data_5CGV # _entry.id 5CGV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5CGV pdb_00005cgv 10.2210/pdb5cgv/pdb WWPDB D_1000211482 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5CGV _pdbx_database_status.recvd_initial_deposition_date 2015-07-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kumar, G.' 1 'White, S.W.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 113 _citation.language ? _citation.page_first 3669 _citation.page_last 3674 _citation.title 'Identification and characterization of influenza variants resistant to a viral endonuclease inhibitor.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1519772113 _citation.pdbx_database_id_PubMed 26976575 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Song, M.S.' 1 ? primary 'Kumar, G.' 2 ? primary 'Shadrick, W.R.' 3 ? primary 'Zhou, W.' 4 ? primary 'Jeevan, T.' 5 ? primary 'Li, Z.' 6 ? primary 'Slavish, P.J.' 7 ? primary 'Fabrizio, T.P.' 8 ? primary 'Yoon, S.W.' 9 ? primary 'Webb, T.R.' 10 ? primary 'Webby, R.J.' 11 ? primary 'White, S.W.' 12 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5CGV _cell.details ? _cell.formula_units_Z ? _cell.length_a 73.899 _cell.length_a_esd ? _cell.length_b 73.899 _cell.length_b_esd ? _cell.length_c 127.457 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5CGV _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein' 21970.160 1 ? ? 'residues 1-196' ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn '(2Z)-4-[1-benzyl-4-(4-chlorobenzyl)piperidin-4-yl]-2-hydroxy-4-oxobut-2-enoic acid' 413.894 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 64 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTG VEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIR QEMASRSLWDSFRQSERAAAELALVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTG VEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIR QEMASRSLWDSFRQSERAAAELALVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASP n 1 4 PHE n 1 5 VAL n 1 6 ARG n 1 7 GLN n 1 8 CYS n 1 9 PHE n 1 10 ASN n 1 11 PRO n 1 12 MET n 1 13 ILE n 1 14 VAL n 1 15 GLU n 1 16 LEU n 1 17 ALA n 1 18 GLU n 1 19 LYS n 1 20 ALA n 1 21 MET n 1 22 LYS n 1 23 GLU n 1 24 TYR n 1 25 GLY n 1 26 GLU n 1 27 ASP n 1 28 PRO n 1 29 LYS n 1 30 ILE n 1 31 GLU n 1 32 THR n 1 33 ASN n 1 34 LYS n 1 35 PHE n 1 36 ALA n 1 37 ALA n 1 38 ILE n 1 39 CYS n 1 40 THR n 1 41 HIS n 1 42 LEU n 1 43 GLU n 1 44 VAL n 1 45 CYS n 1 46 PHE n 1 47 MET n 1 48 TYR n 1 49 SER n 1 50 ASP n 1 51 GLY n 1 52 GLY n 1 53 SER n 1 54 LYS n 1 55 HIS n 1 56 ARG n 1 57 PHE n 1 58 GLU n 1 59 ILE n 1 60 ILE n 1 61 GLU n 1 62 GLY n 1 63 ARG n 1 64 ASP n 1 65 ARG n 1 66 ILE n 1 67 MET n 1 68 ALA n 1 69 TRP n 1 70 THR n 1 71 VAL n 1 72 VAL n 1 73 ASN n 1 74 SER n 1 75 ILE n 1 76 CYS n 1 77 ASN n 1 78 THR n 1 79 THR n 1 80 GLY n 1 81 VAL n 1 82 GLU n 1 83 LYS n 1 84 PRO n 1 85 LYS n 1 86 PHE n 1 87 LEU n 1 88 PRO n 1 89 ASP n 1 90 LEU n 1 91 TYR n 1 92 ASP n 1 93 TYR n 1 94 LYS n 1 95 GLU n 1 96 ASN n 1 97 ARG n 1 98 PHE n 1 99 ILE n 1 100 GLU n 1 101 ILE n 1 102 GLY n 1 103 VAL n 1 104 THR n 1 105 ARG n 1 106 ARG n 1 107 GLU n 1 108 VAL n 1 109 HIS n 1 110 ILE n 1 111 TYR n 1 112 TYR n 1 113 LEU n 1 114 GLU n 1 115 LYS n 1 116 ALA n 1 117 ASN n 1 118 LYS n 1 119 ILE n 1 120 LYS n 1 121 SER n 1 122 GLU n 1 123 LYS n 1 124 THR n 1 125 HIS n 1 126 ILE n 1 127 HIS n 1 128 ILE n 1 129 PHE n 1 130 SER n 1 131 PHE n 1 132 THR n 1 133 GLY n 1 134 GLU n 1 135 GLU n 1 136 MET n 1 137 ALA n 1 138 THR n 1 139 LYS n 1 140 ALA n 1 141 ASP n 1 142 TYR n 1 143 THR n 1 144 LEU n 1 145 ASP n 1 146 GLU n 1 147 GLU n 1 148 SER n 1 149 ARG n 1 150 ALA n 1 151 ARG n 1 152 ILE n 1 153 LYS n 1 154 THR n 1 155 ARG n 1 156 LEU n 1 157 PHE n 1 158 THR n 1 159 ILE n 1 160 ARG n 1 161 GLN n 1 162 GLU n 1 163 MET n 1 164 ALA n 1 165 SER n 1 166 ARG n 1 167 SER n 1 168 LEU n 1 169 TRP n 1 170 ASP n 1 171 SER n 1 172 PHE n 1 173 ARG n 1 174 GLN n 1 175 SER n 1 176 GLU n 1 177 ARG n 1 178 ALA n 1 179 ALA n 1 180 ALA n 1 181 GLU n 1 182 LEU n 1 183 ALA n 1 184 LEU n 1 185 VAL n 1 186 PRO n 1 187 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 187 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'swl A/California/04/2009 H1N1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Influenza A virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 641501 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET52b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C3W5S0_I09A0 _struct_ref.pdbx_db_accession C3W5S0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGESIIVESGDPNALLKHRFEIIE GRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKAD YTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5CGV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 177 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C3W5S0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 196 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 196 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5CGV ? A ? ? UNP C3W5S0 PHE 51 deletion ? 1 1 5CGV ? A ? ? UNP C3W5S0 HIS 52 deletion ? 2 1 5CGV ? A ? ? UNP C3W5S0 PHE 53 deletion ? 3 1 5CGV ? A ? ? UNP C3W5S0 ILE 54 deletion ? 4 1 5CGV ? A ? ? UNP C3W5S0 ASP 55 deletion ? 5 1 5CGV ? A ? ? UNP C3W5S0 GLU 56 deletion ? 6 1 5CGV ? A ? ? UNP C3W5S0 ARG 57 deletion ? 7 1 5CGV ? A ? ? UNP C3W5S0 GLY 58 deletion ? 8 1 5CGV ? A ? ? UNP C3W5S0 GLU 59 deletion ? 9 1 5CGV ? A ? ? UNP C3W5S0 SER 60 deletion ? 10 1 5CGV ? A ? ? UNP C3W5S0 ILE 61 deletion ? 11 1 5CGV ? A ? ? UNP C3W5S0 ILE 62 deletion ? 12 1 5CGV ? A ? ? UNP C3W5S0 VAL 63 deletion ? 13 1 5CGV ? A ? ? UNP C3W5S0 GLU 64 deletion ? 14 1 5CGV ? A ? ? UNP C3W5S0 SER 65 deletion ? 15 1 5CGV ? A ? ? UNP C3W5S0 GLY 66 deletion ? 16 1 5CGV ? A ? ? UNP C3W5S0 ASP 67 deletion ? 17 1 5CGV ? A ? ? UNP C3W5S0 PRO 68 deletion ? 18 1 5CGV ? A ? ? UNP C3W5S0 ASN 69 deletion ? 19 1 5CGV GLY A 51 ? UNP C3W5S0 ALA 70 linker 51 20 1 5CGV GLY A 52 ? UNP C3W5S0 LEU 71 linker 52 21 1 5CGV SER A 53 ? UNP C3W5S0 LEU 72 linker 53 22 1 5CGV ALA A 178 ? UNP C3W5S0 ? ? 'expression tag' 197 23 1 5CGV ALA A 179 ? UNP C3W5S0 ? ? 'expression tag' 198 24 1 5CGV ALA A 180 ? UNP C3W5S0 ? ? 'expression tag' 199 25 1 5CGV GLU A 181 ? UNP C3W5S0 ? ? 'expression tag' 200 26 1 5CGV LEU A 182 ? UNP C3W5S0 ? ? 'expression tag' 201 27 1 5CGV ALA A 183 ? UNP C3W5S0 ? ? 'expression tag' 202 28 1 5CGV LEU A 184 ? UNP C3W5S0 ? ? 'expression tag' 203 29 1 5CGV VAL A 185 ? UNP C3W5S0 ? ? 'expression tag' 204 30 1 5CGV PRO A 186 ? UNP C3W5S0 ? ? 