data_5C20
# 
_entry.id   5C20 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   5C20         pdb_00005c20 10.2210/pdb5c20/pdb 
WWPDB D_1000210896 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-01 
2 'Structure model' 1 1 2016-10-26 
3 'Structure model' 1 2 2017-09-27 
4 'Structure model' 2 0 2020-09-02 
5 'Structure model' 2 1 2023-11-08 
6 'Structure model' 2 2 2024-10-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Database references'     
2  3 'Structure model' 'Data collection'         
3  3 'Structure model' 'Derived calculations'    
4  4 'Structure model' 'Derived calculations'    
5  4 'Structure model' 'Non-polymer description' 
6  4 'Structure model' 'Structure summary'       
7  5 'Structure model' 'Data collection'         
8  5 'Structure model' 'Database references'     
9  5 'Structure model' 'Refinement description'  
10 6 'Structure model' 'Structure summary'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' diffrn_detector               
2  3 'Structure model' pdbx_struct_oper_list         
3  4 'Structure model' chem_comp                     
4  4 'Structure model' entity                        
5  4 'Structure model' pdbx_entity_nonpoly           
6  5 'Structure model' chem_comp_atom                
7  5 'Structure model' chem_comp_bond                
8  5 'Structure model' database_2                    
9  5 'Structure model' pdbx_initial_refinement_model 
10 6 'Structure model' pdbx_entry_details            
11 6 'Structure model' pdbx_modification_feature     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_diffrn_detector.detector'                 
2  3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3  4 'Structure model' '_chem_comp.formula'                        
4  4 'Structure model' '_chem_comp.formula_weight'                 
5  4 'Structure model' '_chem_comp.name'                           
6  4 'Structure model' '_entity.formula_weight'                    
7  4 'Structure model' '_entity.pdbx_description'                  
8  4 'Structure model' '_pdbx_entity_nonpoly.name'                 
9  5 'Structure model' '_database_2.pdbx_DOI'                      
10 5 'Structure model' '_database_2.pdbx_database_accession'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5C20 
_pdbx_database_status.recvd_initial_deposition_date   2015-06-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4GHQ unspecified 
PDB . 4GHT unspecified 
PDB . 5C1U unspecified 
PDB . 5C1X unspecified 
PDB . 5C1Y unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, L.' 1  
'Huang, G.' 2  
'Cai, Q.'   3  
'Zhao, C.'  4  
'Ren, H.'   5  
'Li, P.'    6  
'Li, N.'    7  
'Chen, S.'  8  
'Li, J.'    9  
'Lin, T.'   10 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Mol.Recognit. 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           0952-3499 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            29 
_citation.language                  ? 
_citation.page_first                520 
_citation.page_last                 527 
_citation.title                     
'Optimize the interactions at S4 with efficient inhibitors targeting 3C proteinase from enterovirus 71' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/jmr.2551 
_citation.pdbx_database_id_PubMed   27185390 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhang, L.' 1  ? 
primary 'Huang, G.' 2  ? 
primary 'Cai, Q.'   3  ? 
primary 'Zhao, C.'  4  ? 
primary 'Tang, L.'  5  ? 
primary 'Ren, H.'   6  ? 
primary 'Li, P.'    7  ? 
primary 'Li, N.'    8  ? 
primary 'Huang, J.' 9  ? 
primary 'Chen, X.'  10 ? 
primary 'Guan, Y.'  11 ? 
primary 'You, H.'   12 ? 
primary 'Chen, S.'  13 ? 
primary 'Li, J.'    14 ? 
primary 'Lin, T.'   15 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '3C proteinase' 21391.482 1  3.4.22.28 ? ? ? 
2 non-polymer syn 
;2-methylpropyl N-[(2S)-1-oxidanylidene-1-[[(2S)-1-oxidanyl-3-[(3S)-2-oxidanylidenepyrrolidin-3-yl]propan-2-yl]amino]-3-phenyl-propan-2-yl]carbamate
;
405.488   1  ?         ? ? ? 
3 water       nat water 18.015    13 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGPSLDFALSLLRRNVRQVQTDQGHFTMLGVRDRLAVLPRHSQPGKTIWIEHKLVNILDAVELVDEQGVNLELTLITLDT
NEKFRDITKFIPENISTASDATLVINTEHMPSMFVPVGDVVQYGFLNLSGKPTHRTMMYNFPTKAGQCGGVVTSVGKVIG
IHIGGNGRQGFCAGLKRSYFASEQLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGPSLDFALSLLRRNVRQVQTDQGHFTMLGVRDRLAVLPRHSQPGKTIWIEHKLVNILDAVELVDEQGVNLELTLITLDT
NEKFRDITKFIPENISTASDATLVINTEHMPSMFVPVGDVVQYGFLNLSGKPTHRTMMYNFPTKAGQCGGVVTSVGKVIG
IHIGGNGRQGFCAGLKRSYFASEQLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;2-methylpropyl N-[(2S)-1-oxidanylidene-1-[[(2S)-1-oxidanyl-3-[(3S)-2-oxidanylidenepyrrolidin-3-yl]propan-2-yl]amino]-3-phenyl-propan-2-yl]carbamate
;
GHZ 
3 water HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   PRO n 
1 4   SER n 
1 5   LEU n 
1 6   ASP n 
1 7   PHE n 
1 8   ALA n 
1 9   LEU n 
1 10  SER n 
1 11  LEU n 
1 12  LEU n 
1 13  ARG n 
1 14  ARG n 
1 15  ASN n 
1 16  VAL n 
1 17  ARG n 
1 18  GLN n 
1 19  VAL n 
1 20  GLN n 
1 21  THR n 
1 22  ASP n 
1 23  GLN n 
1 24  GLY n 
1 25  HIS n 
1 26  PHE n 
1 27  THR n 
1 28  MET n 
1 29  LEU n 
1 30  GLY n 
1 31  VAL n 
1 32  ARG n 
1 33  ASP n 
1 34  ARG n 
1 35  LEU n 
1 36  ALA n 
1 37  VAL n 
1 38  LEU n 
1 39  PRO n 
1 40  ARG n 
1 41  HIS n 
1 42  SER n 
1 43  GLN n 
1 44  PRO n 
1 45  GLY n 
1 46  LYS n 
1 47  THR n 
1 48  ILE n 
1 49  TRP n 
1 50  ILE n 
1 51  GLU n 
1 52  HIS n 
1 53  LYS n 
1 54  LEU n 
1 55  VAL n 
1 56  ASN n 
1 57  ILE n 
1 58  LEU n 
1 59  ASP n 
1 60  ALA n 
1 61  VAL n 
1 62  GLU n 
1 63  LEU n 
1 64  VAL n 
1 65  ASP n 
1 66  GLU n 
1 67  GLN n 
1 68  GLY n 
1 69  VAL n 
1 70  ASN n 
1 71  LEU n 
1 72  GLU n 
1 73  LEU n 
1 74  THR n 
1 75  LEU n 
1 76  ILE n 
1 77  THR n 
1 78  LEU n 
1 79  ASP n 
1 80  THR n 
1 81  ASN n 
1 82  GLU n 
1 83  LYS n 
1 84  PHE n 
1 85  ARG n 
1 86  ASP n 
1 87  ILE n 
1 88  THR n 
1 89  LYS n 
1 90  PHE n 
1 91  ILE n 
1 92  PRO n 
1 93  GLU n 
1 94  ASN n 
1 95  ILE n 
1 96  SER n 
1 97  THR n 
1 98  ALA n 
1 99  SER n 
1 100 ASP n 
1 101 ALA n 
1 102 THR n 
1 103 LEU n 
1 104 VAL n 
1 105 ILE n 
1 106 ASN n 
1 107 THR n 
1 108 GLU n 
1 109 HIS n 
1 110 MET n 
1 111 PRO n 
1 112 SER n 
1 113 MET n 
1 114 PHE n 
1 115 VAL n 
1 116 PRO n 
1 117 VAL n 
1 118 GLY n 
1 119 ASP n 
1 120 VAL n 
1 121 VAL n 
1 122 GLN n 
1 123 TYR n 
1 124 GLY n 
1 125 PHE n 
1 126 LEU n 
1 127 ASN n 
1 128 LEU n 
1 129 SER n 
1 130 GLY n 
1 131 LYS n 
1 132 PRO n 
1 133 THR n 
1 134 HIS n 
1 135 ARG n 
1 136 THR n 
1 137 MET n 
1 138 MET n 
1 139 TYR n 
1 140 ASN n 
1 141 PHE n 
1 142 PRO n 
1 143 THR n 
1 144 LYS n 
1 145 ALA n 
1 146 GLY n 
1 147 GLN n 
1 148 CYS n 
1 149 GLY n 
1 150 GLY n 
1 151 VAL n 
1 152 VAL n 
1 153 THR n 
1 154 SER n 
1 155 VAL n 
1 156 GLY n 
1 157 LYS n 
1 158 VAL n 
1 159 ILE n 
1 160 GLY n 
1 161 ILE n 
1 162 HIS n 
1 163 ILE n 
1 164 GLY n 
1 165 GLY n 
1 166 ASN n 
1 167 GLY n 
1 168 ARG n 
1 169 GLN n 
1 170 GLY n 
1 171 PHE n 
1 172 CYS n 
1 173 ALA n 
1 174 GLY n 
1 175 LEU n 
1 176 LYS n 
1 177 ARG n 
1 178 SER n 
1 179 TYR n 
1 180 PHE n 
1 181 ALA n 
1 182 SER n 
1 183 GLU n 
1 184 GLN n 
1 185 LEU n 
1 186 GLU n 
1 187 HIS n 
1 188 HIS n 
1 189 HIS n 
1 190 HIS n 
1 191 HIS n 
1 192 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   192 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    E2004104-TW-CDC 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterovirus A71' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     39054 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GHZ non-polymer         . 
