data_5C4S # _entry.id 5C4S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5C4S WWPDB D_1000211024 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5C4O unspecified PDB . 5C4T unspecified PDB . 5C4U unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5C4S _pdbx_database_status.recvd_initial_deposition_date 2015-06-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Parthasarathy, G.' 1 'Soisson, S.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 8833 _citation.page_last 8833 _citation.title 'Identification of an allosteric binding site for ROR gamma t inhibition.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/ncomms9833 _citation.pdbx_database_id_PubMed 26640126 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Scheepstra, M.' 1 primary 'Leysen, S.' 2 primary 'van Almen, G.C.' 3 primary 'Miller, J.R.' 4 primary 'Piesvaux, J.' 5 primary 'Kutilek, V.' 6 primary 'van Eenennaam, H.' 7 primary 'Zhang, H.' 8 primary 'Barr, K.' 9 primary 'Nagpal, S.' 10 primary 'Soisson, S.M.' 11 primary 'Kornienko, M.' 12 primary 'Wiley, K.' 13 primary 'Elsen, N.' 14 primary 'Sharma, S.' 15 primary 'Correll, C.C.' 16 primary 'Trotter, B.W.' 17 primary 'van der Stelt, M.' 18 primary 'Oubrie, A.' 19 primary 'Ottmann, C.' 20 primary 'Parthasarathy, G.' 21 primary 'Brunsveld, L.' 22 # _cell.length_a 108.450 _cell.length_b 108.450 _cell.length_c 106.300 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 5C4S _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.entry_id 5C4S _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nuclear receptor ROR-gamma' 28184.672 1 ? ? 'Ligand-binding residues 267-507' ? 2 non-polymer syn '4-{1-[2-chloro-6-(trifluoromethyl)benzoyl]-4-fluoro-1H-indazol-3-yl}-3-fluorobenzoic acid' 480.771 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 4 water nat water 18.015 18 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Nuclear receptor RZR-gamma,Nuclear receptor subfamily 1 group F member 3,RAR-related orphan receptor C,Retinoid-related orphan receptor-gamma ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQ NDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLI NAHRPGLQEKRKVEQLQYNLELAFHHHLHKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELF S ; _entity_poly.pdbx_seq_one_letter_code_can ;LTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQ NDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLI NAHRPGLQEKRKVEQLQYNLELAFHHHLHKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELF S ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 THR n 1 3 GLU n 1 4 ILE n 1 5 GLU n 1 6 HIS n 1 7 LEU n 1 8 VAL n 1 9 GLN n 1 10 SER n 1 11 VAL n 1 12 CYS n 1 13 LYS n 1 14 SER n 1 15 TYR n 1 16 ARG n 1 17 GLU n 1 18 THR n 1 19 CYS n 1 20 GLN n 1 21 LEU n 1 22 ARG n 1 23 LEU n 1 24 GLU n 1 25 ASP n 1 26 LEU n 1 27 LEU n 1 28 ARG n 1 29 GLN n 1 30 ARG n 1 31 SER n 1 32 ASN n 1 33 ILE n 1 34 PHE n 1 35 SER n 1 36 ARG n 1 37 GLU n 1 38 GLU n 1 39 VAL n 1 40 THR n 1 41 GLY n 1 42 TYR n 1 43 GLN n 