'expression tag' 205 31 1 5CGV ARG A 187 ? UNP C3W5S0 ? ? 'expression tag' 206 32 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0N8 non-polymer . '(2Z)-4-[1-benzyl-4-(4-chlorobenzyl)piperidin-4-yl]-2-hydroxy-4-oxobut-2-enoic acid' ? 'C23 H24 Cl N O4' 413.894 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5CGV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.46 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M MgCl2, 5mM MnCl2, 0.1 M Tris pH 8.5, 30%(w/v) PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-06-11 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5CGV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.170 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11511 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.800 _reflns.pdbx_Rmerge_I_obs 0.128 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 22.400 _reflns.pdbx_netI_over_sigmaI 6.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.285 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.133 _reflns.pdbx_Rpim_I_all 0.037 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 146974 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.170 2.250 ? ? ? ? ? 1090 ? 98.300 ? ? ? ? 0.893 ? ? ? ? ? ? ? ? 8.100 ? 1.234 ? ? 0.952 0.319 0 1 1 0.763 ? 2.250 2.340 ? ? ? ? ? 1103 ? 100.000 ? ? ? ? 0.799 ? ? ? ? ? ? ? ? 11.400 ? 1.239 ? ? 0.837 0.244 0 2 1 0.924 ? 2.340 2.440 ? ? ? ? ? 1131 ? 100.000 ? ? ? ? 0.692 ? ? ? ? ? ? ? ? 13.800 ? 1.271 ? ? 0.719 0.193 0 3 1 0.915 ? 2.440 2.570 ? ? ? ? ? 1123 ? 100.000 ? ? ? ? 0.515 ? ? ? ? ? ? ? ? 13.800 ? 1.291 ? ? 0.535 0.143 0 4 1 0.953 ? 2.570 2.730 ? ? ? ? ? 1129 ? 100.000 ? ? ? ? 0.370 ? ? ? ? ? ? ? ? 13.800 ? 1.301 ? ? 0.384 0.103 0 5 1 0.972 ? 2.730 2.950 ? ? ? ? ? 1136 ? 100.000 ? ? ? ? 0.248 ? ? ? ? ? ? ? ? 13.800 ? 1.290 ? ? 0.258 0.069 0 6 1 0.988 ? 2.950 3.240 ? ? ? ? ? 1145 ? 100.000 ? ? ? ? 0.157 ? ? ? ? ? ? ? ? 13.700 ? 1.317 ? ? 0.163 0.044 0 7 1 0.995 ? 3.240 3.710 ? ? ? ? ? 1167 ? 100.000 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 13.600 ? 1.315 ? ? 0.086 0.023 0 8 1 0.999 ? 3.710 4.670 ? ? ? ? ? 1185 ? 100.000 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 13.300 ? 1.254 ? ? 0.070 0.019 0 9 1 0.998 ? 4.670 50.000 ? ? ? ? ? 1302 ? 99.900 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 12.100 ? 1.305 ? ? 0.050 0.014 0 10 1 0.999 ? # _refine.aniso_B[1][1] -0.87 _refine.aniso_B[1][2] -0.44 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -0.87 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 2.83 _refine.B_iso_max ? _refine.B_iso_mean 38.330 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.958 _refine.correlation_coeff_Fo_to_Fc_free 0.905 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5CGV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.17 _refine.ls_d_res_low 50.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10926 _refine.ls_number_reflns_R_free 549 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.78 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20242 _refine.ls_R_factor_R_free 0.28166 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19872 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4E5E _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.252 _refine.pdbx_overall_ESU_R_Free 0.234 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 18.445 _refine.overall_SU_ML 0.213 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1452 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.number_atoms_solvent 64 _refine_hist.number_atoms_total 1553 _refine_hist.d_res_high 2.17 _refine_hist.d_res_low 50.00 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.022 0.019 1518 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 1409 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.108 1.965 2042 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.207 3.000 3240 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.658 5.000 177 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.652 23.289 76 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.052 15.000 270 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.307 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.132 0.200 217 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1689 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 368 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.151 3.158 711 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.145 3.156 710 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.442 4.732 887 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.442 4.735 888 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.772 3.491 807 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.765 3.492 807 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.494 5.095 1156 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.668 25.675 1788 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 6.627 25.661 1778 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.169 _refine_ls_shell.d_res_low 2.226 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 38 _refine_ls_shell.number_reflns_R_work 755 _refine_ls_shell.percent_reflns_obs 98.39 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.383 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.348 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5CGV _struct.title '2009 H1N1 PA endonuclease in complex with L-742,001' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5CGV _struct_keywords.text 'Influenza Resistance Endonuclease Inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 1 ? PHE A 9 ? MET A 1 PHE A 9 1 ? 9 HELX_P HELX_P2 AA2 ASN A 10 ? GLU A 23 ? ASN A 10 GLU A 23 1 ? 14 HELX_P HELX_P3 AA3 GLU A 31 ? ASP A 50 ? GLU A 31 ASP A 50 1 ? 20 HELX_P HELX_P4 AA4 ASP A 64 ? GLY A 80 ? ASP A 83 GLY A 99 1 ? 17 HELX_P HELX_P5 AA5 GLU A 107 ? ILE A 119 ? GLU A 126 ILE A 138 1 ? 13 HELX_P HELX_P6 AA6 LYS A 139 ? ASP A 141 ? LYS A 158 ASP A 160 5 ? 3 HELX_P HELX_P7 AA7 ASP A 145 ? ARG A 166 ? ASP A 164 ARG A 185 1 ? 22 HELX_P HELX_P8 AA8 LEU A 168 ? GLN A 174 ? LEU A 187 GLN A 193 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 41 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 41 A MN 301 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc2 metalc ? ? A GLU 61 OE2 ? ? ? 1_555 C MN . MN ? ? A GLU 80 A MN 302 1_555 ? ? ? ? ? ? ? 2.314 ? ? metalc3 metalc ? ? A ASP 89 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 108 A MN 301 1_555 ? ? ? ? ? ? ? 