;2-methylpropyl N-[(2S)-1-oxidanylidene-1-[[(2S)-1-oxidanyl-3-[(3S)-2-oxidanylidenepyrrolidin-3-yl]propan-2-yl]amino]-3-phenyl-propan-2-yl]carbamate
;
? 'C21 H31 N3 O5'  405.488 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   0   MET MET A . n 
A 1 2   GLY 2   1   1   GLY GLY A . n 
A 1 3   PRO 3   2   2   PRO PRO A . n 
A 1 4   SER 4   3   3   SER SER A . n 
A 1 5   LEU 5   4   4   LEU LEU A . n 
A 1 6   ASP 6   5   5   ASP ASP A . n 
A 1 7   PHE 7   6   6   PHE PHE A . n 
A 1 8   ALA 8   7   7   ALA ALA A . n 
A 1 9   LEU 9   8   8   LEU LEU A . n 
A 1 10  SER 10  9   9   SER SER A . n 
A 1 11  LEU 11  10  10  LEU LEU A . n 
A 1 12  LEU 12  11  11  LEU LEU A . n 
A 1 13  ARG 13  12  12  ARG ARG A . n 
A 1 14  ARG 14  13  13  ARG ARG A . n 
A 1 15  ASN 15  14  14  ASN ASN A . n 
A 1 16  VAL 16  15  15  VAL VAL A . n 
A 1 17  ARG 17  16  16  ARG ARG A . n 
A 1 18  GLN 18  17  17  GLN GLN A . n 
A 1 19  VAL 19  18  18  VAL VAL A . n 
A 1 20  GLN 20  19  19  GLN GLN A . n 
A 1 21  THR 21  20  20  THR THR A . n 
A 1 22  ASP 22  21  21  ASP ASP A . n 
A 1 23  GLN 23  22  22  GLN GLN A . n 
A 1 24  GLY 24  23  23  GLY GLY A . n 
A 1 25  HIS 25  24  24  HIS HIS A . n 
A 1 26  PHE 26  25  25  PHE PHE A . n 
A 1 27  THR 27  26  26  THR THR A . n 
A 1 28  MET 28  27  27  MET MET A . n 
A 1 29  LEU 29  28  28  LEU LEU A . n 
A 1 30  GLY 30  29  29  GLY GLY A . n 
A 1 31  VAL 31  30  30  VAL VAL A . n 
A 1 32  ARG 32  31  31  ARG ARG A . n 
A 1 33  ASP 33  32  32  ASP ASP A . n 
A 1 34  ARG 34  33  33  ARG ARG A . n 
A 1 35  LEU 35  34  34  LEU LEU A . n 
A 1 36  ALA 36  35  35  ALA ALA A . n 
A 1 37  VAL 37  36  36  VAL VAL A . n 
A 1 38  LEU 38  37  37  LEU LEU A . n 
A 1 39  PRO 39  38  38  PRO PRO A . n 
A 1 40  ARG 40  39  39  ARG ARG A . n 
A 1 41  HIS 41  40  40  HIS HIS A . n 
A 1 42  SER 42  41  41  SER SER A . n 
A 1 43  GLN 43  42  42  GLN GLN A . n 
A 1 44  PRO 44  43  43  PRO PRO A . n 
A 1 45  GLY 45  44  44  GLY GLY A . n 
A 1 46  LYS 46  45  45  LYS LYS A . n 
A 1 47  THR 47  46  46  THR THR A . n 
A 1 48  ILE 48  47  47  ILE ILE A . n 
A 1 49  TRP 49  48  48  TRP TRP A . n 
A 1 50  ILE 50  49  49  ILE ILE A . n 
A 1 51  GLU 51  50  50  GLU GLU A . n 
A 1 52  HIS 52  51  51  HIS HIS A . n 
A 1 53  LYS 53  52  52  LYS LYS A . n 
A 1 54  LEU 54  53  53  LEU LEU A . n 
A 1 55  VAL 55  54  54  VAL VAL A . n 
A 1 56  ASN 56  55  55  ASN ASN A . n 
A 1 57  ILE 57  56  56  ILE ILE A . n 
A 1 58  LEU 58  57  57  LEU LEU A . n 
A 1 59  ASP 59  58  58  ASP ASP A . n 
A 1 60  ALA 60  59  59  ALA ALA A . n 
A 1 61  VAL 61  60  60  VAL VAL A . n 
A 1 62  GLU 62  61  61  GLU GLU A . n 
A 1 63  LEU 63  62  62  LEU LEU A . n 
A 1 64  VAL 64  63  63  VAL VAL A . n 
A 1 65  ASP 65  64  64  ASP ASP A . n 
A 1 66  GLU 66  65  65  GLU GLU A . n 
A 1 67  GLN 67  66  66  GLN GLN A . n 
A 1 68  GLY 68  67  67  GLY GLY A . n 
A 1 69  VAL 69  68  68  VAL VAL A . n 
A 1 70  ASN 70  69  69  ASN ASN A . n 
A 1 71  LEU 71  70  70  LEU LEU A . n 
A 1 72  GLU 72  71  71  GLU GLU A . n 
A 1 73  LEU 73  72  72  LEU LEU A . n 
A 1 74  THR 74  73  73  THR THR A . n 
A 1 75  LEU 75  74  74  LEU LEU A . n 
A 1 76  ILE 76  75  75  ILE ILE A . n 
A 1 77  THR 77  76  76  THR THR A . n 
A 1 78  LEU 78  77  77  LEU LEU A . n 
A 1 79  ASP 79  78  78  ASP ASP A . n 
A 1 80  THR 80  79  79  THR THR A . n 
A 1 81  ASN 81  80  80  ASN ASN A . n 
A 1 82  GLU 82  81  81  GLU GLU A . n 
A 1 83  LYS 83  82  82  LYS LYS A . n 
A 1 84  PHE 84  83  83  PHE PHE A . n 
A 1 85  ARG 85  84  84  ARG ARG A . n 
A 1 86  ASP 86  85  85  ASP ASP A . n 
A 1 87  ILE 87  86  86  ILE ILE A . n 
A 1 88  THR 88  87  87  THR THR A . n 
A 1 89  LYS 89  88  88  LYS LYS A . n 
A 1 90  PHE 90  89  89  PHE PHE A . n 
A 1 91  ILE 91  90  90  ILE ILE A . n 
A 1 92  PRO 92  91  91  PRO PRO A . n 
A 1 93  GLU 93  92  92  GLU GLU A . n 
A 1 94  ASN 94  93  93  ASN ASN A . n 
A 1 95  ILE 95  94  94  ILE ILE A . n 
A 1 96  SER 96  95  95  SER SER A . n 
A 1 97  THR 97  96  96  THR THR A . n 
A 1 98  ALA 98  97  97  ALA ALA A . n 
