data_5C82 # _entry.id 5C82 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5C82 pdb_00005c82 10.2210/pdb5c82/pdb WWPDB D_1000211198 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-29 2 'Structure model' 2 0 2018-07-04 3 'Structure model' 2 1 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Polymer sequence' 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Database references' 7 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' diffrn_source 3 2 'Structure model' entity_poly 4 2 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' chem_comp_atom 6 3 'Structure model' chem_comp_bond 7 3 'Structure model' database_2 8 3 'Structure model' pdbx_entry_details 9 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_CSD' 2 2 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline' 3 2 'Structure model' '_diffrn_source.type' 4 2 'Structure model' '_entity_poly.pdbx_target_identifier' 5 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5C82 _pdbx_database_status.recvd_initial_deposition_date 2015-06-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kumar, D.' 1 ? 'Ghosh, A.' 2 ? 'Taneja, B.' 3 ? 'Chakraborty, K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of Nourseothricin acetyltransferase' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumar, D.' 1 ? primary 'Ghosh, A.' 2 ? primary 'Taneja, B.' 3 ? primary 'Chakraborty, K.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nourseothricin acetyltransferase' 20790.867 1 ? ? ? ? 2 non-polymer syn 'D(-)-TARTARIC ACID' 150.087 1 ? ? ? ? 3 water nat water 18.015 97 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GTTLDDTAYRYRTSVPGDAEAIEALDGSFTTDTVFRVTATGDGFTLREVPVDPPLTKVFPDDESDDESDDGEDGD PDSRTFVAYGDDGDLAGFVVVSYSGWNRRLTVEDIEVAPEHRGHGVGRAL(MSE)GLATEFARERGAGHLWLEVTNVNAP AIHAYRR(MSE)GFTLCGLDTALYDGTASDGEQALY(MSE)S(MSE)PCP ; _entity_poly.pdbx_seq_one_letter_code_can ;MGTTLDDTAYRYRTSVPGDAEAIEALDGSFTTDTVFRVTATGDGFTLREVPVDPPLTKVFPDDESDDESDDGEDGDPDSR TFVAYGDDGDLAGFVVVSYSGWNRRLTVEDIEVAPEHRGHGVGRALMGLATEFARERGAGHLWLEVTNVNAPAIHAYRRM GFTLCGLDTALYDGTASDGEQALYMSMPCP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'D(-)-TARTARIC ACID' TAR 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 THR n 1 4 THR n 1 5 LEU n 1 6 ASP n 1 7 ASP n 1 8 THR n 1 9 ALA n 1 10 TYR n 1 11 ARG n 1 12 TYR n 1 13 ARG n 1 14 THR n 1 15 SER n 1 16 VAL n 1 17 PRO n 1 18 GLY n 1 19 ASP n 1 20 ALA n 1 21 GLU n 1 22 ALA n 1 23 ILE n 1 24 GLU n 1 25 ALA n 1 26 LEU n 1 27 ASP n 1 28 GLY n 1 29 SER n 1 30 PHE n 1 31 THR n 1 32 THR n 1 33 ASP n 1 34 THR n 1 35 VAL n 1 36 PHE n 1 37 ARG n 1 38 VAL n 1 39 THR n 1 40 ALA n 1 41 THR n 1 42 GLY n 1 43 ASP n 1 44 GLY n 1 45 PHE n 1 46 THR n 1 47 LEU n 1 48 ARG n 1 49 GLU n 1 50 VAL n 1 51 PRO n 1 52 VAL n 1 53 ASP n 1 54 PRO n 1 55 PRO n 1 56 LEU n 1 57 THR n 1 58 LYS n 1 59 VAL n 1 60 PHE n 1 61 PRO n 1 62 ASP n 1 63 ASP n 1 64 GLU n 1 65 SER n 1 66 ASP n 1 67 ASP n 1 68 GLU n 1 69 SER n 1 70 ASP n 1 71 ASP n 1 72 GLY n 1 73 GLU n 1 74 ASP n 1 75 GLY n 1 76 ASP n 1 77 PRO n 1 78 ASP n 1 79 SER n 1 80 ARG n 1 81 THR n 1 82 PHE n 1 83 VAL n 1 84 ALA n 1 85 TYR n 1 86 GLY n 1 87 ASP n 1 88 ASP n 1 89 GLY n 1 90 ASP n 1 91 LEU n 1 92 ALA n 1 93 GLY n 1 94 PHE n 1 95 VAL n 1 96 VAL n 1 97 VAL n 1 98 SER n 1 99 TYR n 1 100 SER n 1 101 GLY n 1 102 TRP n 1 103 ASN n 1 104 ARG n 1 105 ARG n 1 106 LEU n 1 107 THR