2.251 ? ? metalc4 metalc ? ? A ASP 89 OD1 ? ? ? 1_555 C MN . MN ? ? A ASP 108 A MN 302 1_555 ? ? ? ? ? ? ? 2.082 ? ? metalc5 metalc ? ? A GLU 100 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 119 A MN 301 1_555 ? ? ? ? ? ? ? 2.345 ? ? metalc6 metalc ? ? A ILE 101 O ? ? ? 1_555 B MN . MN ? ? A ILE 120 A MN 301 1_555 ? ? ? ? ? ? ? 2.308 ? ? metalc7 metalc ? ? B MN . MN ? ? ? 1_555 D 0N8 . O26 ? ? A MN 301 A 0N8 303 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc8 metalc ? ? B MN . MN ? ? ? 1_555 D 0N8 . O28 ? ? A MN 301 A 0N8 303 1_555 ? ? ? ? ? ? ? 2.340 ? ? metalc9 metalc ? ? C MN . MN ? ? ? 1_555 D 0N8 . O27 ? ? A MN 302 A 0N8 303 1_555 ? ? ? ? ? ? ? 2.229 ? ? metalc10 metalc ? ? C MN . MN ? ? ? 1_555 D 0N8 . O28 ? ? A MN 302 A 0N8 303 1_555 ? ? ? ? ? ? ? 2.071 ? ? metalc11 metalc ? ? C MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 302 A HOH 401 1_555 ? ? ? ? ? ? ? 2.103 ? ? metalc12 metalc ? ? C MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 302 A HOH 428 1_555 ? ? ? ? ? ? ? 2.368 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 57 ? ILE A 59 ? PHE A 76 ILE A 78 AA1 2 LEU A 90 ? ASP A 92 ? LEU A 109 ASP A 111 AA1 3 ARG A 97 ? THR A 104 ? ARG A 116 THR A 123 AA1 4 HIS A 125 ? SER A 130 ? HIS A 144 SER A 149 AA1 5 GLU A 135 ? ALA A 137 ? GLU A 154 ALA A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 58 ? N GLU A 77 O TYR A 91 ? O TYR A 110 AA1 2 3 N LEU A 90 ? N LEU A 109 O ILE A 99 ? O ILE A 118 AA1 3 4 N GLU A 100 ? N GLU A 119 O HIS A 125 ? O HIS A 144 AA1 4 5 N ILE A 128 ? N ILE A 147 O MET A 136 ? O MET A 155 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 301 ? 6 'binding site for residue MN A 301' AC2 Software A MN 302 ? 6 'binding site for residue MN A 302' AC3 Software A 0N8 303 ? 16 'binding site for residue 0N8 A 303' AC4 Software A GOL 304 ? 8 'binding site for residue GOL A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 41 ? HIS A 41 . ? 1_555 ? 2 AC1 6 ASP A 89 ? ASP A 108 . ? 1_555 ? 3 AC1 6 GLU A 100 ? GLU A 119 . ? 1_555 ? 4 AC1 6 ILE A 101 ? ILE A 120 . ? 1_555 ? 5 AC1 6 MN C . ? MN A 302 . ? 1_555 ? 6 AC1 6 0N8 D . ? 0N8 A 303 . ? 1_555 ? 7 AC2 6 GLU A 61 ? GLU A 80 . ? 1_555 ? 8 AC2 6 ASP A 89 ? ASP A 108 . ? 1_555 ? 9 AC2 6 MN B . ? MN A 301 . ? 1_555 ? 10 AC2 6 0N8 D . ? 0N8 A 303 . ? 1_555 ? 11 AC2 6 HOH F . ? HOH A 401 . ? 1_555 ? 12 AC2 6 HOH F . ? HOH A 428 . ? 1_555 ? 13 AC3 16 TYR A 24 ? TYR A 24 . ? 1_555 ? 14 AC3 16 LYS A 34 ? LYS A 34 . ? 1_555 ? 15 AC3 16 ILE A 38 ? ILE A 38 . ? 1_555 ? 16 AC3 16 HIS A 41 ? HIS A 41 . ? 1_555 ? 17 AC3 16 GLU A 61 ? GLU A 80 . ? 1_555 ? 18 AC3 16 LEU A 87 ? LEU A 106 . ? 1_555 ? 19 AC3 16 ASP A 89 ? ASP A 108 . ? 1_555 ? 20 AC3 16 GLU A 100 ? GLU A 119 . ? 1_555 ? 21 AC3 16 ILE A 101 ? ILE A 120 . ? 1_555 ? 22 AC3 16 LYS A 115 ? LYS A 134 . ? 1_555 ? 23 AC3 16 LYS A 118 ? LYS A 137 . ? 1_555 ? 24 AC3 16 MN B . ? MN A 301 . ? 1_555 ? 25 AC3 16 MN C . ? MN A 302 . ? 1_555 ? 26 AC3 16 GOL E . ? GOL A 304 . ? 1_555 ? 27 AC3 16 HOH F . ? HOH A 402 . ? 1_555 ? 28 AC3 16 HOH F . ? HOH A 428 . ? 1_555 ? 29 AC4 8 ALA A 37 ? ALA A 37 . ? 1_555 ? 30 AC4 8 HIS A 41 ? HIS A 41 . ? 1_555 ? 31 AC4 8 VAL A 103 ? VAL A 122 . ? 1_555 ? 32 AC4 8 0N8 D . ? 0N8 A 303 . ? 1_555 ? 33 AC4 8 HOH F . ? HOH A 402 . ? 1_555 ? 34 AC4 8 HOH F . ? HOH A 420 . ? 1_555 ? 35 AC4 8 HOH F . ? HOH A 430 . ? 1_555 ? 36 AC4 8 HOH F . ? HOH A 438 . ? 1_555 ? # _atom_sites.entry_id 5CGV _atom_sites.fract_transf_matrix[1][1] 0.013532 _atom_sites.fract_transf_matrix[1][2] 0.007813 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015625 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007846 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LYS 54 73 73 LYS LYS A . n A 1 55 HIS 55 74 74 HIS HIS A . n A 1 56 ARG 56 75 75 ARG ARG A . n A 1 57 PHE 57 76 76 PHE PHE A . n A 1 58 GLU 58 77 77 GLU GLU A . n A 1 59 ILE 59 78 78 ILE ILE A . n A 1 60 ILE 60 79 79 ILE ILE A . n A 1 61 GLU 61 80 80 GLU GLU A . n A 1 62 GLY 62 81 81 GLY GLY A . n A 1 63 ARG 63 82 82 ARG ARG A . n A 1 64 ASP 64 83 83 ASP ASP A . n A 1 65 ARG 65 84 84 ARG ARG A . n A 1 66 ILE 66 85 85 ILE ILE A . n A 1 67 MET 67 86 86 MET MET A . n A 1 68 ALA 68 87 87 ALA ALA A . n A 1 69 TRP 69 88 88 TRP TRP A . n A 1 70 THR 70 89 89 THR THR A . n A 1 71 VAL 71 90 90 VAL VAL A . n A 1 72 VAL 72 91 91 VAL VAL A . n A 1 73 ASN 73 92 92 ASN ASN A . n A 1 74 SER 74 93 93 SER SER A . n A 1 75 ILE 75 94 94 ILE ILE A . n A 1 76 CYS 76 95 95 CYS CYS A . n A 1 77 ASN 77 96 96 ASN ASN A . n A 1 78 THR 78 97 97 THR THR A . n A 1 79 THR 79 98 98 THR THR A . n A 1 80 GLY 80 99 99 GLY GLY A . n A 1 81 VAL 81 100 100 VAL VAL A . n A 1 82 GLU 82 101 101 GLU GLU A . n A 1 83 LYS 83 102 102 LYS LYS A . n A 1 84 PRO 84 103 103 PRO PRO A . n A 1 85 LYS 85 104 104 LYS LYS A . n A 1 86 PHE 86 105 105 PHE PHE A . n A 1 87 LEU 87 106 106 LEU LEU A . n A 1 88 PRO 88 107 107 PRO PRO A . n A 1 89 ASP 89 108 108 ASP ASP A . n A 1 90 LEU 90 109 109 LEU LEU A . n A 1 91 TYR 91 110 110 TYR TYR A . n A 1 92 ASP 92 111 111 ASP ASP A . n A 1 93 TYR 93 112 112 TYR TYR A . n A 1 94 LYS 94 113 113 LYS LYS A . n A 1 95 GLU 95 114 114 GLU GLU A . n A 1 96 ASN 96 115 115 ASN ASN A . n A 1 97 ARG 97 116 116 ARG ARG A . n A 1 98 PHE 98 117 117 PHE PHE A . n A 1 99 ILE 99 118 118 ILE ILE A . n A 1 100 GLU 100 119 119 GLU GLU A . n A 1 101 ILE 101 120 120 ILE ILE A . n A 1 102 GLY 102 121 121 GLY GLY A . n A 1 103 VAL 103 122 122 VAL VAL A . n A 1 104 THR 104 123 123 THR THR A . n A 1 105 ARG 105 124 124 ARG ARG A . n A 1 106 ARG 106 125 125 ARG ARG A . n A 1 107 GLU 107 126 126 GLU GLU A . n A 1 108 VAL 108 127 127 VAL VAL A . n A 1 109 HIS 109 128 128 HIS HIS A . n A 1 110 ILE 110 129 129 ILE ILE A . n A 1 111 TYR 111 130 130 TYR TYR A . n A 1 112 TYR 112 131 131 TYR TYR A . n A 1 113 LEU 113 132 132 LEU LEU A . n A 1 114 GLU 114 133 133 GLU GLU A . n A 1 115 LYS 115 134 134 LYS LYS A . n A 1 116 ALA 116 135 135 ALA ALA A . n A 1 117 ASN 117 136 136 ASN ASN A . n A 1 118 LYS 118 137 137 LYS LYS A . n A 1 119 ILE 119 138 138 ILE ILE A . n A 1 120 LYS 120 139 139 LYS LYS A . n A 1 121 SER 121 140 140 SER SER A . n A 1 122 GLU 122 141 141 GLU GLU A . n A 1 123 LYS 123 142 142 LYS LYS A . n A 1 124 THR 124 143 143 THR THR A . n A 1 125 HIS 125 144 144 HIS HIS A . n A 1 126 ILE 126 145 145 ILE ILE A . n A 1 127 HIS 127 146 146 HIS HIS A . n A 1 128 ILE 128 147 147 ILE ILE A . n A 1 129 PHE 129 148 148 