A 1 99  SER 99  98  98  SER SER A . n 
A 1 100 ASP 100 99  99  ASP ASP A . n 
A 1 101 ALA 101 100 100 ALA ALA A . n 
A 1 102 THR 102 101 101 THR THR A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 VAL 104 103 103 VAL VAL A . n 
A 1 105 ILE 105 104 104 ILE ILE A . n 
A 1 106 ASN 106 105 105 ASN ASN A . n 
A 1 107 THR 107 106 106 THR THR A . n 
A 1 108 GLU 108 107 107 GLU GLU A . n 
A 1 109 HIS 109 108 108 HIS HIS A . n 
A 1 110 MET 110 109 109 MET MET A . n 
A 1 111 PRO 111 110 110 PRO PRO A . n 
A 1 112 SER 112 111 111 SER SER A . n 
A 1 113 MET 113 112 112 MET MET A . n 
A 1 114 PHE 114 113 113 PHE PHE A . n 
A 1 115 VAL 115 114 114 VAL VAL A . n 
A 1 116 PRO 116 115 115 PRO PRO A . n 
A 1 117 VAL 117 116 116 VAL VAL A . n 
A 1 118 GLY 118 117 117 GLY GLY A . n 
A 1 119 ASP 119 118 118 ASP ASP A . n 
A 1 120 VAL 120 119 119 VAL VAL A . n 
A 1 121 VAL 121 120 120 VAL VAL A . n 
A 1 122 GLN 122 121 121 GLN GLN A . n 
A 1 123 TYR 123 122 122 TYR TYR A . n 
A 1 124 GLY 124 123 123 GLY GLY A . n 
A 1 125 PHE 125 124 124 PHE PHE A . n 
A 1 126 LEU 126 125 125 LEU LEU A . n 
A 1 127 ASN 127 126 126 ASN ASN A . n 
A 1 128 LEU 128 127 127 LEU LEU A . n 
A 1 129 SER 129 128 128 SER SER A . n 
A 1 130 GLY 130 129 129 GLY GLY A . n 
A 1 131 LYS 131 130 130 LYS LYS A . n 
A 1 132 PRO 132 131 131 PRO PRO A . n 
A 1 133 THR 133 132 132 THR THR A . n 
A 1 134 HIS 134 133 133 HIS HIS A . n 
A 1 135 ARG 135 134 134 ARG ARG A . n 
A 1 136 THR 136 135 135 THR THR A . n 
A 1 137 MET 137 136 136 MET MET A . n 
A 1 138 MET 138 137 137 MET MET A . n 
A 1 139 TYR 139 138 138 TYR TYR A . n 
A 1 140 ASN 140 139 139 ASN ASN A . n 
A 1 141 PHE 141 140 140 PHE PHE A . n 
A 1 142 PRO 142 141 141 PRO PRO A . n 
A 1 143 THR 143 142 142 THR THR A . n 
A 1 144 LYS 144 143 143 LYS LYS A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 GLY 146 145 145 GLY GLY A . n 
A 1 147 GLN 147 146 146 GLN GLN A . n 
A 1 148 CYS 148 147 147 CYS CYS A . n 
A 1 149 GLY 149 148 148 GLY GLY A . n 
A 1 150 GLY 150 149 149 GLY GLY A . n 
A 1 151 VAL 151 150 150 VAL VAL A . n 
A 1 152 VAL 152 151 151 VAL VAL A . n 
A 1 153 THR 153 152 152 THR THR A . n 
A 1 154 SER 154 153 153 SER SER A . n 
A 1 155 VAL 155 154 154 VAL VAL A . n 
A 1 156 GLY 156 155 155 GLY GLY A . n 
A 1 157 LYS 157 156 156 LYS LYS A . n 
A 1 158 VAL 158 157 157 VAL VAL A . n 
A 1 159 ILE 159 158 158 ILE ILE A . n 
A 1 160 GLY 160 159 159 GLY GLY A . n 
A 1 161 ILE 161 160 160 ILE ILE A . n 
A 1 162 HIS 162 161 161 HIS HIS A . n 
A 1 163 ILE 163 162 162 ILE ILE A . n 
A 1 164 GLY 164 163 163 GLY GLY A . n 
A 1 165 GLY 165 164 164 GLY GLY A . n 
A 1 166 ASN 166 165 165 ASN ASN A . n 
A 1 167 GLY 167 166 166 GLY GLY A . n 
A 1 168 ARG 168 167 167 ARG ARG A . n 
A 1 169 GLN 169 168 168 GLN GLN A . n 
A 1 170 GLY 170 169 169 GLY GLY A . n 
A 1 171 PHE 171 170 170 PHE PHE A . n 
A 1 172 CYS 172 171 171 CYS CYS A . n 
A 1 173 ALA 173 172 172 ALA ALA A . n 
A 1 174 GLY 174 173 173 GLY GLY A . n 
A 1 175 LEU 175 174 174 LEU LEU A . n 
A 1 176 LYS 176 175 175 LYS LYS A . n 
A 1 177 ARG 177 176 176 ARG ARG A . n 
A 1 178 SER 178 177 177 SER SER A . n 
A 1 179 TYR 179 178 178 TYR TYR A . n 
A 1 180 PHE 180 179 179 PHE PHE A . n 
A 1 181 ALA 181 180 180 ALA ALA A . n 
A 1 182 SER 182 181 ?   ?   ?   A . n 
A 1 183 GLU 183 182 ?   ?   ?   A . n 
A 1 184 GLN 184 183 ?   ?   ?   A . n 
A 1 185 LEU 185 184 ?   ?   ?   A . n 
A 1 186 GLU 186 185 ?   ?   ?   A . n 
A 1 187 HIS 187 186 ?   ?   ?   A . n 
A 1 188 HIS 188 187 ?   ?   ?   A . n 
A 1 189 HIS 189 188 ?   ?   ?   A . n 
A 1 190 HIS 190 189 ?   ?   ?   A . n 
A 1 191 HIS 191 190 ?   ?   ?   A . n 
A 1 192 HIS 192 191 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GHZ 1  201 201 GHZ GHZ A . 
C 3 HOH 1  301 310 HOH HOH A . 
C 3 HOH 2  302 305 HOH HOH A . 
C 3 HOH 3  303 309 HOH HOH A . 
C 3 HOH 4  304 306 HOH HOH A . 
C 3 HOH 5  305 307 HOH HOH A . 
C 3 HOH 6  306 311 HOH HOH A . 
C 3 HOH 7  307 304 HOH HOH A . 
C 3 HOH 8  308 308 HOH HOH A . 
C 3 HOH 9  309 301 HOH HOH A . 