n 1 108 VAL n 1 109 GLU n 1 110 ASP n 1 111 ILE n 1 112 GLU n 1 113 VAL n 1 114 ALA n 1 115 PRO n 1 116 GLU n 1 117 HIS n 1 118 ARG n 1 119 GLY n 1 120 HIS n 1 121 GLY n 1 122 VAL n 1 123 GLY n 1 124 ARG n 1 125 ALA n 1 126 LEU n 1 127 MSE n 1 128 GLY n 1 129 LEU n 1 130 ALA n 1 131 THR n 1 132 GLU n 1 133 PHE n 1 134 ALA n 1 135 ARG n 1 136 GLU n 1 137 ARG n 1 138 GLY n 1 139 ALA n 1 140 GLY n 1 141 HIS n 1 142 LEU n 1 143 TRP n 1 144 LEU n 1 145 GLU n 1 146 VAL n 1 147 THR n 1 148 ASN n 1 149 VAL n 1 150 ASN n 1 151 ALA n 1 152 PRO n 1 153 ALA n 1 154 ILE n 1 155 HIS n 1 156 ALA n 1 157 TYR n 1 158 ARG n 1 159 ARG n 1 160 MSE n 1 161 GLY n 1 162 PHE n 1 163 THR n 1 164 LEU n 1 165 CYS n 1 166 GLY n 1 167 LEU n 1 168 ASP n 1 169 THR n 1 170 ALA n 1 171 LEU n 1 172 TYR n 1 173 ASP n 1 174 GLY n 1 175 THR n 1 176 ALA n 1 177 SER n 1 178 ASP n 1 179 GLY n 1 180 GLU n 1 181 GLN n 1 182 ALA n 1 183 LEU n 1 184 TYR n 1 185 MSE n 1 186 SER n 1 187 MSE n 1 188 PRO n 1 189 CYS n 1 190 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 190 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene nat1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces noursei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1971 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) ROSETTA' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-SUMO _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TAR non-polymer . 'D(-)-TARTARIC ACID' ? 'C4 H6 O6' 150.087 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 ASP 7 7 ? ? ? A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 ASP 63 63 ? ? ? A . n A 1 64 GLU 64 64 ? ? ? A . n A 1 65 SER 65 65 ? ? ? A . n A 1 66 ASP 66 66 ? ? ? A . n A 1 67 ASP 67 67 ? ? ? A . n A 1 68 GLU 68 68 ? ? ? A . n A 1 69 SER 69 69 ? ? ? A . n A 1 70 ASP 70 70 ? ? ? A . n A 1 71 ASP 71 71 ? ? ? A . n A 1 72 GLY 72 72 ? ? ? A . n A 1 73 GLU 73 73 ? ? ? A . n A 1 74 ASP 74 74 ? ? ? A . n A 1 75 GLY 75 75 ? ? ? A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 TRP 102 102 102 TRP TRP A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 MSE 127 127 127 MSE MSE A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 TRP 143 143 143 TRP TRP A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 MSE 160 160 160 MSE MSE A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 CYS 165 165 165 CYS CYS A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 ASP 178 178 178 ASP ASP A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 TYR 184 184 184 TYR TYR A . n A 1 185 MSE 185 185 185 MSE MSE A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 MSE 187 187 187 MSE MSE A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 CYS 189 189 189 CYS CYS A . n A 1 190 PRO 190 190 190 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TAR 1 201 0 TAR TAR A . C 3 HOH 1 301 93 HOH HOH A . C 3 HOH 2 302 97 HOH HOH A . C 3 HOH 3 303 94 HOH HOH A . C 3 HOH 4 304 36 HOH HOH A . C 3 HOH 5 305 2 HOH HOH A . C 3 HOH 6 306 95 HOH HOH A . C 3 HOH 7 307 73 HOH HOH A . C 3 HOH 8 308 22 HOH HOH A . C 3 HOH 9 309 92 HOH HOH A . C 3 HOH 10 310 74 HOH HOH A . C 3 HOH 11 311 75 HOH HOH A . C 3 HOH 12 312 20 HOH HOH A . C 3 HOH 13 313 12 HOH HOH A . C 3 HOH 14 314 5 HOH HOH A . C 3 HOH 15 315 23 HOH HOH A . C 3 HOH 16 316 25 HOH HOH A . C 3 HOH 17 317 39 HOH HOH A . C 3 HOH 18 318 59 HOH HOH A . C 3 HOH 