1 44 ARG n 1 45 LYS n 1 46 SER n 1 47 MET n 1 48 TRP n 1 49 GLU n 1 50 MET n 1 51 TRP n 1 52 GLU n 1 53 ARG n 1 54 CYS n 1 55 ALA n 1 56 HIS n 1 57 HIS n 1 58 LEU n 1 59 THR n 1 60 GLU n 1 61 ALA n 1 62 ILE n 1 63 GLN n 1 64 TYR n 1 65 VAL n 1 66 VAL n 1 67 GLU n 1 68 PHE n 1 69 ALA n 1 70 LYS n 1 71 ARG n 1 72 LEU n 1 73 SER n 1 74 GLY n 1 75 PHE n 1 76 MET n 1 77 GLU n 1 78 LEU n 1 79 CYS n 1 80 GLN n 1 81 ASN n 1 82 ASP n 1 83 GLN n 1 84 ILE n 1 85 VAL n 1 86 LEU n 1 87 LEU n 1 88 LYS n 1 89 ALA n 1 90 GLY n 1 91 ALA n 1 92 MET n 1 93 GLU n 1 94 VAL n 1 95 VAL n 1 96 LEU n 1 97 VAL n 1 98 ARG n 1 99 MET n 1 100 CYS n 1 101 ARG n 1 102 ALA n 1 103 TYR n 1 104 ASN n 1 105 ALA n 1 106 ASP n 1 107 ASN n 1 108 ARG n 1 109 THR n 1 110 VAL n 1 111 PHE n 1 112 PHE n 1 113 GLU n 1 114 GLY n 1 115 LYS n 1 116 TYR n 1 117 GLY n 1 118 GLY n 1 119 MET n 1 120 GLU n 1 121 LEU n 1 122 PHE n 1 123 ARG n 1 124 ALA n 1 125 LEU n 1 126 GLY n 1 127 CYS n 1 128 SER n 1 129 GLU n 1 130 LEU n 1 131 ILE n 1 132 SER n 1 133 SER n 1 134 ILE n 1 135 PHE n 1 136 ASP n 1 137 PHE n 1 138 SER n 1 139 HIS n 1 140 SER n 1 141 LEU n 1 142 SER n 1 143 ALA n 1 144 LEU n 1 145 HIS n 1 146 PHE n 1 147 SER n 1 148 GLU n 1 149 ASP n 1 150 GLU n 1 151 ILE n 1 152 ALA n 1 153 LEU n 1 154 TYR n 1 155 THR n 1 156 ALA n 1 157 LEU n 1 158 VAL n 1 159 LEU n 1 160 ILE n 1 161 ASN n 1 162 ALA n 1 163 HIS n 1 164 ARG n 1 165 PRO n 1 166 GLY n 1 167 LEU n 1 168 GLN n 1 169 GLU n 1 170 LYS n 1 171 ARG n 1 172 LYS n 1 173 VAL n 1 174 GLU n 1 175 GLN n 1 176 LEU n 1 177 GLN n 1 178 TYR n 1 179 ASN n 1 180 LEU n 1 181 GLU n 1 182 LEU n 1 183 ALA n 1 184 PHE n 1 185 HIS n 1 186 HIS n 1 187 HIS n 1 188 LEU n 1 189 HIS n 1 190 LYS n 1 191 THR n 1 192 HIS n 1 193 ARG n 1 194 GLN n 1 195 SER n 1 196 ILE n 1 197 LEU n 1 198 ALA n 1 199 LYS n 1 200 LEU n 1 201 PRO n 1 202 PRO n 1 203 LYS n 1 204 GLY n 1 205 LYS n 1 206 LEU n 1 207 ARG n 1 208 SER n 1 209 LEU n 1 210 CYS n 1 211 SER n 1 212 GLN n 1 213 HIS n 1 214 VAL n 1 215 GLU n 1 216 ARG n 1 217 LEU n 1 218 GLN n 1 219 ILE n 1 220 PHE n 1 221 GLN n 1 222 HIS n 1 223 LEU n 1 224 HIS n 1 225 PRO n 1 226 ILE n 1 227 VAL n 1 228 VAL n 1 229 GLN n 1 230 ALA n 1 231 ALA n 1 232 PHE n 1 233 PRO n 1 234 PRO n 1 235 LEU n 1 236 TYR n 1 237 LYS n 1 238 GLU n 1 239 LEU n 1 240 PHE n 1 241 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 241 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RORC, NR1F3, RORG, RZRG' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RORG_HUMAN _struct_ref.pdbx_db_accession P51449 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQ NDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLI NAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELF S ; _struct_ref.pdbx_align_begin 267 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5C4S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 241 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P51449 _struct_ref_seq.db_align_beg 267 