C 3 HOH 10 310 303 HOH HOH A . 
C 3 HOH 11 311 312 HOH HOH A . 
C 3 HOH 12 312 313 HOH HOH A . 
C 3 HOH 13 313 302 HOH HOH A . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? AUTOMAR ? ? ? .        1 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? AUTOMAR ? ? ? .        2 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        3 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.7.0029 4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5C20 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     64.119 
_cell.length_a_esd                 ? 
_cell.length_b                     64.564 
_cell.length_b_esd                 ? 
_cell.length_c                     75.334 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5C20 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5C20 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.82 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         32.51 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100MM TRIS, 25% PEG4000, 0.8M LITHIUM CHLORIDE' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-11-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5C20 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.750 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       3961 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       0.000 
_reflns.percent_possible_obs             92.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.480 
_reflns.pdbx_Rmerge_I_obs                0.13250 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.6000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.75 
_reflns_shell.d_res_low                   2.85 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.100 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        96.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.39770 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.45 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.33000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.00000 
_refine.aniso_B[2][2]                            -0.40000 
_refine.aniso_B[2][3]                            -0.00000 
_refine.aniso_B[3][3]                            0.08000 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               35.16 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.926 
_refine.correlation_coeff_Fo_to_Fc_free          0.852 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5C20 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.75 
_refine.ls_d_res_low                             20.29 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     3934 
_refine.ls_number_reflns_R_free                  182 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    92.0 
_refine.ls_percent_reflns_R_free                 4.600 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.215 
_refine.ls_R_factor_R_free                       0.282 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.211 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 4GHQ' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.503 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             19.541 
_refine.overall_SU_ML                            0.380 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1401 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             13 
_refine_hist.number_atoms_total               1443 
_refine_hist.d_res_high                       2.75 
_refine_hist.d_res_low                        20.29 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  0.019  1459 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  1425 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.487  1.979  1975 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.904  3.000  3269 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.066  5.000  180  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 38.274 23.710 62   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 22.881 15.000 247  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 21.937 15.000 10   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.085  0.200  228  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.021  1638 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  338  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.75 
_refine_ls_shell.d_res_low                        2.82 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             14 
_refine_ls_shell.number_reflns_R_work             282 
_refine_ls_shell.percent_reflns_obs               96.10 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3230 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.3190 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_database_PDB_matrix.entry_id          5C20 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                     5C20 
_struct.title                        'Crystal structure of EV71 3C Proteinase in complex with Compound 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5C20 
_struct_keywords.text            'HYDROLASE, CYSTEINE PROTEINASE, INHIBITOR, HYDROLASE-HYDROLASE INHIBITOR COMPLEX' 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A9XG43_9ENTO 
_struct_ref.pdbx_db_accession          A9XG43 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GPSLDFALSLLRRNVRQVQTDQGHFTMLGVRDRLAVLPRHSQPGKTIWIEHKLVNILDAVELVDEQGVNLELTLITLDTN
EKFRDITKFIPENISTASDATLVINTEHMPSMFVPVGDVVQYGFLNLSGKPTHRTMMYNFPTKAGQCGGVVTSVGKVIGI
HIGGNGRQGFCAGLKRSYFASEQ
;
_struct_ref.pdbx_align_begin           1549 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5C20 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 184 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             A9XG43 
_struct_ref_seq.db_align_beg                  1549 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1731 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       183 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5C20 MET A 1   ? UNP A9XG43 ? ? 'expression tag' 0   1 
1 5C20 LEU A 185 ? UNP A9XG43 ? ? 'expression tag' 184 2 
1 5C20 GLU A 186 ? UNP A9XG43 ? ? 'expression tag' 185 3 
1 5C20 HIS A 187 ? UNP A9XG43 ? ? 'expression tag' 186 4 
1 5C20 HIS A 188 ? UNP A9XG43 ? ? 'expression tag' 187 5 
1 5C20 HIS A 189 ? UNP A9XG43 ? ? 'expression tag' 188 6 
1 5C20 HIS A 190 ? UNP A9XG43 ? ? 'expression tag' 189 7 
1 5C20 HIS A 191 ? UNP A9XG43 ? ? 'expression tag' 190 8 
1 5C20 HIS A 192 ? UNP A9XG43 ? ? 'expression tag' 191 9 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  8380 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLY A 2   ? ASN A 15  ? GLY A 1   ASN A 14  1 ? 14 
HELX_P HELX_P2 AA2 HIS A 41  ? GLN A 43  ? HIS A 40  GLN A 42  5 ? 3  
HELX_P HELX_P3 AA3 ILE A 87  ? ILE A 91  ? ILE A 86  ILE A 90  5 ? 5  
HELX_P HELX_P4 AA4 LYS A 176 ? ALA A 181 ? LYS A 175 ALA A 180 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        none 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            148 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           GHZ 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C27 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             147 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            GHZ 
_struct_conn.ptnr2_auth_seq_id             201 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.761 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      GHZ 
_pdbx_modification_feature.label_asym_id                      B 
_pdbx_modification_feature.label_seq_id                       . 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     CYS 
_pdbx_modification_feature.modified_residue_label_asym_id     A 
_pdbx_modification_feature.modified_residue_label_seq_id      148 
_pdbx_modification_feature.modified_residue_label_alt_id      ? 
_pdbx_modification_feature.auth_comp_id                       GHZ 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        201 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      CYS 
_pdbx_modification_feature.modified_residue_auth_asym_id      A 
_pdbx_modification_feature.modified_residue_auth_seq_id       147 
_pdbx_modification_feature.modified_residue_PDB_ins_code      ? 
_pdbx_modification_feature.modified_residue_symmetry          1_555 
_pdbx_modification_feature.comp_id_linking_atom               C27 
_pdbx_modification_feature.modified_residue_id_linking_atom   SG 
_pdbx_modification_feature.modified_residue_id                CYS 
_pdbx_modification_feature.ref_pcm_id                         1 
_pdbx_modification_feature.ref_comp_id                        GHZ 
_pdbx_modification_feature.type                               None 
_pdbx_modification_feature.category                           'Covalent chemical modification' 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 16  ? THR A 21  ? VAL A 15  THR A 20  
AA1 2 GLY A 24  ? ARG A 32  ? GLY A 23  ARG A 31  
AA1 3 LEU A 35  ? PRO A 39  ? LEU A 34  PRO A 38  
AA1 4 ASN A 70  ? ASP A 79  ? ASN A 69  ASP A 78  
AA1 5 LYS A 53  ? VAL A 64  ? LYS A 52  VAL A 63  
AA1 6 THR A 47  ? ILE A 50  ? THR A 46  ILE A 49  
AA1 7 VAL A 16  ? THR A 21  ? VAL A 15  THR A 20  
AA2 1 ALA A 98  ? ILE A 105 ? ALA A 97  ILE A 104 
AA2 2 MET A 113 ? LEU A 128 ? MET A 112 LEU A 127 
AA2 3 LYS A 131 ? TYR A 139 ? LYS A 130 TYR A 138 
AA2 4 GLY A 170 ? GLY A 174 ? GLY A 169 GLY A 173 
AA2 5 LYS A 157 ? GLY A 165 ? LYS A 156 GLY A 164 
AA2 6 VAL A 151 ? SER A 154 ? VAL A 150 SER A 153 
AA2 7 ALA A 98  ? ILE A 105 ? ALA A 97  ILE A 104 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 17  ? N ARG A 16  O MET A 28  ? O MET A 27  
AA1 2 3 N VAL A 31  ? N VAL A 30  O LEU A 35  ? O LEU A 34  
AA1 3 4 N LEU A 38  ? N LEU A 37  O THR A 74  ? O THR A 73  
AA1 4 5 O THR A 77  ? O THR A 76  N LEU A 58  ? N LEU A 57  
AA1 5 6 O VAL A 55  ? O VAL A 54  N ILE A 48  ? N ILE A 47  
AA1 6 7 O TRP A 49  ? O TRP A 48  N GLN A 20  ? N GLN A 19  
AA2 1 2 N LEU A 103 ? N LEU A 102 O VAL A 115 ? O VAL A 114 
AA2 2 3 N VAL A 121 ? N VAL A 120 O MET A 138 ? O MET A 137 
AA2 3 4 N TYR A 139 ? N TYR A 138 O GLY A 170 ? O GLY A 169 
AA2 4 5 O ALA A 173 ? O ALA A 172 N ILE A 161 ? N ILE A 160 
AA2 5 6 O ILE A 159 ? O ILE A 158 N VAL A 152 ? N VAL A 151 
AA2 6 7 O VAL A 151 ? O VAL A 150 N VAL A 104 ? N VAL A 103 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    GHZ 
_struct_site.pdbx_auth_seq_id     201 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    14 
_struct_site.details              'binding site for residue GHZ A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 ARG A 40  ? ARG A 39  . ? 1_555 ? 