19 319 45 HOH HOH A . C 3 HOH 20 320 52 HOH HOH A . C 3 HOH 21 321 53 HOH HOH A . C 3 HOH 22 322 3 HOH HOH A . C 3 HOH 23 323 72 HOH HOH A . C 3 HOH 24 324 50 HOH HOH A . C 3 HOH 25 325 85 HOH HOH A . C 3 HOH 26 326 10 HOH HOH A . C 3 HOH 27 327 64 HOH HOH A . C 3 HOH 28 328 89 HOH HOH A . C 3 HOH 29 329 77 HOH HOH A . C 3 HOH 30 330 96 HOH HOH A . C 3 HOH 31 331 1 HOH HOH A . C 3 HOH 32 332 42 HOH HOH A . C 3 HOH 33 333 48 HOH HOH A . C 3 HOH 34 334 16 HOH HOH A . C 3 HOH 35 335 6 HOH HOH A . C 3 HOH 36 336 79 HOH HOH A . C 3 HOH 37 337 37 HOH HOH A . C 3 HOH 38 338 65 HOH HOH A . C 3 HOH 39 339 67 HOH HOH A . C 3 HOH 40 340 19 HOH HOH A . C 3 HOH 41 341 28 HOH HOH A . C 3 HOH 42 342 27 HOH HOH A . C 3 HOH 43 343 71 HOH HOH A . C 3 HOH 44 344 21 HOH HOH A . C 3 HOH 45 345 58 HOH HOH A . C 3 HOH 46 346 14 HOH HOH A . C 3 HOH 47 347 84 HOH HOH A . C 3 HOH 48 348 34 HOH HOH A . C 3 HOH 49 349 9 HOH HOH A . C 3 HOH 50 350 31 HOH HOH A . C 3 HOH 51 351 76 HOH HOH A . C 3 HOH 52 352 51 HOH HOH A . C 3 HOH 53 353 26 HOH HOH A . C 3 HOH 54 354 70 HOH HOH A . C 3 HOH 55 355 7 HOH HOH A . C 3 HOH 56 356 46 HOH HOH A . C 3 HOH 57 357 78 HOH HOH A . C 3 HOH 58 358 8 HOH HOH A . C 3 HOH 59 359 17 HOH HOH A . C 3 HOH 60 360 83 HOH HOH A . C 3 HOH 61 361 38 HOH HOH A . C 3 HOH 62 362 80 HOH HOH A . C 3 HOH 63 363 32 HOH HOH A . C 3 HOH 64 364 62 HOH HOH A . C 3 HOH 65 365 24 HOH HOH A . C 3 HOH 66 366 55 HOH HOH A . C 3 HOH 67 367 56 HOH HOH A . C 3 HOH 68 368 40 HOH HOH A . C 3 HOH 69 369 47 HOH HOH A . C 3 HOH 70 370 87 HOH HOH A . C 3 HOH 71 371 4 HOH HOH A . C 3 HOH 72 372 81 HOH HOH A . C 3 HOH 73 373 90 HOH HOH A . C 3 HOH 74 374 11 HOH HOH A . C 3 HOH 75 375 63 HOH HOH A . C 3 HOH 76 376 33 HOH HOH A . C 3 HOH 77 377 43 HOH HOH A . C 3 HOH 78 378 29 HOH HOH A . C 3 HOH 79 379 49 HOH HOH A . C 3 HOH 80 380 41 HOH HOH A . C 3 HOH 81 381 54 HOH HOH A . C 3 HOH 82 382 30 HOH HOH A . C 3 HOH 83 383 91 HOH HOH A . C 3 HOH 84 384 86 HOH HOH A . C 3 HOH 85 385 60 HOH HOH A . C 3 HOH 86 386 82 HOH HOH A . C 3 HOH 87 387 44 HOH HOH A . C 3 HOH 88 388 88 HOH HOH A . C 3 HOH 89 389 69 HOH HOH A . C 3 HOH 90 390 15 HOH HOH A . C 3 HOH 91 391 35 HOH HOH A . C 3 HOH 92 392 66 HOH HOH A . C 3 HOH 93 393 57 HOH HOH A . C 3 HOH 94 394 13 HOH HOH A . C 3 HOH 95 395 61 HOH HOH A . C 3 HOH 96 396 18 HOH HOH A . C 3 HOH 97 397 68 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.2 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 97.67 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5C82 _cell.details ? _cell.formula_units_Z ? _cell.length_a 96.536 _cell.length_a_esd ? _cell.length_b 44.641 _cell.length_b_esd ? _cell.length_c 42.244 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5C82 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5C82 _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.75 _exptl_crystal.description 'THE ENTRY CONTAINS FRIEDEL PAIRS IN F_PLUS/MINUS COLUMNS.' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 297.