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 507 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 267 _struct_ref_seq.pdbx_auth_seq_align_end 507 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5C4S _struct_ref_seq_dif.mon_id HIS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 189 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P51449 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 455 _struct_ref_seq_dif.details variant _struct_ref_seq_dif.pdbx_auth_seq_num 455 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4Y5 non-polymer . '4-{1-[2-chloro-6-(trifluoromethyl)benzoyl]-4-fluoro-1H-indazol-3-yl}-3-fluorobenzoic acid' ? 'C22 H10 Cl F5 N2 O3' 480.771 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5C4S _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.54 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.2 to 1.8M Ammonium sulfate, 0.1 M Tris HCl' _exptl_crystal_grow.pdbx_pH_range '8 - 9' # _diffrn.ambient_environment ? _diffrn.ambient_temp 273 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-03-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5C4S _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2300 _reflns.d_resolution_low 42.96 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18547 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.35 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.entry_id 5C4S _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.2300 _refine.ls_d_res_low 42.96 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.9900 _refine.ls_number_reflns_obs 18547 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2263 _refine.ls_R_factor_R_work 0.2245 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2609 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0900 _refine.ls_number_reflns_R_free 944 _refine.ls_number_reflns_R_work ? _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 67.7400 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 7.6717 _refine.aniso_B[2][2] 7.6717 _refine.aniso_B[3][3] -15.3433 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9407 _refine.correlation_coeff_Fo_to_Fc_free 0.9159 _refine.overall_SU_R_Cruickshank_DPI 0.2220 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.1920 _refine.pdbx_overall_SU_R_Blow_DPI 0.2230 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.1920 _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.solvent_model_details ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 149.720 _refine.B_iso_min 39.500 _refine.pdbx_overall_phase_error ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_analyze.entry_id 5C4S _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_obs 0.384 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.2300 _refine_hist.d_res_low 42.96 _refine_hist.pdbx_number_atoms_ligand 45 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 2042 _refine_hist.pdbx_number_residues_total 241 _refine_hist.pdbx_B_iso_mean_ligand 64.14 _refine_hist.pdbx_B_iso_mean_solvent 63.87 _refine_hist.pdbx_number_atoms_protein 1979 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' t_dihedral_angle_d 744 ? ? 