2  AC1 14 HIS A 41  ? HIS A 40  . ? 1_555 ? 
3  AC1 14 GLU A 72  ? GLU A 71  . ? 1_555 ? 
4  AC1 14 LEU A 128 ? LEU A 127 . ? 1_555 ? 
5  AC1 14 SER A 129 ? SER A 128 . ? 1_555 ? 
6  AC1 14 THR A 143 ? THR A 142 . ? 1_555 ? 
7  AC1 14 LYS A 144 ? LYS A 143 . ? 1_555 ? 
8  AC1 14 ALA A 145 ? ALA A 144 . ? 1_555 ? 
9  AC1 14 GLY A 146 ? GLY A 145 . ? 1_555 ? 
10 AC1 14 CYS A 148 ? CYS A 147 . ? 1_555 ? 
11 AC1 14 HIS A 162 ? HIS A 161 . ? 1_555 ? 
12 AC1 14 ILE A 163 ? ILE A 162 . ? 1_555 ? 
13 AC1 14 GLY A 164 ? GLY A 163 . ? 1_555 ? 
14 AC1 14 GLY A 165 ? GLY A 164 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   5C20 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 A ASP 32  ? ? NZ  A LYS 82  ? ? 1.53 
2 1 OD1 A ASP 85  ? ? OG1 A THR 87  ? ? 2.03 
3 1 O   A THR 142 ? ? N33 A GHZ 201 ? ? 2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 32 ? ? 56.53 -125.85 
2 1 GLU A 50 ? ? 71.56 -66.94  
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     313 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 181 ? A SER 182 
2  1 Y 1 A GLU 182 ? A GLU 183 
3  1 Y 1 A GLN 183 ? A GLN 184 
4  1 Y 1 A LEU 184 ? A LEU 185 
5  1 Y 1 A GLU 185 ? A GLU 186 
6  1 Y 1 A HIS 186 ? A HIS 187 
7  1 Y 1 A HIS 187 ? A HIS 188 
8  1 Y 1 A HIS 188 ? A HIS 189 
9  1 Y 1 A HIS 189 ? A HIS 190 
10 1 Y 1 A HIS 190 ? A HIS 191 
11 1 Y 1 A HIS 191 ? A HIS 192 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GHZ O25  O N N 88  
GHZ C23  C N N 89  
GHZ C15  C N S 90  
GHZ C16  C N N 91  
GHZ C17  C Y N 92  
GHZ C22  C Y N 93  
GHZ C21  C Y N 94  
GHZ C20  C Y N 95  
GHZ C19  C Y N 96  
GHZ C18  C Y N 97  
GHZ N13  N N N 98  
GHZ C12  C N N 99  
GHZ O11  O N N 100 
GHZ C10  C N N 101 
GHZ C1   C N N 102 
GHZ O14  O N N 103 
GHZ N24  N N N 104 
GHZ C26  C N S 105 
GHZ C27  C N N 106 
GHZ O28  O N N 107 
GHZ C29  C N N 108 
GHZ C30  C N S 109 
GHZ C31  C N N 110 
GHZ C32  C N N 111 
GHZ N33  N N N 112 
GHZ C34  C N N 113 
GHZ O1   O N N 114 
GHZ C2   C N N 115 
GHZ C3   C N N 116 
GHZ H1   H N N 117 
GHZ H2   H N N 118 
GHZ H3   H N N 119 
GHZ H4   H N N 120 
GHZ H5   H N N 121 
GHZ H6   H N N 122 
GHZ H7   H N N 123 
GHZ H8   H N N 124 
GHZ H9   H N N 125 
GHZ H10  H N N 126 
GHZ H11  H N N 127 
GHZ H12  H N N 128 
GHZ H13  H N N 129 
GHZ H14  H N N 130 
GHZ H15  H N N 131 
GHZ H16  H N N 132 
GHZ H17  H N N 133 
GHZ H18  H N N 134 
GHZ H19  H N N 135 
GHZ H20  H N N 136 
GHZ H21  H N N 137 
GHZ H22  H N N 138 
GHZ H23  H N N 139 
GHZ H24  H N N 140 
GHZ H25  H N N 141 
GHZ H26  H N N 142 
GHZ H27  H N N 143 
GHZ H28  H N N 144 
GHZ H29  H N N 145 
GHZ H30  H N N 146 
GHZ H31  H N N 147 
GLN N    N N N 148 
GLN CA   C N S 149 
GLN C    C N N 150 
GLN O    O N N 151 
GLN CB   C N N 152 
GLN CG   C N N 153 
GLN CD   C N N 154 
GLN OE1  O N N 155 
GLN NE2  N N N 156 
GLN OXT  O N N 157 
GLN H    H N N 158 
GLN H2   H N N 159 
GLN HA   H N N 160 
GLN HB2  H N N 161 
GLN HB3  H N N 162 
GLN HG2  H N N 163 
GLN HG3  H N N 164 
GLN HE21 H N N 165 
GLN HE22 H N N 166 
GLN HXT  H N N 167 
GLU N    N N N 168 
GLU CA   C N S 169 
GLU C    C N N 170 
GLU O    O N N 171 
GLU CB   C N N 172 
GLU CG   C N N 173 
GLU CD   C N N 174 
GLU OE1  O N N 175 
GLU OE2  O N N 176 
GLU OXT  O N N 177 
GLU H    H N N 178 
GLU H2   H N N 179 
GLU HA   H N N 180 
GLU HB2  H N N 181 
GLU HB3  H N N 182 
GLU HG2  H N N 183 
GLU HG3  H N N 184 
GLU HE2  H N N 185 
GLU HXT  H N N 186 
GLY N    N N N 187 
GLY CA   C N N 188 
GLY C    C N N 189 
GLY O    O N N 190 
GLY OXT  O N N 191 
GLY H    H N N 192 
GLY H2   H N N 193 
GLY HA2  H N N 194 
GLY HA3  H N N 195 
GLY HXT  H N N 196 
HIS N    N N N 197 
HIS CA   C N S 198 
HIS C    C N N 199 
HIS O    O N N 200 
HIS CB   C N N 201 
HIS CG   C Y N 202 
HIS ND1  N Y N 203 
HIS CD2  C Y N 204 
HIS CE1  C Y N 205 
HIS NE2  N Y N 206 
HIS OXT  O N N 207 
HIS H    H N N 208 
HIS H2   H N N 209 
HIS HA   H N N 210 
HIS HB2  H N N 211 
HIS HB3  H N N 212 
HIS HD1  H N N 213 
HIS HD2  H N N 214 
HIS HE1  H N N 215 
HIS HE2  H N N 216 
HIS HXT  H N N 217 
HOH O    O N N 218 
HOH H1   H N N 219 
HOH H2   H N N 220 
ILE N    N N N 221 
ILE CA   C N S 222 
ILE C    C N N 223 
ILE O    O N N 224 
ILE CB   C N S 225 
ILE CG1  C N N 226 
ILE CG2  C N N 227 
ILE CD1  C N N 228 
ILE OXT  O N N 229 
ILE H    H N N 230 
ILE H2   H N N 231 
ILE HA   H N N 232 
ILE HB   H N N 233 
ILE HG12 H N N 234 
ILE HG13 H N N 235 
ILE HG21 H N N 236 
ILE HG22 H N N 237 
ILE HG23 H N N 238 
ILE HD11 H N N 239 
ILE HD12 H N N 240 
ILE HD13 H N N 241 
ILE HXT  H N N 242 
LEU N    N N N 243 
LEU CA   C N S 244 
LEU C    C N N 245 
LEU O    O N N 246 
LEU CB   C N N 247 
LEU CG   C N N 248 
LEU CD1  C N N 249 