PHE PHE A . n A 1 130 SER 130 149 149 SER SER A . n A 1 131 PHE 131 150 150 PHE PHE A . n A 1 132 THR 132 151 151 THR THR A . n A 1 133 GLY 133 152 152 GLY GLY A . n A 1 134 GLU 134 153 153 GLU GLU A . n A 1 135 GLU 135 154 154 GLU GLU A . n A 1 136 MET 136 155 155 MET MET A . n A 1 137 ALA 137 156 156 ALA ALA A . n A 1 138 THR 138 157 157 THR THR A . n A 1 139 LYS 139 158 158 LYS LYS A . n A 1 140 ALA 140 159 159 ALA ALA A . n A 1 141 ASP 141 160 160 ASP ASP A . n A 1 142 TYR 142 161 161 TYR TYR A . n A 1 143 THR 143 162 162 THR THR A . n A 1 144 LEU 144 163 163 LEU LEU A . n A 1 145 ASP 145 164 164 ASP ASP A . n A 1 146 GLU 146 165 165 GLU GLU A . n A 1 147 GLU 147 166 166 GLU GLU A . n A 1 148 SER 148 167 167 SER SER A . n A 1 149 ARG 149 168 168 ARG ARG A . n A 1 150 ALA 150 169 169 ALA ALA A . n A 1 151 ARG 151 170 170 ARG ARG A . n A 1 152 ILE 152 171 171 ILE ILE A . n A 1 153 LYS 153 172 172 LYS LYS A . n A 1 154 THR 154 173 173 THR THR A . n A 1 155 ARG 155 174 174 ARG ARG A . n A 1 156 LEU 156 175 175 LEU LEU A . n A 1 157 PHE 157 176 176 PHE PHE A . n A 1 158 THR 158 177 177 THR THR A . n A 1 159 ILE 159 178 178 ILE ILE A . n A 1 160 ARG 160 179 179 ARG ARG A . n A 1 161 GLN 161 180 180 GLN GLN A . n A 1 162 GLU 162 181 181 GLU GLU A . n A 1 163 MET 163 182 182 MET MET A . n A 1 164 ALA 164 183 183 ALA ALA A . n A 1 165 SER 165 184 184 SER SER A . n A 1 166 ARG 166 185 185 ARG ARG A . n A 1 167 SER 167 186 186 SER SER A . n A 1 168 LEU 168 187 187 LEU LEU A . n A 1 169 TRP 169 188 188 TRP TRP A . n A 1 170 ASP 170 189 189 ASP ASP A . n A 1 171 SER 171 190 190 SER SER A . n A 1 172 PHE 172 191 191 PHE PHE A . n A 1 173 ARG 173 192 192 ARG ARG A . n A 1 174 GLN 174 193 193 GLN GLN A . n A 1 175 SER 175 194 194 SER SER A . n A 1 176 GLU 176 195 195 GLU GLU A . n A 1 177 ARG 177 196 196 ARG ARG A . n A 1 178 ALA 178 197 197 ALA ALA A . n A 1 179 ALA 179 198 ? ? ? A . n A 1 180 ALA 180 199 ? ? ? A . n A 1 181 GLU 181 200 ? ? ? A . n A 1 182 LEU 182 201 ? ? ? A . n A 1 183 ALA 183 202 ? ? ? A . n A 1 184 LEU 184 203 ? ? ? A . n A 1 185 VAL 185 204 ? ? ? A . n A 1 186 PRO 186 205 ? ? ? A . n A 1 187 ARG 187 206 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 301 201 MN MN A . C 2 MN 1 302 202 MN MN A . D 3 0N8 1 303 1 0N8 0N8 A . E 4 GOL 1 304 1 GOL GOL A . F 5 HOH 1 401 1 HOH HOH A . F 5 HOH 2 402 5 HOH HOH A . F 5 HOH 3 403 42 HOH HOH A . F 5 HOH 4 404 51 HOH HOH A . F 5 HOH 5 405 18 HOH HOH A . F 5 HOH 6 406 12 HOH HOH A . F 5 HOH 7 407 36 HOH HOH A . F 5 HOH 8 408 64 HOH HOH A . F 5 HOH 9 409 45 HOH HOH A . F 5 HOH 10 410 8 HOH HOH A . F 5 HOH 11 411 17 HOH HOH A . F 5 HOH 12 412 11 HOH HOH A . F 5 HOH 13 413 68 HOH HOH A . F 5 HOH 14 414 54 HOH HOH A . F 5 HOH 15 415 57 HOH HOH A . F 5 HOH 16 416 6 HOH HOH A . F 5 HOH 17 417 4 HOH HOH A . F 5 HOH 18 418 9 HOH HOH A . F 5 HOH 19 419 22 HOH HOH A . F 5 HOH 20 420 33 HOH HOH A . F 5 HOH 21 421 26 HOH HOH A . F 5 HOH 22 422 59 HOH HOH A . F 5 HOH 23 423 44 HOH HOH A . F 5 HOH 24 424 39 HOH HOH A . F 5 HOH 25 425 3 HOH HOH A . F 5 HOH 26 426 63 HOH HOH A . F 5 HOH 27 427 10 HOH HOH A . F 5 HOH 28 428 2 HOH HOH A . F 5 HOH 29 429 58 HOH HOH A . F 5 HOH 30 430 16 HOH HOH A . F 5 HOH 31 431 38 HOH HOH A . F 5 HOH 32 432 66 HOH HOH A . F 5 HOH 33 433 56 HOH HOH A . F 5 HOH 34 434 40 HOH HOH A . F 5 HOH 35 435 53 HOH HOH A . F 5 HOH 36 436 20 HOH HOH A . F 5 HOH 37 437 23 HOH HOH A . F 5 HOH 38 438 61 HOH HOH A . F 5 HOH 39 439 52 HOH HOH A . F 5 HOH 40 440 28 HOH HOH A . F 5 HOH 41 441 21 HOH HOH A . F 5 HOH 42 442 55 HOH HOH A . F 5 HOH 43 443 27 HOH HOH A . F 5 HOH 44 444 65 HOH HOH A . F 5 HOH 45 445 69 HOH HOH A . F 5 HOH 46 446 35 HOH HOH A . F 5 HOH 47 447 29 HOH HOH A . F 5 HOH 48 448 48 HOH HOH A . F 5 HOH 49 449 49 HOH HOH A . F 5 HOH 50 450 19 HOH HOH A . F 5 HOH 51 451 50 HOH HOH A . F 5 HOH 52 452 30 HOH HOH A . F 5 HOH 53 453 15 HOH HOH A . F 5 HOH 54 454 34 HOH HOH A . F 5 HOH 55 455 60 HOH HOH A . F 5 HOH 56 456 25 HOH HOH A . F 5 HOH 57 457 47 HOH HOH A . F 5 HOH 58 458 46 HOH HOH A . F 5 HOH 59 459 24 HOH HOH A . F 5 HOH 60 460 62 HOH HOH A . F 5 HOH 61 461 14 HOH HOH A . F 5 HOH 62 462 67 HOH HOH A . F 5 HOH 63 463 7 HOH HOH A . F 5 HOH 64 464 37 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 101.6 ? 2 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE2 ? A GLU 100 ? A GLU 119 ? 1_555 162.3 ? 3 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE2 ? A GLU 100 ? A GLU 119 ? 1_555 92.5 ? 4 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 101 ? A ILE 120 ? 1_555 84.1 ? 5 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 101 ? A ILE 120 ? 1_555 92.0 ? 6 OE2 ? A GLU 100 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 101 ? A ILE 120 ? 1_555 84.9 ? 7 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O26 ? D 0N8 . ? A 0N8 303 ? 1_555 82.2 ? 8 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O26 ? D 0N8 . ? A 0N8 303 ? 1_555 175.4 ? 9 OE2 ? A GLU 100 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O26 ? D 0N8 . ? A 0N8 303 ? 1_555 84.2 ? 10 O ? A ILE 101 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O26 ? D 0N8 . ? A 0N8 303 ? 1_555 90.9 ? 11 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O28 ? D 0N8 . ? A 0N8 303 ? 1_555 87.0 ? 12 OD2 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O28 ? D 0N8 . ? A 0N8 303 ? 1_555 99.9 ? 13 OE2 ? A GLU 100 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O28 ? D 0N8 . ? A 0N8 303 ? 1_555 101.1 ? 14 O ? A ILE 101 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O28 ? D 0N8 . ? A 0N8 303 ? 1_555 166.3 ? 15 O26 ? D 0N8 . ? A 0N8 303 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O28 ? D 0N8 . ? A 0N8 303 ? 1_555 77.6 ? 16 OE2 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 85.9 ? 17 OE2 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O27 ? D 0N8 . ? A 0N8 303 ? 1_555 80.5 ? 18 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O27 ? D 0N8 . ? A 0N8 303 ? 1_555 165.7 ? 19 OE2 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O28 ? D 0N8 . ? A 0N8 303 ? 1_555 83.7 ? 20 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O28 ? D 0N8 . ? A 0N8 303 ? 1_555 93.9 ? 21 O27 ? D 0N8 . ? A 0N8 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O28 ? D 0N8 . ? A 0N8 303 ? 1_555 80.3 ? 22 OE2 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 401 ? 1_555 173.1 ? 23 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 401 ? 1_555 100.2 ? 