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' t_trig_c_planes 48 ? ? 8.000 HARMONIC 'X-RAY DIFFRACTION' t_gen_planes 331 ? ? 8.000 HARMONIC 'X-RAY DIFFRACTION' t_it 2076 ? ? 20.000 HARMONIC 'X-RAY DIFFRACTION' t_nbd ? ? ? ? ? 'X-RAY DIFFRACTION' t_improper_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_pseud_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_chiral_improper_torsion 250 ? ? 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_sum_occupancies ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_distance ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_angle ? ? ? ? ? 'X-RAY DIFFRACTION' t_utility_torsion ? ? ? ? ? 'X-RAY DIFFRACTION' t_ideal_dist_contact 2338 ? ? 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' t_bond_d 2076 0.010 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_angle_deg 2801 1.070 ? 2.000 HARMONIC 'X-RAY DIFFRACTION' t_omega_torsion ? 1.890 ? ? ? 'X-RAY DIFFRACTION' t_other_torsion ? 20.460 ? ? ? # _refine_ls_shell.d_res_high 2.2300 _refine_ls_shell.d_res_low 2.3700 _refine_ls_shell.pdbx_total_number_of_bins_used 9 _refine_ls_shell.percent_reflns_obs 99.9900 _refine_ls_shell.number_reflns_R_work 2770 _refine_ls_shell.R_factor_all 0.2625 _refine_ls_shell.R_factor_R_work 0.2613 _refine_ls_shell.R_factor_R_free 0.2851 _refine_ls_shell.percent_reflns_R_free 5.4000 _refine_ls_shell.number_reflns_R_free 158 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 2928 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_obs ? # _struct.entry_id 5C4S _struct.title 'Identification of a Novel Allosteric Binding Site for RORgt Inhibitors' _struct.pdbx_descriptor 'Nuclear receptor ROR-gamma' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5C4S _struct_keywords.text 'allosteric, inhibitor, TRANSCRIPTION-TRANSCRIPTION INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSCRIPTION/TRANSCRIPTION INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 2 ? THR A 18 ? THR A 268 THR A 284 1 ? 17 HELX_P HELX_P2 AA2 ARG A 22 ? GLN A 29 ? ARG A 288 GLN A 295 1 ? 8 HELX_P HELX_P3 AA3 ARG A 30 ? ASN A 32 ? ARG A 296 ASN A 298 5 ? 3 HELX_P HELX_P4 AA4 SER A 35 ? LYS A 45 ? SER A 301 LYS A 311 1 ? 11 HELX_P HELX_P5 AA5 SER A 46 ? ARG A 71 ? SER A 312 ARG A 337 1 ? 26 HELX_P HELX_P6 AA6 CYS A 79 ? MET A 99 ? CYS A 345 MET A 365 1 ? 21 HELX_P HELX_P7 AA7 GLY A 118 ? GLY A 126 ? GLY A 384 GLY A 392 5 ? 9 HELX_P HELX_P8 AA8 CYS A 127 ? ALA A 143 ? CYS A 393 ALA A 409 1 ? 17 HELX_P HELX_P9 AA9 SER A 147 ? ILE A 160 ? SER A 413 ILE A 426 1 ? 14 HELX_P HELX_P10 AB1 GLU A 169 ? THR A 191 ? GLU A 435 THR A 457 1 ? 23 HELX_P HELX_P11 AB2 ARG A 193 ? LEU A 200 ? ARG A 459 LEU A 466 5 ? 8 HELX_P HELX_P12 AB3 PRO A 202 ? HIS A 224 ? PRO A 468 HIS A 490 1 ? 