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M Carboxylic acids (0.2M Sodium formate; 0.2M Ammonium acetate; 0.2M Sodium citrate tribasic dihydrate; 0.2M Sodium potassium tartrate tetrahydrate; 0.2M Sodium oxamate), 0.1 M Buffer System 3(Tris base; BICINE) 8.5, 50 % v/v Precipitant Mix 4(25% v/v MPD; 25% PEG 1000; 25% w/v PEG 3350) ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-225' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-06-09 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si (111) and Si (220) Double crystal monochromato' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.978690 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'RRCAT INDUS-2 BEAMLINE PX-BL21' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.978690 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline PX-BL21 _diffrn_source.pdbx_synchrotron_site 'RRCAT INDUS-2' # _reflns.B_iso_Wilson_estimate 29.45 _reflns.entry_id 5C82 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 33.82 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9075 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.2 _reflns.pdbx_Rmerge_I_obs 0.091 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 90.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.341 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 6.3899 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 2.5328 _refine.aniso_B[2][2] -1.7618 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -4.6281 _refine.B_iso_max ? _refine.B_iso_mean 29.43 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.9328 _refine.correlation_coeff_Fo_to_Fc_free 0.9031 _refine.details 'SF FILE CONTAINS FRIEDEL PAIRS UNDER I/F_MINUS AND I/F_PLUS COLUMNS.' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5C82 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.20 _refine.ls_d_res_low 15.28 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9046 _refine.ls_number_reflns_R_free 465 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.69 _refine.ls_percent_reflns_R_free 5.14 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1829 _refine.ls_R_factor_R_free 0.2239 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1807 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.195 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.196 _refine.pdbx_overall_SU_R_Blow_DPI 0.269 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.257 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5C82 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.269 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1306 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 97 _refine_hist.number_atoms_total 1413 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 15.28 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1347 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.00 ? 1837 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 440 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 30 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 208 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1347 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.98 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 19.50 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 174 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1591 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.20 _refine_ls_shell.d_res_low 2.46 _refine_ls_shell.number_reflns_all 2460 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 126 _refine_ls_shell.number_reflns_R_work 2334 _refine_ls_shell.percent_reflns_obs 95.34 _refine_ls_shell.percent_reflns_R_free 5.12 _refine_ls_shell.R_factor_all 0.1886 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2532 