24 O27 ? D 0N8 . ? A 0N8 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 401 ? 1_555 93.7 ? 25 O28 ? D 0N8 . ? A 0N8 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 401 ? 1_555 99.0 ? 26 OE2 ? A GLU 61 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 428 ? 1_555 83.3 ? 27 OD1 ? A ASP 89 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 428 ? 1_555 98.4 ? 28 O27 ? D 0N8 . ? A 0N8 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 428 ? 1_555 84.4 ? 29 O28 ? D 0N8 . ? A 0N8 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 428 ? 1_555 161.4 ? 30 O ? F HOH . ? A HOH 401 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? F HOH . ? A HOH 428 ? 1_555 92.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-23 2 'Structure model' 1 1 2017-09-20 3 'Structure model' 1 2 2018-05-16 4 'Structure model' 1 3 2019-12-11 5 'Structure model' 1 4 2020-01-08 6 'Structure model' 1 5 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 4 'Structure model' 'Author supporting evidence' 7 5 'Structure model' 'Author supporting evidence' 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Database references' 10 6 'Structure model' 'Derived calculations' 11 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_audit_support 3 2 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' citation 5 3 'Structure model' citation_author 6 4 'Structure model' pdbx_audit_support 7 5 'Structure model' pdbx_audit_support 8 6 'Structure model' chem_comp_atom 9 6 'Structure model' chem_comp_bond 10 6 'Structure model' database_2 11 6 'Structure model' pdbx_initial_refinement_model 12 6 'Structure model' pdbx_struct_conn_angle 13 6 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_CSD' 2 2 'Structure model' '_pdbx_audit_support.funding_organization' 3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 3 'Structure model' '_citation.journal_abbrev' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation.pdbx_database_id_PubMed' 9 3 'Structure model' '_citation.title' 10 3 'Structure model' '_citation_author.name' 11 4 'Structure model' '_pdbx_audit_support.funding_organization' 12 5 'Structure model' '_pdbx_audit_support.funding_organization' 13 6 'Structure model' '_database_2.pdbx_DOI' 14 6 'Structure model' '_database_2.pdbx_database_accession' 15 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 16 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 17 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 18 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 19 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 20 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 21 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 22 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 23 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 24 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 25 6 'Structure model' '_pdbx_struct_conn_angle.value' 26 6 'Structure model' '_struct_conn.pdbx_dist_value' 27 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 28 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -22.9738 _pdbx_refine_tls.origin_y -11.5856 _pdbx_refine_tls.origin_z 14.1704 _pdbx_refine_tls.T[1][1] 0.0557 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0027 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0169 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0169 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0042 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0305 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.2159 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.2168 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.2701 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.7798 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.2993 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.1345 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0341 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0075 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0570 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0235 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0687 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0002 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0947 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0011 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.1028 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? A 197 ? ? 2 'X-RAY DIFFRACTION' 1 ? ? A 303 ? ? A 303 ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0123 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 N _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 MET _pdbx_validate_rmsd_bond.auth_seq_id_1 1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CA _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 MET _pdbx_validate_rmsd_bond.auth_seq_id_2 1 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.590 _pdbx_validate_rmsd_bond.bond_target_value 1.459 _pdbx_validate_rmsd_bond.bond_deviation 0.131 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.020 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 82 ? ? CZ A ARG 82 ? ? NH2 A ARG 82 ? ? 117.18 120.30 -3.12 0.50 N 2 1 CB A ASP 83 ? ? CG A ASP 83 ? ? OD1 A ASP 83 ? ? 125.10 118.30 6.80 0.90 N 3 1 CB A ASP 160 ? ? CG A ASP 160 ? ? OD1 A ASP 160 ? ? 125.10 118.30 6.80 0.90 N 4 1 NE A ARG 179 ? ? CZ A ARG 179 ? ? NH1 A ARG 179 ? ? 124.35 120.30 4.05 0.50 N 5 1 NE A ARG 179 ? ? CZ A ARG 179 ? ? NH2 A ARG 179 ? ? 115.98 120.30 -4.32 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 125 ? ? -101.23 -132.38 2 1 THR A 162 ? ? 