23 HELX_P HELX_P13 AB4 PHE A 232 ? PHE A 240 ? PHE A 498 PHE A 506 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 103 ? ASN A 104 ? TYR A 369 ASN A 370 AA1 2 THR A 109 ? PHE A 112 ? THR A 375 PHE A 378 AA1 3 LYS A 115 ? GLY A 117 ? LYS A 381 GLY A 383 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 104 ? N ASN A 370 O THR A 109 ? O THR A 375 AA1 2 3 N PHE A 112 ? N PHE A 378 O LYS A 115 ? O LYS A 381 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 4Y5 601 ? 17 'binding site for residue 4Y5 A 601' AC2 Software A GOL 602 ? 2 'binding site for residue GOL A 602' AC3 Software A GOL 603 ? 7 'binding site for residue GOL A 603' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 17 LEU A 58 ? LEU A 324 . ? 1_555 ? 2 AC1 17 THR A 59 ? THR A 325 . ? 1_555 ? 3 AC1 17 ILE A 62 ? ILE A 328 . ? 1_555 ? 4 AC1 17 GLN A 63 ? GLN A 329 . ? 1_555 ? 5 AC1 17 LEU A 87 ? LEU A 353 . ? 1_555 ? 6 AC1 17 LYS A 88 ? LYS A 354 . ? 1_555 ? 7 AC1 17 MET A 92 ? MET A 358 . ? 1_555 ? 8 AC1 17 VAL A 214 ? VAL A 480 . ? 1_555 ? 9 AC1 17 LEU A 217 ? LEU A 483 . ? 1_555 ? 10 AC1 17 GLN A 218 ? GLN A 484 . ? 1_555 ? 11 AC1 17 GLN A 221 ? GLN A 487 . ? 1_555 ? 12 AC1 17 ALA A 230 ? ALA A 496 . ? 1_555 ? 13 AC1 17 ALA A 231 ? ALA A 497 . ? 1_555 ? 14 AC1 17 PHE A 232 ? PHE A 498 . ? 1_555 ? 15 AC1 17 LEU A 235 ? LEU A 501 . ? 1_555 ? 16 AC1 17 LEU A 239 ? LEU A 505 . ? 1_555 ? 17 AC1 17 PHE A 240 ? PHE A 506 . ? 1_555 ? 18 AC2 2 LEU A 58 ? LEU A 324 . ? 1_555 ? 19 AC2 2 LEU A 125 ? LEU A 391 . ? 1_555 ? 20 AC3 7 GLY A 126 ? GLY A 392 . ? 1_555 ? 21 AC3 7 CYS A 127 ? CYS A 393 . ? 1_555 ? 22 AC3 7 SER A 128 ? SER A 394 . ? 1_555 ? 23 AC3 7 GLU A 129 ? GLU A 395 . ? 1_555 ? 24 AC3 7 LEU A 130 ? LEU A 396 . ? 1_555 ? 25 AC3 7 LYS A 190 ? LYS A 456 . ? 6_555 ? 26 AC3 7 ARG A 216 ? ARG A 482 . ? 1_555 ? # _atom_sites.entry_id 5C4S _atom_sites.fract_transf_matrix[1][1] 0.009221 _atom_sites.fract_transf_matrix[1][2] 0.005324 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010647 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009407 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 267 267 LEU LEU A . n A 1 2 THR 2 268 268 THR THR A . n A 1 3 GLU 3 269 269 GLU GLU A . n A 1 4 ILE 4 270 270 ILE ILE A . n A 1 5 GLU 5 271 271 GLU GLU A . n A 1 6 HIS 6 272 272 HIS HIS A . n A 1 7 LEU 7 273 273 LEU LEU A . n A 1 8 VAL 8 274 274 VAL VAL A . n A 1 9 GLN 9 275 275 GLN GLN A . n A 1 10 SER 10 276 276 SER SER A . n A 1 11 VAL 11 277 277 VAL VAL A . n A 1 12 CYS 12 278 278 CYS CYS A . n A 1 13 LYS 13 279 279 LYS LYS A . n A 1 14 SER 14 280 280 SER SER A . n A 1 15 TYR 15 281 281 TYR TYR A . n A 1 16 ARG 16 282 282 ARG ARG A . n A 1 17 GLU 17 283 283 GLU GLU A . n A 1 18 THR 18 284 284 THR THR A . n A 1 19 CYS 19 285 285 CYS CYS A . n A 1 20 GLN 20 286 286 GLN GLN A . n A 1 21 LEU 21 287 287 LEU LEU A . n A 1 22 ARG 22 288 288 ARG ARG A . n A 1 23 LEU 23 289 289 LEU LEU A . n A 1 24 GLU 24 290 290 GLU GLU A . n A 1 25 ASP 25 291 291 ASP ASP A . n A 1 26 LEU 26 292 292 LEU LEU A . n A 1 27 LEU 27 293 293 LEU LEU A . n A 1 28 ARG 28 294 294 ARG ARG A . n A 1 29 GLN 29 295 295 