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.1852 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5C82 _struct.title 'Crystal structure of Nourseothricin acetyltransferase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5C82 _struct_keywords.text 'Acettyl transferase, antibiotic ressistance, Se-Met SAD, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q08414_STRNR _struct_ref.pdbx_db_accession Q08414 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTTLDDTAYRYRTSVPGDAEAIEALDGSFTTDTVFRVTATGDGFTLREVPVDPPLTKVFPDDESDDESDAGEDGDPDSRT FVAYGDDGDLAGFVVVSYSGWNRRLTVEDIEVAPEHRGHGVGRALMGLATEFARERGAGHLWLEVTNVNAPAIHAYRRMG FTLCGLDTALYDGTASDGEQALYMSMPCP ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5C82 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 190 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q08414 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 190 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5C82 MSE A 1 ? UNP Q08414 ? ? 'initiating methionine' 1 1 1 5C82 GLY A 2 ? UNP Q08414 MET 1 insertion 2 2 1 5C82 ASP A 71 ? UNP Q08414 ALA 70 'engineered mutation' 71 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2720 ? 1 MORE -8 ? 1 'SSA (A^2)' 16740 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 96.5360000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 16 ? GLY A 18 ? VAL A 16 GLY A 18 5 ? 3 HELX_P HELX_P2 AA2 ASP A 19 ? LEU A 26 ? ASP A 19 LEU A 26 1 ? 8 HELX_P HELX_P3 AA3 PRO A 115 ? ARG A 118 ? PRO A 115 ARG A 118 5 ? 4 HELX_P HELX_P4 AA4 GLY A 121 ? GLY A 138 ? GLY A 121 GLY A 138 1 ? 18 HELX_P HELX_P5 AA5 ASN A 150 ? ARG A 159 ? ASN A 150 ARG A 159 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 126 C ? ? ? 1_555 A MSE 127 N ? ? A LEU 126 A MSE 127 1_555 ? ? ? ? ? ? ? 1.354 ? ? covale2 covale both ? A MSE 127 C ? ? ? 1_555 A GLY 128 N ? ? A MSE 127 A GLY 128 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale3 covale both ? A ARG 159 C ? ? ? 1_555 A MSE 160 N ? ? A ARG 159 A MSE 160 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale4 covale both ? A MSE 160 C ? ? ? 1_555 A GLY 161 N ? ? A MSE 160 A GLY 161 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale5 covale both ? A TYR 184 C ? ? ? 1_555 A MSE 185 N ? ? A TYR 184 A MSE 185 1_555 ? ? ? ? ? ? ? 1.353 ? ? covale6 covale both ? A MSE 185 C ? ? ? 1_555 A SER 186 N ? ? A MSE 185 A SER 186 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale7 covale both ? A SER 186 C ? ? ? 1_555 A MSE 187 N ? ? A SER 186 A MSE 187 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale8 covale both ? A MSE 187 C ? ? ? 1_555 A PRO 188 N ? ? A MSE 187 A PRO 188 1_555 ? ? ? ? ? ? ? 1.364 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 127 ? . . . . MSE A 127 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 160 ? . . . . MSE A 160 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 185 ? . . . . MSE A 185 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 187 ? . . . . MSE A 187 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 53 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 53 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 54 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 54 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.91 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 11 ? THR A 14 ? ARG A 11 