69.51 -61.72 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLY _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 52 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 SER _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 53 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 147.49 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 73 ? CG ? A LYS 54 CG 2 1 Y 1 A LYS 73 ? CD ? A LYS 54 CD 3 1 Y 1 A LYS 73 ? CE ? A LYS 54 CE 4 1 Y 1 A LYS 73 ? NZ ? A LYS 54 NZ 5 1 Y 1 A LYS 104 ? CG ? A LYS 85 CG 6 1 Y 1 A LYS 104 ? CD ? A LYS 85 CD 7 1 Y 1 A LYS 104 ? CE ? A LYS 85 CE 8 1 Y 1 A LYS 104 ? NZ ? A LYS 85 NZ 9 1 Y 1 A GLU 141 ? CG ? A GLU 122 CG 10 1 Y 1 A GLU 141 ? CD ? A GLU 122 CD 11 1 Y 1 A GLU 141 ? OE1 ? A GLU 122 OE1 12 1 Y 1 A GLU 141 ? OE2 ? A GLU 122 OE2 13 1 Y 1 A LYS 142 ? CG ? A LYS 123 CG 14 1 Y 1 A LYS 142 ? CD ? A LYS 123 CD 15 1 Y 1 A LYS 142 ? CE ? A LYS 123 CE 16 1 Y 1 A LYS 142 ? NZ ? A LYS 123 NZ 17 1 Y 1 A ARG 170 ? CG ? A ARG 151 CG 18 1 Y 1 A ARG 170 ? CD ? A ARG 151 CD 19 1 Y 1 A ARG 170 ? NE ? A ARG 151 NE 20 1 Y 1 A ARG 170 ? CZ ? A ARG 151 CZ 21 1 Y 1 A ARG 170 ? NH1 ? A ARG 151 NH1 22 1 Y 1 A ARG 170 ? NH2 ? A ARG 151 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 198 ? A ALA 179 2 1 Y 1 A ALA 199 ? A ALA 180 3 1 Y 1 A GLU 200 ? A GLU 181 4 1 Y 1 A LEU 201 ? A LEU 182 5 1 Y 1 A ALA 202 ? A ALA 183 6 1 Y 1 A LEU 203 ? A LEU 184 7 1 Y 1 A VAL 204 ? A VAL 185 8 1 Y 1 A PRO 205 ? A PRO 186 9 1 Y 1 A ARG 206 ? A ARG 187 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 0N8 CL2 CL N N 1 0N8 C19 C Y N 2 0N8 C18 C Y N 3 0N8 C17 C Y N 4 0N8 C20 C Y N 5 0N8 C21 C Y N 6 0N8 C16 C Y N 7 0N8 C15 C N N 8 0N8 C11 C N N 9 0N8 C10 C N N 10 0N8 C9 C N N 11 0N8 C14 C N N 12 0N8 O27 O N N 13 0N8 C22 C N N 14 0N8 C23 C N N 15 0N8 O28 O N N 16 0N8 C24 C N N 17 0N8 O26 O N N 18 0N8 O25 O N N 19 0N8 C12 C N N 20 0N8 C13 C N N 21 0N8 N8 N N N 22 0N8 C7 C N N 23 0N8 C2 C Y N 24 0N8 C3 C Y N 25 0N8 C4 C Y N 26 0N8 C5 C Y N 27 0N8 C6 C Y N 28 0N8 C1 C Y N 29 0N8 H1 H N N 30 0N8 H2 H N N 31 0N8 H3 H N N 32 0N8 H4 H N N 33 0N8 H5 H N N 34 0N8 H6 H N N 35 0N8 H7 H N N 36 0N8 H8 H N N 37 0N8 H9 H N N 38 0N8 H10 H N N 39 0N8 H11 H N N 40 0N8 H14 H N N 41 0N8 H15 H N N 42 0N8 H16 H N N 43 0N8 H17 H N N 44 0N8 H18 H N N 45 0N8 H19 H N N 46 0N8 H21 H N N 47 0N8 H22 H N N 48 0N8 H23 H N N 49 0N8 H24 H N N 50 0N8 H25 H N N 51 0N8 H26 H N N 52 0N8 H27 H N N 53 ALA N N N N 54 ALA CA C N S 55 ALA C C N N 56 ALA O O N N 57 ALA CB C N N 58 ALA OXT O N N 59 ALA H H N N 60 ALA H2 H N N 61 ALA HA H N N 62 ALA HB1 H N N 63 ALA HB2 H N N 64 ALA HB3 H N N 65 ALA HXT H N N 66 ARG N N N N 67 ARG CA C N S 68 ARG C C N N 69 ARG O O N N 70 ARG CB C N N 71 ARG CG C N N 72 ARG CD C N N 73 ARG NE N N N 74 ARG CZ C N N 75 ARG NH1 N N N 76 ARG NH2 N N N 77 ARG OXT O N N 78 ARG H H N N 79 ARG H2 H N N 80 ARG HA H N N 81 ARG HB2 H N N 82 ARG HB3 H N N 83 ARG HG2 H N N 84 ARG HG3 H N N 85 ARG HD2 H N N 86 ARG HD3 H N N 87 ARG HE H N N 88 ARG HH11 H N N 89 ARG HH12 H N N 90 ARG HH21 H N N 91 ARG HH22 H N N 92 ARG HXT H N N 93 ASN N N N N 94 ASN CA C N S 95 ASN C C N N 96 ASN O O N N 97 ASN CB C N N 98 ASN CG C N N 99 ASN OD1 O N N 100 ASN ND2 N N N 101 ASN OXT O N N 102 ASN H H N N 103 ASN H2 H N N 104 ASN HA H N N 105 ASN HB2 H N N 106 ASN HB3 H N N 107 ASN HD21 H N N 108 ASN HD22 H N N 109 ASN HXT H N N 110 ASP N N N N 111 ASP CA C N S 112 ASP C C N N 113 ASP O O N N 114 ASP CB C N N 115 ASP CG C N N 116 ASP OD1 O N N 117 ASP OD2 O N N 118 ASP OXT O N N 119 ASP H H N N 120 ASP H2 H N N 121 ASP HA H N N 122 ASP HB2 H N N 123 ASP HB3 H N N 124 ASP HD2 H N N 125 ASP HXT H N N 126 CYS N N N N 127 CYS CA C N R 128 CYS C C N N 129 CYS O O N N 130 CYS CB C N N 131 CYS SG S N N 132 CYS OXT O N N 133 CYS H H N N 134 CYS H2 H N N 135 CYS HA H N N 136 CYS HB2 H N N 137 CYS HB3 H N N 138 CYS HG H N N 139 CYS HXT H N N 140 GLN N N N N 141 GLN CA C N S 142 GLN C C N N 143 GLN O O N N 144 GLN CB C N N 145 GLN CG C N N 146 GLN CD C N N 147 GLN OE1 O N N 148 GLN NE2 N N N 149 GLN OXT O N N 150 GLN H H N N 151 GLN H2 H N N 152 GLN HA H N N 153 GLN HB2 H N N 154 GLN HB3 H N N 155 GLN HG2 H N N 156 GLN HG3 H N N 157 GLN HE21 H N N 158 GLN HE22 H N N 159 GLN HXT H N N 160 GLU N N N N 161 GLU CA C N S 162 GLU C C N N 163 GLU O O N N 164 GLU CB C N N 165 GLU CG C N N 166 GLU CD C N N 167 GLU OE1 O N N 168 GLU OE2 O N N 169 GLU OXT O N N 170 GLU H H N N 171 GLU H2 H N N 172 GLU HA H N N 173 GLU HB2 H N N 174 GLU HB3 H N N 175 GLU HG2 H N N 176 GLU HG3 H N N 177 GLU HE2 H N N 178 GLU HXT H N N 179 GLY N N N N 180 GLY CA C N N 181 GLY C C N N 182 GLY O O N N 183 GLY OXT O N N 184 GLY H H N N 185 GLY H2 H N N 186 GLY HA2 H N N 187 GLY HA3 H N N 188 GLY HXT H N N 189 GOL C1 C N N 190 GOL O1 O N N 191 GOL C2 C N N 192 GOL O2 O N N 193 GOL C3 C N N 194 GOL O3 O N N 195 GOL H11 H N N 196 GOL H12 H N N 197 GOL HO1 H N N 198 GOL H2 H N N 199 GOL HO2 H N N 200 GOL H31 H N N 201 GOL H32 H N N 202 GOL HO3 H N N 203 HIS N N N N 204 HIS CA C N S 205 HIS C C N N 206 HIS O O N N 207 HIS CB C N N 208 HIS CG C Y N 209 HIS ND1 N Y N 210 HIS CD2 C Y N 211 HIS CE1 C Y N 212 HIS NE2 N Y N 213 HIS OXT O N N 214 HIS H H N N 215 HIS H2 H N N 216 HIS HA H N N 217 HIS HB2 H N N 218 HIS HB3 H N N 219 HIS HD1 H N N 220 HIS HD2 H N N 221 HIS HE1 H N N 222 HIS HE2 H N N 223 HIS HXT H N N 224 HOH O O N N 225 HOH H1 H N N 226 HOH H2 H N N 227 ILE N N N N 228 ILE CA C N S 229 ILE C C N N 230 ILE O O N N 231 ILE CB C N S 232 ILE CG1 C N N 233 ILE CG2 C N N 234 ILE CD1 C N N 235 ILE OXT O N N 236 ILE H H N N 237 ILE H2 H N N 238 ILE HA H N N 239 ILE HB H N N 240 ILE HG12 H N N 241 ILE HG13 H N N 242 ILE HG21 H N N 243 ILE HG22 H N N 244 ILE HG23 H N N 245 ILE HD11 H N N 246 ILE HD12 H N N 247 ILE HD13 H N N 248 ILE HXT H N N 249 LEU N N N N 250 LEU CA C N S 251 LEU C C N N 252 LEU O O N N 253 LEU CB C N N 254 LEU CG C N N 255 LEU CD1 C N N 256 LEU CD2 C N N 257 LEU OXT O N N 258 LEU H H N N 259 LEU H2 H N N 260 LEU HA H N N 261 LEU HB2 H N N 262 LEU HB3 H N N 263 LEU HG H N N 264 LEU HD11 H N N 265 LEU HD12 H N N 266 LEU HD13 H N N 267 LEU HD21 H N N 268 LEU HD22 H N N 269 LEU HD23 H N N 270 LEU HXT H N N 271 LYS N N N N 272 LYS CA C N S 273 LYS C C N N 274 LYS O O N N 275 LYS CB C N N 276 LYS CG C N N 277 LYS CD C N N 278 LYS CE C N N 279 LYS NZ N N N 280 LYS OXT O N N 281 LYS H H N N 282 LYS H2 H N N 283 LYS HA H N N 284 LYS HB2 H N N 285 LYS HB3 H N N 286 LYS HG2 H N N 287 LYS HG3 H N N 288 LYS HD2 H N N 289 LYS HD3 H N N 290 LYS HE2 H N N 291 LYS HE3 H N N 292 LYS HZ1 H N N 293 LYS HZ2 H N N 294 LYS HZ3 H N N 295 LYS HXT H N N 296 MET N N N N 297 MET CA C N S 298 MET C C N N 299 MET O O N N 300 MET CB C N N 301 MET CG C N N 302 MET SD S N N 303 MET CE C N N 304 MET OXT O N N 305 MET H H N N 306 MET H2 H N N 307 MET HA H N N 308 MET HB2 H N N 309 MET HB3 H N N 310 MET HG2 H N N 311 MET HG3 H N N 312 MET HE1 H N N 313 MET HE2 H N N 314 MET HE3 H N N 315 MET HXT H N N 316 MN MN MN N N 317 PHE N N N N 318 PHE CA C N S 319 PHE C C N N 320 PHE O O N N 321 PHE CB C N N 322 PHE CG C Y N 323 PHE CD1 C Y N 324 PHE CD2 C Y N 325 PHE CE1 C Y N 326 PHE CE2 C Y N 327 PHE CZ C Y N 328 PHE OXT O N N 329 PHE H H N N 330 PHE H2 H N N 331 PHE HA H N N 332 PHE HB2 H N N 333 PHE HB3 H N N 334 PHE HD1 H N N 335 PHE HD2 H N N 336 PHE HE1 H N N 337 PHE HE2 H N N 338 PHE HZ H N