GLN GLN A . n A 1 30 ARG 30 296 296 ARG ARG A . n A 1 31 SER 31 297 297 SER SER A . n A 1 32 ASN 32 298 298 ASN ASN A . n A 1 33 ILE 33 299 299 ILE ILE A . n A 1 34 PHE 34 300 300 PHE PHE A . n A 1 35 SER 35 301 301 SER SER A . n A 1 36 ARG 36 302 302 ARG ARG A . n A 1 37 GLU 37 303 303 GLU GLU A . n A 1 38 GLU 38 304 304 GLU GLU A . n A 1 39 VAL 39 305 305 VAL VAL A . n A 1 40 THR 40 306 306 THR THR A . n A 1 41 GLY 41 307 307 GLY GLY A . n A 1 42 TYR 42 308 308 TYR TYR A . n A 1 43 GLN 43 309 309 GLN GLN A . n A 1 44 ARG 44 310 310 ARG ARG A . n A 1 45 LYS 45 311 311 LYS LYS A . n A 1 46 SER 46 312 312 SER SER A . n A 1 47 MET 47 313 313 MET MET A . n A 1 48 TRP 48 314 314 TRP TRP A . n A 1 49 GLU 49 315 315 GLU GLU A . n A 1 50 MET 50 316 316 MET MET A . n A 1 51 TRP 51 317 317 TRP TRP A . n A 1 52 GLU 52 318 318 GLU GLU A . n A 1 53 ARG 53 319 319 ARG ARG A . n A 1 54 CYS 54 320 320 CYS CYS A . n A 1 55 ALA 55 321 321 ALA ALA A . n A 1 56 HIS 56 322 322 HIS HIS A . n A 1 57 HIS 57 323 323 HIS HIS A . n A 1 58 LEU 58 324 324 LEU LEU A . n A 1 59 THR 59 325 325 THR THR A . n A 1 60 GLU 60 326 326 GLU GLU A . n A 1 61 ALA 61 327 327 ALA ALA A . n A 1 62 ILE 62 328 328 ILE ILE A . n A 1 63 GLN 63 329 329 GLN GLN A . n A 1 64 TYR 64 330 330 TYR TYR A . n A 1 65 VAL 65 331 331 VAL VAL A . n A 1 66 VAL 66 332 332 VAL VAL A . n A 1 67 GLU 67 333 333 GLU GLU A . n A 1 68 PHE 68 334 334 PHE PHE A . n A 1 69 ALA 69 335 335 ALA ALA A . n A 1 70 LYS 70 336 336 LYS LYS A . n A 1 71 ARG 71 337 337 ARG ARG A . n A 1 72 LEU 72 338 338 LEU LEU A . n A 1 73 SER 73 339 339 SER SER A . n A 1 74 GLY 74 340 340 GLY GLY A . n A 1 75 PHE 75 341 341 PHE PHE A . n A 1 76 MET 76 342 342 MET MET A . n A 1 77 GLU 77 343 343 GLU GLU A . n A 1 78 LEU 78 344 344 LEU LEU A . n A 1 79 CYS 79 345 345 CYS CYS A . n A 1 80 GLN 80 346 346 GLN GLN A . n A 1 81 ASN 81 347 347 ASN ASN A . n A 1 82 ASP 82 348 348 ASP ASP A . n A 1 83 GLN 83 349 349 GLN GLN A . n A 1 84 ILE 84 350 350 ILE ILE A . n A 1 85 VAL 85 351 351 VAL VAL A . n A 1 86 LEU 86 352 352 LEU LEU A . n A 1 87 LEU 87 353 353 LEU LEU A . n A 1 88 LYS 88 354 354 LYS LYS A . n A 1 89 ALA 89 355 355 ALA ALA A . n A 1 90 GLY 90 356 356 GLY GLY A . n A 1 91 ALA 91 357 357 ALA ALA A . n A 1 92 MET 92 358 358 MET MET A . n A 1 93 GLU 93 359 359 GLU GLU A . n A 1 94 VAL 94 360 360 VAL VAL A . n A 1 95 VAL 95 361 361 VAL VAL A . n A 1 96 LEU 96 362 362 LEU LEU A . n A 1 97 VAL 97 363 363 VAL VAL A . n A 1 98 ARG 98 364 364 ARG ARG A . n A 1 99 MET 99 365 365 MET MET A . n A 1 100 CYS 100 366 366 CYS CYS A . n A 1 101 ARG 101 367 367 ARG ARG A . n A 1 102 ALA 102 368 368 ALA ALA A . n A 1 103 TYR 103 369 369 TYR TYR A . n A 1 104 ASN 104 370 370 ASN ASN A . n A 1 105 ALA 105 371 371 ALA ALA A . n A 1 106 ASP 106 372 372 ASP ASP A . n A 1 107 ASN 107 373 373 ASN ASN A . n A 1 108 ARG 108 374 374 ARG ARG A . n A 1 109 THR 109 375 375 THR THR A . n A 1 110 VAL 110 376 376 VAL VAL A . n A 1 111 PHE 111 377 377 PHE PHE A . n A 1 112 PHE 112 378 378 PHE PHE A . n A 1 113 GLU 113 379 379 GLU GLU A . n A 1 114 GLY 114 380 380 GLY GLY A . n A 1 115 LYS 115 381 381 LYS LYS A . n A 1 116 TYR 116 382 382 TYR TYR A . n A 1 117 GLY 117 383 383 GLY GLY A . n A 1 118 GLY 118 384 384 GLY GLY A . n A 1 119 MET 119 385 385 MET MET A . n A 1 120 GLU 120 386 386 GLU GLU A . n A 1 121 LEU 121 387 387 LEU LEU A . n A 1 122 PHE 122 388 388 PHE PHE A . n A 1 123 ARG 123 389 389 ARG ARG A . n A 1 124 ALA 124 390 390 ALA ALA A . n A 1 125 LEU 125 391 391 LEU LEU A . n A 1 126 GLY 126 392 392 GLY GLY A . n A 1 127 CYS 127 393 393 CYS CYS A . n A 1 128 SER 128 394 394 SER SER A . n A 1 129 GLU 129 395 395 GLU GLU A . n A 1 130 LEU 130 396 396 LEU LEU A . n A 1 131 ILE 131 397 397 ILE ILE A . n A 1 132 SER 132 398 398 SER SER A . n A 1 133 SER 133 399 399 SER SER A . n A 1 134 ILE 134 400 400 ILE ILE A . n A 1 135 PHE 135 401 401 PHE PHE A . n A 1 136 ASP 136 402 402 ASP ASP A . n A 1 137 PHE 137 403 403 PHE PHE A . n A 1 138 SER 138 404 404 SER SER A . n A 1 139 HIS 139 405 405 HIS HIS A . n A 1 140 SER 140 406 406 SER SER A . n A 1 141 LEU 141 407 407 LEU LEU A . n A 1 142 SER 142 408 408 SER SER A . n A 1 143 ALA 143 409 409 ALA ALA A . n A 1 144 LEU 144 410 410 LEU LEU A . n A 1 145 HIS 145 411 411 HIS HIS A . n A 1 146 PHE 146 412 412 PHE PHE A . n A 1 147 SER 147 413 413 SER SER A . n A 1 148 GLU 148 414 414 GLU GLU A . n A 1 149 ASP 149 415 415 ASP ASP A . n A 1 150 GLU 150 416 416 GLU GLU A . n A 1 151 ILE 151 417 417 ILE ILE A . n A 1 152 ALA 152 418 418 ALA ALA A . n A 1 153 LEU 153 419 419 LEU LEU A . n A 1 154 TYR 154 420 420 TYR TYR A . n A 1 155 THR 155 421 421 THR THR A . n A 1 156 ALA 156 422 422 ALA ALA A . n A 1 157 LEU 157 423 423 LEU LEU A . n A 1 158 VAL 158 424 424 VAL VAL A . n A 1 159 LEU 159 425 425 LEU LEU A . n A 1 160 ILE 160 426 426 ILE ILE A . n A 1 161 ASN 161 427 427 ASN ASN A . n A 1 162 ALA 162 428 428 ALA ALA A . n A 1 163 HIS 163 429 429 HIS HIS A . n A 1 164 ARG 164 430 430 ARG ARG A . n A 1 165 PRO 165 431 431 PRO PRO A . n A 1 166 GLY 166 432 432 GLY GLY A . n A 1 167 LEU 167 433 433 LEU LEU A . n A 1 168 GLN 168 434 434 GLN GLN A . n A 1 169 GLU 169 435 435 GLU GLU A . n A 1 170 LYS 170 436 436 LYS LYS A . n A 1 171 ARG 171 437 437 ARG ARG A . n A 1 172 LYS 172 438 438 LYS LYS A . n A 1 173 VAL 173 439 439 VAL VAL A . n A 1 174 GLU 174 440 440 GLU GLU A . n A 1 175 GLN 175 441 441 GLN GLN A . n A 1 176 LEU 176 442 442 LEU LEU A . n A 1 177 GLN 177 443 443 GLN GLN A . n A 1 178 TYR 178 444 444 TYR TYR A . n A 1 179 ASN 179 445 445 ASN ASN A . n A 1 180 LEU 180 446 446 LEU LEU A . n A 1 181 GLU 181 447 447 GLU GLU A . n A 1 182 LEU 182 448 448 LEU LEU A . n A 1 183 ALA 183 449 449 ALA ALA A . n A 1 184 PHE 184 450 450 PHE PHE A . n A 1 185 HIS 185 451 451 HIS HIS A . n A 1 186 HIS 186 452 452 HIS HIS A . n A 1 187 HIS 187 453 453 HIS HIS A . n A 1 188 LEU 188 454 454 LEU LEU A . n A 1 189 HIS 189 455 455 HIS HIS A . n A 1 190 LYS 190 456 