THR A 14 AA1 2 SER A 79 ? TYR A 85 ? SER A 79 TYR A 85 AA1 3 LEU A 91 ? SER A 100 ? LEU A 91 SER A 100 AA1 4 ARG A 105 ? VAL A 113 ? ARG A 105 VAL A 113 AA1 5 HIS A 141 ? THR A 147 ? HIS A 141 THR A 147 AA1 6 ALA A 182 ? PRO A 188 ? ALA A 182 PRO A 188 AA1 7 THR A 163 ? ASP A 168 ? THR A 163 ASP A 168 AA2 1 PHE A 30 ? ALA A 40 ? PHE A 30 ALA A 40 AA2 2 PHE A 45 ? LYS A 58 ? PHE A 45 LYS A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 13 ? N ARG A 13 O VAL A 83 ? O VAL A 83 AA1 2 3 N ARG A 80 ? N ARG A 80 O VAL A 97 ? O VAL A 97 AA1 3 4 N SER A 98 ? N SER A 98 O THR A 107 ? O THR A 107 AA1 4 5 N VAL A 108 ? N VAL A 108 O TRP A 143 ? O TRP A 143 AA1 5 6 N LEU A 142 ? N LEU A 142 O MSE A 187 ? O MSE A 187 AA1 6 7 O TYR A 184 ? O TYR A 184 N CYS A 165 ? N CYS A 165 AA2 1 2 N ARG A 37 ? N ARG A 37 O ARG A 48 ? O ARG A 48 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id TAR _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'binding site for residue TAR A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 ILE A 111 ? ILE A 111 . ? 1_555 ? 2 AC1 10 VAL A 113 ? VAL A 113 . ? 1_555 ? 3 AC1 10 GLY A 123 ? GLY A 123 . ? 1_555 ? 4 AC1 10 ALA A 153 ? ALA A 153 . ? 1_555 ? 5 AC1 10 ALA A 156 ? ALA A 156 . ? 1_555 ? 6 AC1 10 TYR A 157 ? TYR A 157 . ? 1_555 ? 7 AC1 10 HOH C . ? HOH A 304 . ? 1_555 ? 8 AC1 10 HOH C . ? HOH A 316 . ? 1_555 ? 9 AC1 10 HOH C . ? HOH A 323 . ? 1_555 ? 10 AC1 10 HOH C . ? HOH A 355 . ? 1_555 ? # _pdbx_entry_details.entry_id 5C82 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 9 ? ? 76.91 -1.01 2 1 PRO A 61 ? ? -82.59 45.99 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 127 A MSE 127 ? MET 'modified residue' 2 A MSE 160 A MSE 160 ? MET 'modified residue' 3 A MSE 185 A MSE 185 ? MET 'modified residue' 4 A MSE 187 A MSE 187 ? MET 'modified residue' # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 397 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.98 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A ASP 7 ? A ASP 7 8 1 Y 1 A ASP 63 ? A ASP 63 9 1 Y 1 A GLU 64 ? A GLU 64 10 1 Y 1 A SER 65 ? A SER 65 11 1 Y 1 A ASP 66 ? A ASP 66 12 1 Y 1 A ASP 67 ? A ASP 67 13 1 Y 1 A GLU 68 ? A GLU 68 14 1 Y 1 A SER 69 ? A SER 69 15 1 Y 1 A ASP 70 ? A ASP 70 16 1 Y 1 A ASP 71 ? A ASP 71 17 1 Y 1 A GLY 72 ? A GLY 72 18 1 Y 1 A GLU 73 ? A GLU 73 19 1 Y 1 A ASP 74 ? A ASP 74 20 1 Y 1 A GLY 75 ? A GLY 75 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MSE N N N N 250 MSE CA C N S 251 MSE C C N N 252 MSE O O N N 253 MSE OXT O N N 254 MSE CB C N N 255 MSE CG C N N 256 MSE SE SE N N 257 MSE CE C N N 258 MSE H H N N 259 MSE H2 H N N 260 MSE HA H N N 261 MSE HXT H N N 262 MSE HB2 H N N 263 MSE HB3 H N N 264 MSE HG2 H N N 265 MSE HG3 H N N 266 MSE HE1 H N N 267 MSE HE2 H N N 268 MSE HE3 H N N 269 PHE N N N N 270 PHE CA C N S 271 PHE C C N N 272 PHE O O N N 273 PHE CB C N N 274 PHE CG C Y N 275 PHE CD1 C Y N 276 PHE CD2 C Y N 277 PHE CE1 C Y N 278 PHE CE2 C Y N 279 PHE CZ C Y N 280 PHE OXT O N N 281 PHE H H N N 282 PHE H2 H N N 283 PHE HA H N N 284 PHE HB2 H N N 285 PHE HB3 H N N 286 PHE HD1 H N N 287 PHE HD2 H N N 288 PHE HE1 H N N 289 PHE HE2 H N N 290 PHE HZ H N N 291 PHE HXT H N N 292 PRO N N N N 293 PRO CA C N S 294 PRO C C N N 295 PRO O O N N 296 PRO CB C N N 297 PRO CG C N N 298 PRO CD C N N 299 PRO OXT O N N 300 PRO H H N N 301 PRO HA H N N 302 PRO