LEU CD2  C N N 250 
LEU OXT  O N N 251 
LEU H    H N N 252 
LEU H2   H N N 253 
LEU HA   H N N 254 
LEU HB2  H N N 255 
LEU HB3  H N N 256 
LEU HG   H N N 257 
LEU HD11 H N N 258 
LEU HD12 H N N 259 
LEU HD13 H N N 260 
LEU HD21 H N N 261 
LEU HD22 H N N 262 
LEU HD23 H N N 263 
LEU HXT  H N N 264 
LYS N    N N N 265 
LYS CA   C N S 266 
LYS C    C N N 267 
LYS O    O N N 268 
LYS CB   C N N 269 
LYS CG   C N N 270 
LYS CD   C N N 271 
LYS CE   C N N 272 
LYS NZ   N N N 273 
LYS OXT  O N N 274 
LYS H    H N N 275 
LYS H2   H N N 276 
LYS HA   H N N 277 
LYS HB2  H N N 278 
LYS HB3  H N N 279 
LYS HG2  H N N 280 
LYS HG3  H N N 281 
LYS HD2  H N N 282 
LYS HD3  H N N 283 
LYS HE2  H N N 284 
LYS HE3  H N N 285 
LYS HZ1  H N N 286 
LYS HZ2  H N N 287 
LYS HZ3  H N N 288 
LYS HXT  H N N 289 
MET N    N N N 290 
MET CA   C N S 291 
MET C    C N N 292 
MET O    O N N 293 
MET CB   C N N 294 
MET CG   C N N 295 
MET SD   S N N 296 
MET CE   C N N 297 
MET OXT  O N N 298 
MET H    H N N 299 
MET H2   H N N 300 
MET HA   H N N 301 
MET HB2  H N N 302 
MET HB3  H N N 303 
MET HG2  H N N 304 
MET HG3  H N N 305 
MET HE1  H N N 306 
MET HE2  H N N 307 
MET HE3  H N N 308 
MET HXT  H N N 309 
PHE N    N N N 310 
PHE CA   C N S 311 
PHE C    C N N 312 
PHE O    O N N 313 
PHE CB   C N N 314 
PHE CG   C Y N 315 
PHE CD1  C Y N 316 
PHE CD2  C Y N 317 
PHE CE1  C Y N 318 
PHE CE2  C Y N 319 
PHE CZ   C Y N 320 
PHE OXT  O N N 321 
PHE H    H N N 322 
PHE H2   H N N 323 
PHE HA   H N N 324 
PHE HB2  H N N 325 
PHE HB3  H N N 326 
PHE HD1  H N N 327 
PHE HD2  H N N 328 
PHE HE1  H N N 329 
PHE HE2  H N N 330 
PHE HZ   H N N 331 
PHE HXT  H N N 332 
PRO N    N N N 333 
PRO CA   C N S 334 
PRO C    C N N 335 
PRO O    O N N 336 
PRO CB   C N N 337 
PRO CG   C N N 338 
PRO CD   C N N 339 
PRO OXT  O N N 340 
PRO H    H N N 341 
PRO HA   H N N 342 
PRO HB2  H N N 343 
PRO HB3  H N N 344 
PRO HG2  H N N 345 
PRO HG3  H N N 346 
PRO HD2  H N N 347 
PRO HD3  H N N 348 
PRO HXT  H N N 349 
SER N    N N N 350 
SER CA   C N S 351 
SER C    C N N 352 
SER O    O N N 353 
SER CB   C N N 354 
SER OG   O N N 355 
SER OXT  O N N 356 
SER H    H N N 357 
SER H2   H N N 358 
SER HA   H N N 359 
SER HB2  H N N 360 
SER HB3  H N N 361 
SER HG   H N N 362 
SER HXT  H N N 363 
THR N    N N N 364 
THR CA   C N S 365 
THR C    C N N 366 
THR O    O N N 367 
THR CB   C N R 368 
THR OG1  O N N 369 
THR CG2  C N N 370 
THR OXT  O N N 371 
THR H    H N N 372 
THR H2   H N N 373 
THR HA   H N N 374 
THR HB   H N N 375 
THR HG1  H N N 376 
THR HG21 H N N 377 
THR HG22 H N N 378 
THR HG23 H N N 379 
THR HXT  H N N 380 
TRP N    N N N 381 
TRP CA   C N S 382 
TRP C    C N N 383 
TRP O    O N N 384 
TRP CB   C N N 385 
TRP CG   C Y N 386 
TRP CD1  C Y N 387 
TRP CD2  C Y N 388 
TRP NE1  N Y N 389 
TRP CE2  C Y N 390 
TRP CE3  C Y N 391 
TRP CZ2  C Y N 392 
TRP CZ3  C Y N 393 
TRP CH2  C Y N 394 
TRP OXT  O N N 395 
TRP H    H N N 396 
TRP H2   H N N 397 
TRP HA   H N N 398 
TRP HB2  H N N 399 
TRP HB3  H N N 400 
TRP HD1  H N N 401 
TRP HE1  H N N 402 
TRP HE3  H N N 403 
TRP HZ2  H N N 404 
TRP HZ3  H N N 405 
TRP HH2  H N N 406 
TRP HXT  H N N 407 
TYR N    N N N 408 
TYR CA   C N S 409 
TYR C    C N N 410 
TYR O    O N N 411 
TYR CB   C N N 412 
TYR CG   C Y N 413 
TYR CD1  C Y N 414 
TYR CD2  C Y N 415 
TYR CE1  C Y N 416 
TYR CE2  C Y N 417 
TYR CZ   C Y N 418 
TYR OH   O N N 419 
TYR OXT  O N N 420 
TYR H    H N N 421 
TYR H2   H N N 422 
TYR HA   H N N 423 
TYR HB2  H N N 424 
TYR HB3  H N N 425 
TYR HD1  H N N 426 
TYR HD2  H N N 427 
TYR HE1  H N N 428 
TYR HE2  H N N 429 
TYR HH   H N N 430 
TYR HXT  H N N 431 
VAL N    N N N 432 
VAL CA   C N S 433 
VAL C    C N N 434 
VAL O    O N N 435 
VAL CB   C N N 436 
VAL CG1  C N N 437 
VAL CG2  C N N 438 
VAL OXT  O N N 439 
VAL H    H N N 440 
VAL H2   H N N 441 
VAL HA   H N N 442 
VAL HB   H N N 443 
VAL HG11 H N N 444 
VAL HG12 H N N 445 
VAL HG13 H N N 446 
VAL HG21 H N N 447 
VAL HG22 H N N 448 
VAL HG23 H N N 449 
VAL HXT  H N N 450 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GHZ C3  C1   sing N N 83  
GHZ C1  C2   sing N N 84  
GHZ C1  C10  sing N N 85  
GHZ C10 O11  sing N N 86  
GHZ O11 C12  sing N N 87  
GHZ C20 C19  doub Y N 88  
GHZ C20 C21  sing Y N 89  
GHZ C19 C18  sing Y N 90  
GHZ C12 N13  sing N N 91  
GHZ C12 O14  doub N N 92  
GHZ C21 C22  doub Y N 93  
GHZ N13 C15  sing N N 94  
GHZ C18 C17  doub Y N 95  
GHZ C22 C17  sing Y N 96  
GHZ C17 C16  sing N N 97  
GHZ C16 C15  sing N N 98  
GHZ C15 C23  sing N N 99  
GHZ C23 O25  doub N N 100 
GHZ C23 N24  sing N N 101 
GHZ N24 C26  sing N N 102 
GHZ C31 C30  sing N N 103 
GHZ C31 C32  sing N N 104 
GHZ C30 C34  sing N N 105 