456 LYS LYS A . n A 1 191 THR 191 457 457 THR THR A . n A 1 192 HIS 192 458 458 HIS HIS A . n A 1 193 ARG 193 459 459 ARG ARG A . n A 1 194 GLN 194 460 460 GLN GLN A . n A 1 195 SER 195 461 461 SER SER A . n A 1 196 ILE 196 462 462 ILE ILE A . n A 1 197 LEU 197 463 463 LEU LEU A . n A 1 198 ALA 198 464 464 ALA ALA A . n A 1 199 LYS 199 465 465 LYS LYS A . n A 1 200 LEU 200 466 466 LEU LEU A . n A 1 201 PRO 201 467 467 PRO PRO A . n A 1 202 PRO 202 468 468 PRO PRO A . n A 1 203 LYS 203 469 469 LYS LYS A . n A 1 204 GLY 204 470 470 GLY GLY A . n A 1 205 LYS 205 471 471 LYS LYS A . n A 1 206 LEU 206 472 472 LEU LEU A . n A 1 207 ARG 207 473 473 ARG ARG A . n A 1 208 SER 208 474 474 SER SER A . n A 1 209 LEU 209 475 475 LEU LEU A . n A 1 210 CYS 210 476 476 CYS CYS A . n A 1 211 SER 211 477 477 SER SER A . n A 1 212 GLN 212 478 478 GLN GLN A . n A 1 213 HIS 213 479 479 HIS HIS A . n A 1 214 VAL 214 480 480 VAL VAL A . n A 1 215 GLU 215 481 481 GLU GLU A . n A 1 216 ARG 216 482 482 ARG ARG A . n A 1 217 LEU 217 483 483 LEU LEU A . n A 1 218 GLN 218 484 484 GLN GLN A . n A 1 219 ILE 219 485 485 ILE ILE A . n A 1 220 PHE 220 486 486 PHE PHE A . n A 1 221 GLN 221 487 487 GLN GLN A . n A 1 222 HIS 222 488 488 HIS HIS A . n A 1 223 LEU 223 489 489 LEU LEU A . n A 1 224 HIS 224 490 490 HIS HIS A . n A 1 225 PRO 225 491 491 PRO PRO A . n A 1 226 ILE 226 492 492 ILE ILE A . n A 1 227 VAL 227 493 493 VAL VAL A . n A 1 228 VAL 228 494 494 VAL VAL A . n A 1 229 GLN 229 495 495 GLN GLN A . n A 1 230 ALA 230 496 496 ALA ALA A . n A 1 231 ALA 231 497 497 ALA ALA A . n A 1 232 PHE 232 498 498 PHE PHE A . n A 1 233 PRO 233 499 499 PRO PRO A . n A 1 234 PRO 234 500 500 PRO PRO A . n A 1 235 LEU 235 501 501 LEU LEU A . n A 1 236 TYR 236 502 502 TYR TYR A . n A 1 237 LYS 237 503 503 LYS LYS A . n A 1 238 GLU 238 504 504 GLU GLU A . n A 1 239 LEU 239 505 505 LEU LEU A . n A 1 240 PHE 240 506 506 PHE PHE A . n A 1 241 SER 241 507 507 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 4Y5 1 601 1 4Y5 299 A . C 3 GOL 1 602 1 GOL GOL A . D 3 GOL 1 603 2 GOL GOL A . E 4 HOH 1 701 9 HOH HOH A . E 4 HOH 2 702 10 HOH HOH A . E 4 HOH 3 703 13 HOH HOH A . E 4 HOH 4 704 1 HOH HOH A . E 4 HOH 5 705 17 HOH HOH A . E 4 HOH 6 706 7 HOH HOH A . E 4 HOH 7 707 8 HOH HOH A . E 4 HOH 8 708 2 HOH HOH A . E 4 HOH 9 709 18 HOH HOH A . E 4 HOH 10 710 12 HOH HOH A . E 4 HOH 11 711 4 HOH HOH A . E 4 HOH 12 712 11 HOH HOH A . E 4 HOH 13 713 5 HOH HOH A . E 4 HOH 14 714 3 HOH HOH A . E 4 HOH 15 715 14 HOH HOH A . E 4 HOH 16 716 6 HOH HOH A . E 4 HOH 17 717 16 HOH HOH A . E 4 HOH 18 718 15 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2015-12-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.5 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 393 ? ? -145.86 57.95 2 1 GLU A 435 ? ? -114.82 65.87 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-{1-[2-chloro-6-(trifluoromethyl)benzoyl]-4-fluoro-1H-indazol-3-yl}-3-fluorobenzoic acid' 4Y5 3 GLYCEROL GOL 4 water HOH #