HB2 H N N 303 PRO HB3 H N N 304 PRO HG2 H N N 305 PRO HG3 H N N 306 PRO HD2 H N N 307 PRO HD3 H N N 308 PRO HXT H N N 309 SER N N N N 310 SER CA C N S 311 SER C C N N 312 SER O O N N 313 SER CB C N N 314 SER OG O N N 315 SER OXT O N N 316 SER H H N N 317 SER H2 H N N 318 SER HA H N N 319 SER HB2 H N N 320 SER HB3 H N N 321 SER HG H N N 322 SER HXT H N N 323 TAR O1 O N N 324 TAR O11 O N N 325 TAR C1 C N N 326 TAR C2 C N S 327 TAR O2 O N N 328 TAR C3 C N S 329 TAR O3 O N N 330 TAR C4 C N N 331 TAR O4 O N N 332 TAR O41 O N N 333 TAR HO1 H N N 334 TAR H2 H N N 335 TAR HO2 H N N 336 TAR H3 H N N 337 TAR HO3 H N N 338 TAR HO4 H N N 339 THR N N N N 340 THR CA C N S 341 THR C C N N 342 THR O O N N 343 THR CB C N R 344 THR OG1 O N N 345 THR CG2 C N N 346 THR OXT O N N 347 THR H H N N 348 THR H2 H N N 349 THR HA H N N 350 THR HB H N N 351 THR HG1 H N N 352 THR HG21 H N N 353 THR HG22 H N N 354 THR HG23 H N N 355 THR HXT H N N 356 TRP N N N N 357 TRP CA C N S 358 TRP C C N N 359 TRP O O N N 360 TRP CB C N N 361 TRP CG C Y N 362 TRP CD1 C Y N 363 TRP CD2 C Y N 364 TRP NE1 N Y N 365 TRP CE2 C Y N 366 TRP CE3 C Y N 367 TRP CZ2 C Y N 368 TRP CZ3 C Y N 369 TRP CH2 C Y N 370 TRP OXT O N N 371 TRP H H N N 372 TRP H2 H N N 373 TRP HA H N N 374 TRP HB2 H N N 375 TRP HB3 H N N 376 TRP HD1 H N N 377 TRP HE1 H N N 378 TRP HE3 H N N 379 TRP HZ2 H N N 380 TRP HZ3 H N N 381 TRP HH2 H N N 382 TRP HXT H N N 383 TYR N N N N 384 TYR CA C N S 385 TYR C C N N 386 TYR O O N N 387 TYR CB C N N 388 TYR CG C Y N 389 TYR CD1 C Y N 390 TYR CD2 C Y N 391 TYR CE1 C Y N 392 TYR CE2 C Y N 393 TYR CZ C Y N 394 TYR OH O N N 395 TYR OXT O N N 396 TYR H H N N 397 TYR H2 H N N 398 TYR HA H N N 399 TYR HB2 H N N 400 TYR HB3 H N N 401 TYR HD1 H N N 402 TYR HD2 H N N 403 TYR HE1 H N N 404 TYR HE2 H N N 405 TYR HH H N N 406 TYR HXT H N N 407 VAL N N N N 408 VAL CA C N S 409 VAL C C N N 410 VAL O O N N 411 VAL CB C N N 412 VAL CG1 C N N 413 VAL CG2 C N N 414 VAL OXT O N N 415 VAL H H N N 416 VAL H2 H N N 417 VAL HA H N N 418 VAL HB H N N 419 VAL HG11 H N N 420 VAL HG12 H N N 421 VAL HG13 H N N 422 VAL HG21 H N N 423 VAL HG22 H N N 424 VAL HG23 H N N 425 VAL HXT H N N 426 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 MSE N CA sing N N 237 MSE N H sing N N 238 MSE N H2 sing N N 239 MSE CA C sing N N 240 MSE CA CB sing N N 241 MSE CA HA sing N N 242 MSE C O doub N N 243 MSE C OXT sing N N 244 MSE OXT HXT sing N N 245 MSE CB CG sing N N 246 MSE CB HB2 sing N N 247 MSE CB HB3 sing N N 248 MSE CG SE sing N N 249 MSE CG HG2 sing N N 250 MSE CG HG3 sing N N 251 MSE SE CE sing N N 252 MSE CE HE1 sing N N 253 MSE CE HE2 sing N N 254 MSE CE HE3 sing N N 255 PHE N CA sing N N 256 PHE N H sing N N 257 PHE N H2 sing N N 258 PHE CA C sing N N 259 PHE CA CB sing N N 260 PHE CA HA sing N N 261 PHE C O doub N N 262 PHE C OXT sing N N 263 PHE CB CG sing N N 264 PHE CB HB2 sing N N 265 PHE CB HB3 sing N N 266 PHE CG CD1 doub Y N 267 PHE CG CD2 sing Y N 268 PHE CD1 CE1 sing Y N 269 PHE CD1 HD1 sing N N 270 PHE CD2 CE2 doub Y N 271 PHE CD2 HD2 sing N N 272 PHE CE1 CZ doub Y N 273 PHE CE1 HE1 sing N N 274 PHE CE2 CZ sing Y N 275 PHE CE2 HE2 sing N N 276 PHE CZ HZ sing N N 277 PHE OXT HXT sing N N 278 PRO N CA sing N N 279 PRO N CD sing N N 280 PRO N H sing N N 281 PRO CA C sing N N 282 PRO CA CB sing N N 283 PRO CA HA sing N N 284 PRO C O doub N N 285 PRO