GHZ C30 C29  sing N N 106 
GHZ C32 N33  sing N N 107 
GHZ C34 N33  sing N N 108 
GHZ C34 O1   doub N N 109 
GHZ C26 C29  sing N N 110 
GHZ C26 C27  sing N N 111 
GHZ C27 O28  sing N N 112 
GHZ C15 H1   sing N N 113 
GHZ C16 H2   sing N N 114 
GHZ C16 H3   sing N N 115 
GHZ C22 H4   sing N N 116 
GHZ C21 H5   sing N N 117 
GHZ C20 H6   sing N N 118 
GHZ C19 H7   sing N N 119 
GHZ C18 H8   sing N N 120 
GHZ N13 H9   sing N N 121 
GHZ C10 H10  sing N N 122 
GHZ C10 H11  sing N N 123 
GHZ C1  H12  sing N N 124 
GHZ N24 H13  sing N N 125 
GHZ C26 H14  sing N N 126 
GHZ C27 H15  sing N N 127 
GHZ C27 H16  sing N N 128 
GHZ O28 H17  sing N N 129 
GHZ C29 H18  sing N N 130 
GHZ C29 H19  sing N N 131 
GHZ C30 H20  sing N N 132 
GHZ C31 H21  sing N N 133 
GHZ C31 H22  sing N N 134 
GHZ C32 H23  sing N N 135 
GHZ C2  H24  sing N N 136 
GHZ C2  H25  sing N N 137 
GHZ C2  H26  sing N N 138 
GHZ C3  H27  sing N N 139 
GHZ C3  H28  sing N N 140 
GHZ C3  H29  sing N N 141 
GHZ C32 H30  sing N N 142 
GHZ N33 H31  sing N N 143 
GLN N   CA   sing N N 144 
GLN N   H    sing N N 145 
GLN N   H2   sing N N 146 
GLN CA  C    sing N N 147 
GLN CA  CB   sing N N 148 
GLN CA  HA   sing N N 149 
GLN C   O    doub N N 150 
GLN C   OXT  sing N N 151 
GLN CB  CG   sing N N 152 
GLN CB  HB2  sing N N 153 
GLN CB  HB3  sing N N 154 
GLN CG  CD   sing N N 155 
GLN CG  HG2  sing N N 156 
GLN CG  HG3  sing N N 157 
GLN CD  OE1  doub N N 158 
GLN CD  NE2  sing N N 159 
GLN NE2 HE21 sing N N 160 
GLN NE2 HE22 sing N N 161 
GLN OXT HXT  sing N N 162 
GLU N   CA   sing N N 163 
GLU N   H    sing N N 164 
GLU N   H2   sing N N 165 
GLU CA  C    sing N N 166 
GLU CA  CB   sing N N 167 
GLU CA  HA   sing N N 168 
GLU C   O    doub N N 169 
GLU C   OXT  sing N N 170 
GLU CB  CG   sing N N 171 
GLU CB  HB2  sing N N 172 
GLU CB  HB3  sing N N 173 
GLU CG  CD   sing N N 174 
GLU CG  HG2  sing N N 175 
GLU CG  HG3  sing N N 176 
GLU CD  OE1  doub N N 177 
GLU CD  OE2  sing N N 178 
GLU OE2 HE2  sing N N 179 
GLU OXT HXT  sing N N 180 
GLY N   CA   sing N N 181 
GLY N   H    sing N N 182 
GLY N   H2   sing N N 183 
GLY CA  C    sing N N 184 
GLY CA  HA2  sing N N 185 
GLY CA  HA3  sing N N 186 
GLY C   O    doub N N 187 
GLY C   OXT  sing N N 188 
GLY OXT HXT  sing N N 189 
HIS N   CA   sing N N 190 
HIS N   H    sing N N 191 
HIS N   H2   sing N N 192 
HIS CA  C    sing N N 193 
HIS CA  CB   sing N N 194 
HIS CA  HA   sing N N 195 
HIS C   O    doub N N 196 
HIS C   OXT  sing N N 197 
HIS CB  CG   sing N N 198 
HIS CB  HB2  sing N N 199 
HIS CB  HB3  sing N N 200 
HIS CG  ND1  sing Y N 201 
HIS CG  CD2  doub Y N 202 
HIS ND1 CE1  doub Y N 203 
HIS ND1 HD1  sing N N 204 
HIS CD2 NE2  sing Y N 205 
HIS CD2 HD2  sing N N 206 
HIS CE1 NE2  sing Y N 207 
HIS CE1 HE1  sing N N 208 
HIS NE2 HE2  sing N N 209 
HIS OXT HXT  sing N N 210 
HOH O   H1   sing N N 211 
HOH O   H2   sing N N 212 
ILE N   CA   sing N N 213 
ILE N   H    sing N N 214 
ILE N   H2   sing N N 215 
ILE CA  C    sing N N 216 
ILE CA  CB   sing N N 217 
ILE CA  HA   sing N N 218 
ILE C   O    doub N N 219 
ILE C   OXT  sing N N 220 
ILE CB  CG1  sing N N 221 
ILE CB  CG2  sing N N 222 
ILE CB  HB   sing N N 223 
ILE CG1 CD1  sing N N 224 
ILE CG1 HG12 sing N N 225 
ILE CG1 HG13 sing N N 226 
ILE CG2 HG21 sing N N 227 
ILE CG2 HG22 sing N N 228 
ILE CG2 HG23 sing N N 229 
ILE CD1 HD11 sing N N 230 
ILE CD1 HD12 sing N N 231 
ILE CD1 HD13 sing N N 232 
ILE OXT HXT  sing N N 233 
LEU N   CA   sing N N 234 
LEU N   H    sing N N 235 
LEU N   H2   sing N N 236 
LEU CA  C    sing N N 237 
LEU CA  CB   sing N N 238 
LEU CA  HA   sing N N 239 
LEU C   O    doub N N 240 
LEU C   OXT  sing N N 241 
LEU CB  CG   sing N N 242 
LEU CB  HB2  sing N N 243 
LEU CB  HB3  sing N N 244 
LEU CG  CD1  sing N N 245 
LEU CG  CD2  sing N N 246 
LEU CG  HG   sing N N 247 
LEU CD1 HD11 sing N N 248 
LEU CD1 HD12 sing N N 249 
LEU CD1 HD13 sing N N 250 
LEU CD2 HD21 sing N N 251 
LEU CD2 HD22 sing N N 252 
LEU CD2 HD23 sing N N 253 
LEU OXT HXT  sing N N 254 
LYS N   CA   sing N N 255 
LYS N   H    sing N N 256 
LYS N   H2   sing N N 257 
LYS CA  C    sing N N 258 
LYS CA  CB   sing N N 259 
LYS CA  HA   sing N N 260 
LYS C   O    doub N N 261 
LYS C   OXT  sing N N 262 
LYS CB  CG   sing N N 263 
LYS CB  HB2  sing N N 264 
LYS CB  HB3  sing N N 265 
LYS CG  CD   sing N N 266 
LYS CG  HG2  sing N N 267 
LYS CG  HG3  sing N N 268 
LYS CD  CE   sing N N 269 
LYS CD  HD2  sing N N 270 
LYS CD  HD3  sing N N 271 
LYS CE  NZ   sing N N 272 
LYS CE  HE2  sing N N 273 
LYS CE  HE3  sing N N 274 
LYS NZ  HZ1  sing N N 275 
LYS NZ  HZ2  sing N N 276 
LYS NZ  HZ3  sing N N 277 
LYS OXT HXT  sing N N 278 
