1 28 ARG 28 50 50 ARG ARG A . n A 1 29 THR 29 51 51 THR THR A . n A 1 30 GLU 30 52 52 GLU GLU A . n A 1 31 ALA 31 53 53 ALA ALA A . n A 1 32 ALA 32 54 54 ALA ALA A . n A 1 33 ASP 33 55 55 ASP ASP A . n A 1 34 LEU 34 56 56 LEU LEU A . n A 1 35 CYS 35 57 57 CYS CYS A . n A 1 36 GLN 36 58 58 GLN GLN A . n A 1 37 ALA 37 59 59 ALA ALA A . n A 1 38 PHE 38 60 60 PHE PHE A . n A 1 39 ASN 39 61 61 ASN ASN A . n A 1 40 SER 40 62 62 SER SER A . n A 1 41 THR 41 63 63 THR THR A . n A 1 42 LEU 42 64 64 LEU LEU A . n A 1 43 PRO 43 65 65 PRO PRO A . n A 1 44 THR 44 66 66 THR THR A . n A 1 45 MET 45 67 67 MET MET A . n A 1 46 ASP 46 68 68 ASP ASP A . n A 1 47 GLN 47 69 69 GLN GLN A . n A 1 48 MET 48 70 70 MET MET A . n A 1 49 LYS 49 71 71 LYS LYS A . n A 1 50 LEU 50 72 72 LEU LEU A . n A 1 51 ALA 51 73 73 ALA ALA A . n A 1 52 LEU 52 74 74 LEU LEU A . n A 1 53 SER 53 75 75 SER SER A . n A 1 54 LYS 54 76 76 LYS LYS A . n A 1 55 GLY 55 77 77 GLY GLY A . n A 1 56 PHE 56 78 78 PHE PHE A . n A 1 57 GLU 57 79 79 GLU GLU A . n A 1 58 THR 58 80 80 THR THR A . n A 1 59 CYS 59 81 81 CYS CYS A . n A 1 60 ARG 60 82 82 ARG ARG A . n A 1 61 TYR 61 83 83 TYR TYR A . n A 1 62 GLY 62 84 84 GLY GLY A . n A 1 63 PHE 63 85 85 PHE PHE A . n A 1 64 ILE 64 86 86 ILE ILE A . n A 1 65 GLU 65 87 87 GLU GLU A . n A 1 66 GLY 66 88 88 GLY GLY A . n A 1 67 ASN 67 89 89 ASN ASN A . n A 1 68 VAL 68 90 90 VAL VAL A . n A 1 69 VAL 69 91 91 VAL VAL A . n A 1 70 ILE 70 92 92 ILE ILE A . n A 1 71 PRO 71 93 93 PRO PRO A . n A 1 72 ARG 72 94 94 ARG ARG A . n A 1 73 ILE 73 95 95 ILE ILE A . n A 1 74 HIS 74 96 96 HIS HIS A . n A 1 75 PRO 75 97 97 PRO PRO A . n A 1 76 ASN 76 98 98 ASN ASN A . n A 1 77 ALA 77 99 99 ALA ALA A . n A 1 78 ILE 78 100 100 ILE ILE A . n A 1 79 CYS 79 101 101 CYS CYS A . n A 1 80 ALA 80 102 102 ALA ALA A . n A 1 81 ALA 81 103 103 ALA ALA A . n A 1 82 ASN 82 104 104 ASN ASN A . n A 1 83 HIS 83 105 105 HIS HIS A . n A 1 84 THR 84 106 106 THR THR A . n A 1 85 GLY 85 107 107 GLY GLY A . n A 1 86 VAL 86 108 108 VAL VAL A . n A 1 87 TYR 87 109 109 TYR TYR A . n A 1 88 ILE 88 110 110 ILE ILE A . n A 1 89 LEU 89 111 111 LEU LEU A . n A 1 90 VAL 90 112 112 VAL VAL A . n A 1 91 THR 91 113 113 THR THR A . n A 1 92 SER 92 114 114 SER SER A . n A 1 93 ASN 93 115 115 ASN ASN A . n A 1 94 THR 94 116 116 THR THR A . n A 1 95 SER 95 117 117 SER SER A . n A 1 96 HIS 96 118 118 HIS HIS A . n A 1 97 TYR 97 119 119 TYR TYR A . n A 1 98 ASP 98 120 120 ASP ASP A . n A 1 99 THR 99 121 121 THR THR A . n A 1 100 TYR 100 122 122 TYR TYR A . n A 1 101 CYS 101 123 123 CYS CYS A . n A 1 102 PHE 102 124 124 PHE PHE A . n A 1 103 ASN 103 125 125 ASN ASN A . n A 1 104 ALA 104 126 126 ALA ALA A . n A 1 105 SER 105 127 127 SER SER A . n A 1 106 ALA 106 128 128 ALA ALA A . n A 1 107 PRO 107 129 129 PRO PRO A . n A 1 108 PRO 108 130 130 PRO PRO A . n A 1 109 GLU 109 131 131 GLU GLU A . n A 1 110 GLU 110 132 132 GLU GLU A . n A 1 111 ASP 111 133 133 ASP ASP A . n A 1 112 CYS 112 134 134 CYS CYS A . n A 1 113 THR 113 135 135 THR THR A . n A 1 114 SER 114 136 136 SER SER A . n A 1 115 VAL 115 137 137 VAL VAL A . n A 1 116 THR 116 138 138 THR THR A . n A 1 117 ASP 117 139 139 ASP ASP A . n A 1 