N 339 PHE HXT H N N 340 PRO N N N N 341 PRO CA C N S 342 PRO C C N N 343 PRO O O N N 344 PRO CB C N N 345 PRO CG C N N 346 PRO CD C N N 347 PRO OXT O N N 348 PRO H H N N 349 PRO HA H N N 350 PRO HB2 H N N 351 PRO HB3 H N N 352 PRO HG2 H N N 353 PRO HG3 H N N 354 PRO HD2 H N N 355 PRO HD3 H N N 356 PRO HXT H N N 357 SER N N N N 358 SER CA C N S 359 SER C C N N 360 SER O O N N 361 SER CB C N N 362 SER OG O N N 363 SER OXT O N N 364 SER H H N N 365 SER H2 H N N 366 SER HA H N N 367 SER HB2 H N N 368 SER HB3 H N N 369 SER HG H N N 370 SER HXT H N N 371 THR N N N N 372 THR CA C N S 373 THR C C N N 374 THR O O N N 375 THR CB C N R 376 THR OG1 O N N 377 THR CG2 C N N 378 THR OXT O N N 379 THR H H N N 380 THR H2 H N N 381 THR HA H N N 382 THR HB H N N 383 THR HG1 H N N 384 THR HG21 H N N 385 THR HG22 H N N 386 THR HG23 H N N 387 THR HXT H N N 388 TRP N N N N 389 TRP CA C N S 390 TRP C C N N 391 TRP O O N N 392 TRP CB C N N 393 TRP CG C Y N 394 TRP CD1 C Y N 395 TRP CD2 C Y N 396 TRP NE1 N Y N 397 TRP CE2 C Y N 398 TRP CE3 C Y N 399 TRP CZ2 C Y N 400 TRP CZ3 C Y N 401 TRP CH2 C Y N 402 TRP OXT O N N 403 TRP H H N N 404 TRP H2 H N N 405 TRP HA H N N 406 TRP HB2 H N N 407 TRP HB3 H N N 408 TRP HD1 H N N 409 TRP HE1 H N N 410 TRP HE3 H N N 411 TRP HZ2 H N N 412 TRP HZ3 H N N 413 TRP HH2 H N N 414 TRP HXT H N N 415 TYR N N N N 416 TYR CA C N S 417 TYR C C N N 418 TYR O O N N 419 TYR CB C N N 420 TYR CG C Y N 421 TYR CD1 C Y N 422 TYR CD2 C Y N 423 TYR CE1 C Y N 424 TYR CE2 C Y N 425 TYR CZ C Y N 426 TYR OH O N N 427 TYR OXT O N N 428 TYR H H N N 429 TYR H2 H N N 430 TYR HA H N N 431 TYR HB2 H N N 432 TYR HB3 H N N 433 TYR HD1 H N N 434 TYR HD2 H N N 435 TYR HE1 H N N 436 TYR HE2 H N N 437 TYR HH H N N 438 TYR HXT H N N 439 VAL N N N N 440 VAL CA C N S 441 VAL C C N N 442 VAL O O N N 443 VAL CB C N N 444 VAL CG1 C N N 445 VAL CG2 C N N 446 VAL OXT O N N 447 VAL H H N N 448 VAL H2 H N N 449 VAL HA H N N 450 VAL HB H N N 451 VAL HG11 H N N 452 VAL HG12 H N N 453 VAL HG13 H N N 454 VAL HG21 H N N 455 VAL HG22 H N N 456 VAL HG23 H N N 457 VAL HXT H N N 458 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 0N8 C6 C1 doub Y N 1 0N8 C6 C5 sing Y N 2 0N8 C1 C2 sing Y N 3 0N8 O27 C14 doub N N 4 0N8 C12 C13 sing N N 5 0N8 C12 C11 sing N N 6 0N8 C5 C4 doub Y N 7 0N8 C13 N8 sing N N 8 0N8 C2 C7 sing N N 9 0N8 C2 C3 doub Y N 10 0N8 O28 C23 sing N N 11 0N8 C7 N8 sing N N 12 0N8 C15 C11 sing N N 13 0N8 C15 C16 sing N N 14 0N8 C14 C11 sing N N 15 0N8 C14 C22 sing N N 16 0N8 C11 C10 sing N N 17 0N8 N8 C9 sing N N 18 0N8 C4 C3 sing Y N 19 0N8 C16 C21 doub Y N 20 0N8 C16 C17 sing Y N 21 0N8 C23 C22 doub N Z 22 0N8 C23 C24 sing N N 23 0N8 C21 C20 sing Y N 24 0N8 C17 C18 doub Y N 25 0N8 O25 C24 doub N N 26 0N8 C10 C9 sing N N 27 0N8 C24 O26 sing N N 28 0N8 C20 C19 doub Y N 29 0N8 C18 C19 sing Y N 30 0N8 C19 CL2 sing N N 31 0N8 C18 H1 sing N N 32 0N8 C17 H2 sing N N 33 0N8 C20 H3 sing N N 34 0N8 C21 H4 sing N N 35 0N8 C15 H5 sing N N 36 0N8 C15 H6 sing N N 37 0N8 C10 H7 sing N N 38 0N8 C10 H8 sing N N 39 0N8 C9 H9 sing N N 40 0N8 C9 H10 sing N N 41 0N8 C22 H11 sing N N 42 0N8 O28 H14 sing N N 43 0N8 O26 H15 sing N N 44 0N8 C12 H16 sing N N 45 0N8 C12 H17 sing N N 46 0N8 C13 H18 sing N N 47 0N8 C13 H19 sing N N 48 0N8 C7 H21 sing N N 49 0N8 C7 H22 sing N N 50 0N8 C3 H23 sing N N 51 0N8 C4 H24 sing N N 52 0N8 C5 H25 sing N N 53 0N8 C6 H26 sing N N 54 0N8 C1 H27 sing N N 55 ALA N CA sing N N 56 ALA N H sing N N 57 ALA N H2 sing N N 58 ALA CA C sing N N 59 ALA CA CB sing N N 60 ALA CA HA sing N N 61 ALA C O doub N N 62 ALA C OXT sing N N 63 ALA CB HB1 sing N N 64 ALA CB HB2 sing N N 65 ALA CB HB3 sing N N 66 ALA OXT HXT sing N N 67 ARG N CA sing N N 68 ARG N H sing N N 69 ARG N H2 sing N N 70 ARG CA C sing N N 71 ARG CA CB sing N N 72 ARG CA HA sing N N 73 ARG C O doub N N 74 ARG C OXT sing N N 75 ARG CB CG sing N N 76 ARG CB HB2 sing N N 77 ARG CB HB3 sing N N 78 ARG CG CD sing N N 79 ARG CG HG2 sing N N 80 ARG CG HG3 sing N N 81 ARG CD NE sing N N 82 ARG CD HD2 sing N N 83 ARG CD HD3 sing N N 84 ARG NE CZ sing N N 85 ARG NE HE sing N N 86 ARG CZ NH1 sing N N 87 ARG CZ NH2 doub N N 88 ARG NH1 HH11 sing N N 89 ARG NH1 HH12 sing N N 90 ARG NH2 HH21 sing N N 91 ARG NH2 HH22 sing N N 92 ARG OXT HXT sing N N 93 ASN N CA sing N N 94 ASN N H sing N N 95 ASN N H2 sing N N 96 ASN CA C sing N N 97 ASN CA CB sing N N 98 ASN CA HA sing N N 99 ASN C O doub N N 100 ASN C OXT sing N N 101 ASN CB CG sing N N 102 ASN CB HB2 sing N N 103 ASN CB HB3 sing N N 104 ASN CG OD1 doub N N 105 ASN CG ND2 sing N N 106 ASN ND2 HD21 sing N N 107 ASN ND2 HD22 sing N N 108 ASN OXT HXT sing N N 109 ASP N CA sing N N 110 ASP N H sing N N 111 ASP N H2 sing N N 112 ASP CA C sing N N 113 ASP CA CB sing N N 114 ASP CA HA sing N N 115 ASP C O doub N N 116 ASP C OXT sing N N 117 ASP CB CG sing N N 118 ASP CB HB2 sing N N 119 ASP CB HB3 sing N N 120 ASP CG OD1 doub N N 121 ASP CG OD2 sing N N 122 ASP OD2 HD2 sing N N 123 ASP OXT HXT sing N N 124 CYS N CA sing N N 125 CYS N H sing N N 126 CYS N H2 sing N N 127 CYS CA C sing N N 128 CYS CA CB sing N N 129 CYS CA HA sing N N 130 CYS C O doub N N 131 CYS C OXT sing N N 132 CYS CB SG sing N N 133 CYS CB HB2 sing N N 134 CYS CB HB3 sing N N 135 CYS SG HG sing N N 136 CYS OXT HXT sing N N 137 GLN N CA sing N N 138 GLN N H sing N N 139 GLN N H2 sing N N 140 GLN CA C sing N N 141 GLN CA CB sing N N 142 GLN CA HA sing N N 143 GLN C O doub N N 144 GLN C OXT sing N N 145 GLN CB CG sing N N 146 GLN CB HB2 sing N N 147 GLN CB HB3 sing N N 148 GLN CG CD sing N N 149 GLN CG HG2 sing N N 150 GLN CG HG3 sing N N 151 GLN CD OE1 doub N N 152 GLN CD NE2 sing N N 153 GLN NE2 HE21 sing N N 154 GLN NE2 HE22 sing N N 155 GLN OXT HXT sing N N 156 GLU N CA sing N N 157 GLU N H sing N N 158 GLU N H2 sing N N 159 GLU CA C sing N N 160 GLU CA CB sing N N 161 GLU CA HA sing N N 162 GLU C O doub N N 163 GLU C OXT sing N N 164 GLU CB CG sing N N 165 GLU CB HB2 sing N N 166 GLU CB HB3 sing N N 167 GLU CG CD sing N N 168 GLU CG HG2 sing N N 169 GLU CG HG3 sing N N 170 GLU CD OE1 doub N N 171 GLU CD OE2 sing N N 172 GLU OE2 HE2 sing N N 173 GLU OXT HXT sing N N 174 GLY N CA sing N N 175 GLY N H sing N N 176 GLY N H2 sing N N 177 GLY CA C sing N N 178 GLY CA HA2 sing N N 179 GLY CA HA3 sing N N 180 GLY C O doub N N 181 GLY C OXT sing N N 182 GLY OXT HXT sing N N 183 GOL C1 O1 sing N N 184 GOL C1 C2 sing N N 185 GOL C1 H11 sing N N 186 GOL C1 H12 sing N N 187 GOL O1 HO1 sing N N 188 GOL C2 O2 