MET N   CA   sing N N 279 
MET N   H    sing N N 280 
MET N   H2   sing N N 281 
MET CA  C    sing N N 282 
MET CA  CB   sing N N 283 
MET CA  HA   sing N N 284 
MET C   O    doub N N 285 
MET C   OXT  sing N N 286 
MET CB  CG   sing N N 287 
MET CB  HB2  sing N N 288 
MET CB  HB3  sing N N 289 
MET CG  SD   sing N N 290 
MET CG  HG2  sing N N 291 
MET CG  HG3  sing N N 292 
MET SD  CE   sing N N 293 
MET CE  HE1  sing N N 294 
MET CE  HE2  sing N N 295 
MET CE  HE3  sing N N 296 
MET OXT HXT  sing N N 297 
PHE N   CA   sing N N 298 
PHE N   H    sing N N 299 
PHE N   H2   sing N N 300 
PHE CA  C    sing N N 301 
PHE CA  CB   sing N N 302 
PHE CA  HA   sing N N 303 
PHE C   O    doub N N 304 
PHE C   OXT  sing N N 305 
PHE CB  CG   sing N N 306 
PHE CB  HB2  sing N N 307 
PHE CB  HB3  sing N N 308 
PHE CG  CD1  doub Y N 309 
PHE CG  CD2  sing Y N 310 
PHE CD1 CE1  sing Y N 311 
PHE CD1 HD1  sing N N 312 
PHE CD2 CE2  doub Y N 313 
PHE CD2 HD2  sing N N 314 
PHE CE1 CZ   doub Y N 315 
PHE CE1 HE1  sing N N 316 
PHE CE2 CZ   sing Y N 317 
PHE CE2 HE2  sing N N 318 
PHE CZ  HZ   sing N N 319 
PHE OXT HXT  sing N N 320 
PRO N   CA   sing N N 321 
PRO N   CD   sing N N 322 
PRO N   H    sing N N 323 
PRO CA  C    sing N N 324 
PRO CA  CB   sing N N 325 
PRO CA  HA   sing N N 326 
PRO C   O    doub N N 327 
PRO C   OXT  sing N N 328 
PRO CB  CG   sing N N 329 
PRO CB  HB2  sing N N 330 
PRO CB  HB3  sing N N 331 
PRO CG  CD   sing N N 332 
PRO CG  HG2  sing N N 333 
PRO CG  HG3  sing N N 334 
PRO CD  HD2  sing N N 335 
PRO CD  HD3  sing N N 336 
PRO OXT HXT  sing N N 337 
SER N   CA   sing N N 338 
SER N   H    sing N N 339 
SER N   H2   sing N N 340 
SER CA  C    sing N N 341 
SER CA  CB   sing N N 342 
SER CA  HA   sing N N 343 
SER C   O    doub N N 344 
SER C   OXT  sing N N 345 
SER CB  OG   sing N N 346 
SER CB  HB2  sing N N 347 
SER CB  HB3  sing N N 348 
SER OG  HG   sing N N 349 
SER OXT HXT  sing N N 350 
THR N   CA   sing N N 351 
THR N   H    sing N N 352 
THR N   H2   sing N N 353 
THR CA  C    sing N N 354 
THR CA  CB   sing N N 355 
THR CA  HA   sing N N 356 
THR C   O    doub N N 357 
THR C   OXT  sing N N 358 
THR CB  OG1  sing N N 359 
THR CB  CG2  sing N N 360 
THR CB  HB   sing N N 361 
THR OG1 HG1  sing N N 362 
THR CG2 HG21 sing N N 363 
THR CG2 HG22 sing N N 364 
THR CG2 HG23 sing N N 365 
THR OXT HXT  sing N N 366 
TRP N   CA   sing N N 367 
TRP N   H    sing N N 368 
TRP N   H2   sing N N 369 
TRP CA  C    sing N N 370 
TRP CA  CB   sing N N 371 
TRP CA  HA   sing N N 372 
TRP C   O    doub N N 373 
TRP C   OXT  sing N N 374 
TRP CB  CG   sing N N 375 
TRP CB  HB2  sing N N 376 
TRP CB  HB3  sing N N 377 
TRP CG  CD1  doub Y N 378 
TRP CG  CD2  sing Y N 379 
TRP CD1 NE1  sing Y N 380 
TRP CD1 HD1  sing N N 381 
TRP CD2 CE2  doub Y N 382 
TRP CD2 CE3  sing Y N 383 
TRP NE1 CE2  sing Y N 384 
TRP NE1 HE1  sing N N 385 
TRP CE2 CZ2  sing Y N 386 
TRP CE3 CZ3  doub Y N 387 
TRP CE3 HE3  sing N N 388 
TRP CZ2 CH2  doub Y N 389 
TRP CZ2 HZ2  sing N N 390 
TRP CZ3 CH2  sing Y N 391 
TRP CZ3 HZ3  sing N N 392 
TRP CH2 HH2  sing N N 393 
TRP OXT HXT  sing N N 394 
TYR N   CA   sing N N 395 
TYR N   H    sing N N 396 
TYR N   H2   sing N N 397 
TYR CA  C    sing N N 398 
TYR CA  CB   sing N N 399 
TYR CA  HA   sing N N 400 
TYR C   O    doub N N 401 
TYR C   OXT  sing N N 402 
TYR CB  CG   sing N N 403 
TYR CB  HB2  sing N N 404 
TYR CB  HB3  sing N N 405 
TYR CG  CD1  doub Y N 406 
TYR CG  CD2  sing Y N 407 
TYR CD1 CE1  sing Y N 408 
TYR CD1 HD1  sing N N 409 
TYR CD2 CE2  doub Y N 410 
TYR CD2 HD2  sing N N 411 
TYR CE1 CZ   doub Y N 412 
TYR CE1 HE1  sing N N 413 
TYR CE2 CZ   sing Y N 414 
TYR CE2 HE2  sing N N 415 
TYR CZ  OH   sing N N 416 
TYR OH  HH   sing N N 417 
TYR OXT HXT  sing N N 418 
VAL N   CA   sing N N 419 
VAL N   H    sing N N 420 
VAL N   H2   sing N N 421 
VAL CA  C    sing N N 422 
VAL CA  CB   sing N N 423 
VAL CA  HA   sing N N 424 
VAL C   O    doub N N 425 
VAL C   OXT  sing N N 426 
VAL CB  CG1  sing N N 427 
VAL CB  CG2  sing N N 428 
VAL CB  HB   sing N N 429 
VAL CG1 HG11 sing N N 430 
VAL CG1 HG12 sing N N 431 
VAL CG1 HG13 sing N N 432 
VAL CG2 HG21 sing N N 433 
VAL CG2 HG22 sing N N 434 
VAL CG2 HG23 sing N N 435 
VAL OXT HXT  sing N N 436 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   4GHQ 
_pdbx_initial_refinement_model.details          'PDB ENTRY 4GHQ' 
# 
_atom_sites.entry_id                    5C20 
_atom_sites.fract_transf_matrix[1][1]   0.015596 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015489 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013274 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_