C OXT sing N N 286 PRO CB CG sing N N 287 PRO CB HB2 sing N N 288 PRO CB HB3 sing N N 289 PRO CG CD sing N N 290 PRO CG HG2 sing N N 291 PRO CG HG3 sing N N 292 PRO CD HD2 sing N N 293 PRO CD HD3 sing N N 294 PRO OXT HXT sing N N 295 SER N CA sing N N 296 SER N H sing N N 297 SER N H2 sing N N 298 SER CA C sing N N 299 SER CA CB sing N N 300 SER CA HA sing N N 301 SER C O doub N N 302 SER C OXT sing N N 303 SER CB OG sing N N 304 SER CB HB2 sing N N 305 SER CB HB3 sing N N 306 SER OG HG sing N N 307 SER OXT HXT sing N N 308 TAR O1 C1 doub N N 309 TAR O11 C1 sing N N 310 TAR O11 HO1 sing N N 311 TAR C1 C2 sing N N 312 TAR C2 O2 sing N N 313 TAR C2 C3 sing N N 314 TAR C2 H2 sing N N 315 TAR O2 HO2 sing N N 316 TAR C3 O3 sing N N 317 TAR C3 C4 sing N N 318 TAR C3 H3 sing N N 319 TAR O3 HO3 sing N N 320 TAR C4 O4 doub N N 321 TAR C4 O41 sing N N 322 TAR O41 HO4 sing N N 323 THR N CA sing N N 324 THR N H sing N N 325 THR N H2 sing N N 326 THR CA C sing N N 327 THR CA CB sing N N 328 THR CA HA sing N N 329 THR C O doub N N 330 THR C OXT sing N N 331 THR CB OG1 sing N N 332 THR CB CG2 sing N N 333 THR CB HB sing N N 334 THR OG1 HG1 sing N N 335 THR CG2 HG21 sing N N 336 THR CG2 HG22 sing N N 337 THR CG2 HG23 sing N N 338 THR OXT HXT sing N N 339 TRP N CA sing N N 340 TRP N H sing N N 341 TRP N H2 sing N N 342 TRP CA C sing N N 343 TRP CA CB sing N N 344 TRP CA HA sing N N 345 TRP C O doub N N 346 TRP C OXT sing N N 347 TRP CB CG sing N N 348 TRP CB HB2 sing N N 349 TRP CB HB3 sing N N 350 TRP CG CD1 doub Y N 351 TRP CG CD2 sing Y N 352 TRP CD1 NE1 sing Y N 353 TRP CD1 HD1 sing N N 354 TRP CD2 CE2 doub Y N 355 TRP CD2 CE3 sing Y N 356 TRP NE1 CE2 sing Y N 357 TRP NE1 HE1 sing N N 358 TRP CE2 CZ2 sing Y N 359 TRP CE3 CZ3 doub Y N 360 TRP CE3 HE3 sing N N 361 TRP CZ2 CH2 doub Y N 362 TRP CZ2 HZ2 sing N N 363 TRP CZ3 CH2 sing Y N 364 TRP CZ3 HZ3 sing N N 365 TRP CH2 HH2 sing N N 366 TRP OXT HXT sing N N 367 TYR N CA sing N N 368 TYR N H sing N N 369 TYR N H2 sing N N 370 TYR CA C sing N N 371 TYR CA CB sing N N 372 TYR CA HA sing N N 373 TYR C O doub N N 374 TYR C OXT sing N N 375 TYR CB CG sing N N 376 TYR CB HB2 sing N N 377 TYR CB HB3 sing N N 378 TYR CG CD1 doub Y N 379 TYR CG CD2 sing Y N 380 TYR CD1 CE1 sing Y N 381 TYR CD1 HD1 sing N N 382 TYR CD2 CE2 doub Y N 383 TYR CD2 HD2 sing N N 384 TYR CE1 CZ doub Y N 385 TYR CE1 HE1 sing N N 386 TYR CE2 CZ sing Y N 387 TYR CE2 HE2 sing N N 388 TYR CZ OH sing N N 389 TYR OH HH sing N N 390 TYR OXT HXT sing N N 391 VAL N CA sing N N 392 VAL N H sing N N 393 VAL N H2 sing N N 394 VAL CA C sing N N 395 VAL CA CB sing N N 396 VAL CA HA sing N N 397 VAL C O doub N N 398 VAL C OXT sing N N 399 VAL CB CG1 sing N N 400 VAL CB CG2 sing N N 401 VAL CB HB sing N N 402 VAL CG1 HG11 sing N N 403 VAL CG1 HG12 sing N N 404 VAL CG1 HG13 sing N N 405 VAL CG2 HG21 sing N N 406 VAL CG2 HG22 sing N N 407 VAL CG2 HG23 sing N N 408 VAL OXT HXT sing N N 409 # _pdbx_audit_support.funding_organization CSIR-IGIB _pdbx_audit_support.country India _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 5C82 _atom_sites.fract_transf_matrix[1][1] 0.010359 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001395 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022401 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023886 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_