sing N N 189 GOL C2 C3 sing N N 190 GOL C2 H2 sing N N 191 GOL O2 HO2 sing N N 192 GOL C3 O3 sing N N 193 GOL C3 H31 sing N N 194 GOL C3 H32 sing N N 195 GOL O3 HO3 sing N N 196 HIS N CA sing N N 197 HIS N H sing N N 198 HIS N H2 sing N N 199 HIS CA C sing N N 200 HIS CA CB sing N N 201 HIS CA HA sing N N 202 HIS C O doub N N 203 HIS C OXT sing N N 204 HIS CB CG sing N N 205 HIS CB HB2 sing N N 206 HIS CB HB3 sing N N 207 HIS CG ND1 sing Y N 208 HIS CG CD2 doub Y N 209 HIS ND1 CE1 doub Y N 210 HIS ND1 HD1 sing N N 211 HIS CD2 NE2 sing Y N 212 HIS CD2 HD2 sing N N 213 HIS CE1 NE2 sing Y N 214 HIS CE1 HE1 sing N N 215 HIS NE2 HE2 sing N N 216 HIS OXT HXT sing N N 217 HOH O H1 sing N N 218 HOH O H2 sing N N 219 ILE N CA sing N N 220 ILE N H sing N N 221 ILE N H2 sing N N 222 ILE CA C sing N N 223 ILE CA CB sing N N 224 ILE CA HA sing N N 225 ILE C O doub N N 226 ILE C OXT sing N N 227 ILE CB CG1 sing N N 228 ILE CB CG2 sing N N 229 ILE CB HB sing N N 230 ILE CG1 CD1 sing N N 231 ILE CG1 HG12 sing N N 232 ILE CG1 HG13 sing N N 233 ILE CG2 HG21 sing N N 234 ILE CG2 HG22 sing N N 235 ILE CG2 HG23 sing N N 236 ILE CD1 HD11 sing N N 237 ILE CD1 HD12 sing N N 238 ILE CD1 HD13 sing N N 239 ILE OXT HXT sing N N 240 LEU N CA sing N N 241 LEU N H sing N N 242 LEU N H2 sing N N 243 LEU CA C sing N N 244 LEU CA CB sing N N 245 LEU CA HA sing N N 246 LEU C O doub N N 247 LEU C OXT sing N N 248 LEU CB CG sing N N 249 LEU CB HB2 sing N N 250 LEU CB HB3 sing N N 251 LEU CG CD1 sing N N 252 LEU CG CD2 sing N N 253 LEU CG HG sing N N 254 LEU CD1 HD11 sing N N 255 LEU CD1 HD12 sing N N 256 LEU CD1 HD13 sing N N 257 LEU CD2 HD21 sing N N 258 LEU CD2 HD22 sing N N 259 LEU CD2 HD23 sing N N 260 LEU OXT HXT sing N N 261 LYS N CA sing N N 262 LYS N H sing N N 263 LYS N H2 sing N N 264 LYS CA C sing N N 265 LYS CA CB sing N N 266 LYS CA HA sing N N 267 LYS C O doub N N 268 LYS C OXT sing N N 269 LYS CB CG sing N N 270 LYS CB HB2 sing N N 271 LYS CB HB3 sing N N 272 LYS CG CD sing N N 273 LYS CG HG2 sing N N 274 LYS CG HG3 sing N N 275 LYS CD CE sing N N 276 LYS CD HD2 sing N N 277 LYS CD HD3 sing N N 278 LYS CE NZ sing N N 279 LYS CE HE2 sing N N 280 LYS CE HE3 sing N N 281 LYS NZ HZ1 sing N N 282 LYS NZ HZ2 sing N N 283 LYS NZ HZ3 sing N N 284 LYS OXT HXT sing N N 285 MET N CA sing N N 286 MET N H sing N N 287 MET N H2 sing N N 288 MET CA C sing N N 289 MET CA CB sing N N 290 MET CA HA sing N N 291 MET C O doub N N 292 MET C OXT sing N N 293 MET CB CG sing N N 294 MET CB HB2 sing N N 295 MET CB HB3 sing N N 296 MET CG SD sing N N 297 MET CG HG2 sing N N 298 MET CG HG3 sing N N 299 MET SD CE sing N N 300 MET CE HE1 sing N N 301 MET CE HE2 sing N N 302 MET CE HE3 sing N N 303 MET OXT HXT sing N N 304 PHE N CA sing N N 305 PHE N H sing N N 306 PHE N H2 sing N N 307 PHE CA C sing N N 308 PHE CA CB sing N N 309 PHE CA HA sing N N 310 PHE C O doub N N 311 PHE C OXT sing N N 312 PHE CB CG sing N N 313 PHE CB HB2 sing N N 314 PHE CB HB3 sing N N 315 PHE CG CD1 doub Y N 316 PHE CG CD2 sing Y N 317 PHE CD1 CE1 sing Y N 318 PHE CD1 HD1 sing N N 319 PHE CD2 CE2 doub Y N 320 PHE CD2 HD2 sing N N 321 PHE CE1 CZ doub Y N 322 PHE CE1 HE1 sing N N 323 PHE CE2 CZ sing Y N 324 PHE CE2 HE2 sing N N 325 PHE CZ HZ sing N N 326 PHE OXT HXT sing N N 327 PRO N CA sing N N 328 PRO N CD sing N N 329 PRO N H sing N N 330 PRO CA C sing N N 331 PRO CA CB sing N N 332 PRO CA HA sing N N 333 PRO C O doub N N 334 PRO C OXT sing N N 335 PRO CB CG sing N N 336 PRO CB HB2 sing N N 337 PRO CB HB3 sing N N 338 PRO CG CD sing N N 339 PRO CG HG2 sing N N 340 PRO CG HG3 sing N N 341 PRO CD HD2 sing N N 342 PRO CD HD3 sing N N 343 PRO OXT HXT sing N N 344 SER N CA sing N N 345 SER N H sing N N 346 SER N H2 sing N N 347 SER CA C sing N N 348 SER CA CB sing N N 349 SER CA HA sing N N 350 SER C O doub N N 351 SER C OXT sing N N 352 SER CB OG sing N N 353 SER CB HB2 sing N N 354 SER CB HB3 sing N N 355 SER OG HG sing N N 356 SER OXT HXT sing N N 357 THR N CA sing N N 358 THR N H sing N N 359 THR N H2 sing N N 360 THR CA C sing N N 361 THR CA CB sing N N 362 THR CA HA sing N N 363 THR C O doub N N 364 THR C OXT sing N N 365 THR CB OG1 sing N N 366 THR CB CG2 sing N N 367 THR CB HB sing N N 368 THR OG1 HG1 sing N N 369 THR CG2 HG21 sing N N 370 THR CG2 HG22 sing N N 371 THR CG2 HG23 sing N N 372 THR OXT HXT sing N N 373 TRP N CA sing N N 374 TRP N H sing N N 375 TRP N H2 sing N N 376 TRP CA C sing N N 377 TRP CA CB sing N N 378 TRP CA HA sing N N 379 TRP C O doub N N 380 TRP C OXT sing N N 381 TRP CB CG sing N N 382 TRP CB HB2 sing N N 383 TRP CB HB3 sing N N 384 TRP CG CD1 doub Y N 385 TRP CG CD2 sing Y N 386 TRP CD1 NE1 sing Y N 387 TRP CD1 HD1 sing N N 388 TRP CD2 CE2 doub Y N 389 TRP CD2 CE3 sing Y N 390 TRP NE1 CE2 sing Y N 391 TRP NE1 HE1 sing N N 392 TRP CE2 CZ2 sing Y N 393 TRP CE3 CZ3 doub Y N 394 TRP CE3 HE3 sing N N 395 TRP CZ2 CH2 doub Y N 396 TRP CZ2 HZ2 sing N N 397 TRP CZ3 CH2 sing Y N 398 TRP CZ3 HZ3 sing N N 399 TRP CH2 HH2 sing N N 400 TRP OXT HXT sing N N 401 TYR N CA sing N N 402 TYR N H sing N N 403 TYR N H2 sing N N 404 TYR CA C sing N N 405 TYR CA CB sing N N 406 TYR CA HA sing N N 407 TYR C O doub N N 408 TYR C OXT sing N N 409 TYR CB CG sing N N 410 TYR CB HB2 sing N N 411 TYR CB HB3 sing N N 412 TYR CG CD1 doub Y N 413 TYR CG CD2 sing Y N 414 TYR CD1 CE1 sing Y N 415 TYR CD1 HD1 sing N N 416 TYR CD2 CE2 doub Y N 417 TYR CD2 HD2 sing N N 418 TYR CE1 CZ doub Y N 419 TYR CE1 HE1 sing N N 420 TYR CE2 CZ sing Y N 421 TYR CE2 HE2 sing N N 422 TYR CZ OH sing N N 423 TYR OH HH sing N N 424 TYR OXT HXT sing N N 425 VAL N CA sing N N 426 VAL N H sing N N 427 VAL N H2 sing N N 428 VAL CA C sing N N 429 VAL CA CB sing N N 430 VAL CA HA sing N N 431 VAL C O doub N N 432 VAL C OXT sing N N 433 VAL CB CG1 sing N N 434 VAL CB CG2 sing N N 435 VAL CB HB sing N N 436 VAL CG1 HG11 sing N N 437 VAL CG1 HG12 sing N N 438 VAL CG1 HG13 sing N N 439 VAL CG2 HG21 sing N N 440 VAL CG2 HG22 sing N N 441 VAL CG2 HG23 sing N N 442 VAL OXT HXT sing N N 443 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R01AI098757 1 ;St. Jude Children's Research Hospital (ALSAC) ; 'United States' ? 2 ;St. Jude Children's Research Hospital (ALSAC) ; 'United States' ? 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 '(2Z)-4-[1-benzyl-4-(4-chlorobenzyl)piperidin-4-yl]-2-hydroxy-4-oxobut-2-enoic acid' 0N8 4 GLYCEROL GOL 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4E5E _pdbx_initial_refinement_model.details ? #