118 LEU 118 140 140 LEU LEU A . n A 1 119 PRO 119 141 141 PRO PRO A . n A 1 120 ASN 120 142 142 ASN ASN A . n A 1 121 SER 121 143 143 SER SER A . n A 1 122 PHE 122 144 144 PHE PHE A . n A 1 123 ASP 123 145 145 ASP ASP A . n A 1 124 GLY 124 146 146 GLY GLY A . n A 1 125 PRO 125 147 147 PRO PRO A . n A 1 126 VAL 126 148 148 VAL VAL A . n A 1 127 THR 127 149 149 THR THR A . n A 1 128 ILE 128 150 150 ILE ILE A . n A 1 129 THR 129 151 151 THR THR A . n A 1 130 ILE 130 152 152 ILE ILE A . n A 1 131 VAL 131 153 153 VAL VAL A . n A 1 132 ASN 132 154 154 ASN ASN A . n A 1 133 ARG 133 155 155 ARG ARG A . n A 1 134 ASP 134 156 156 ASP ASP A . n A 1 135 GLY 135 157 157 GLY GLY A . n A 1 136 THR 136 158 158 THR THR A . n A 1 137 ARG 137 159 159 ARG ARG A . n A 1 138 TYR 138 160 160 TYR TYR A . n A 1 139 SER 139 161 161 SER SER A . n A 1 140 LYS 140 162 162 LYS LYS A . n A 1 141 LYS 141 163 163 LYS LYS A . n A 1 142 GLY 142 164 164 GLY GLY A . n A 1 143 GLU 143 165 165 GLU GLU A . n A 1 144 TYR 144 166 166 TYR TYR A . n A 1 145 ARG 145 167 167 ARG ARG A . n A 1 146 THR 146 168 168 THR THR A . n A 1 147 HIS 147 169 169 HIS HIS A . n A 1 148 GLN 148 170 170 GLN GLN A . n A 1 149 GLU 149 171 171 GLU GLU A . n A 1 150 ASP 150 172 172 ASP ASP A . n A 1 151 ILE 151 173 173 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DMS 1 201 1 DMS DMS A . C 3 4X6 1 202 1 4X6 DRG A . D 4 SO4 1 203 1 SO4 SO4 A . E 5 HOH 1 301 19 HOH HOH A . E 5 HOH 2 302 7 HOH HOH A . E 5 HOH 3 303 9 HOH HOH A . E 5 HOH 4 304 2 HOH HOH A . E 5 HOH 5 305 12 HOH HOH A . E 5 HOH 6 306 11 HOH HOH A . E 5 HOH 7 307 14 HOH HOH A . E 5 HOH 8 308 16 HOH HOH A . E 5 HOH 9 309 13 HOH HOH A . E 5 HOH 10 310 5 HOH HOH A . E 5 HOH 11 311 17 HOH HOH A . E 5 HOH 12 312 1 HOH HOH A . E 5 HOH 13 313 4 HOH HOH A . E 5 HOH 14 314 10 HOH HOH A . E 5 HOH 15 315 21 HOH HOH A . E 5 HOH 16 316 18 HOH HOH A . E 5 HOH 17 317 8 HOH HOH A . E 5 HOH 18 318 15 HOH HOH A . E 5 HOH 19 319 6 HOH HOH A . E 5 HOH 20 320 3 HOH HOH A . E 5 HOH 21 321 20 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-29 2 'Structure model' 1 1 2017-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_struct_oper_list 3 2 'Structure model' reflns_shell # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_CSD' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 2 'Structure model' '_reflns_shell.percent_possible_all' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.1.4 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 120 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 120 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 OD1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 120 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 125.11 _pdbx_validate_rmsd_angle.angle_target_value 118.30 _pdbx_validate_rmsd_angle.angle_deviation 6.81 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 46 ? ? -59.58 104.63 2 1 SER A 47 ? ? -151.30 14.90 3 1 GLU A 131 ? ? -122.49 -135.77 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 23 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DIMETHYL SULFOXIDE' DMS 3 2-methyl-1,2,3,4-tetrahydroisoquinolin-5-amine 4X6 4 'SULFATE ION' SO4 5 water HOH #