data_5CQC # _entry.id 5CQC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5CQC pdb_00005cqc 10.2210/pdb5cqc/pdb WWPDB D_1000212032 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-09 2 'Structure model' 1 1 2015-09-23 3 'Structure model' 1 2 2015-09-30 4 'Structure model' 1 3 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5CQC _pdbx_database_status.recvd_initial_deposition_date 2015-07-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Horenkamp, F.A.' 1 'Reinisch, K.M.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Dev.Cell _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1534-5807 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 34 _citation.language ? _citation.page_first 569 _citation.page_last 576 _citation.title 'The Legionella Anti-autophagy Effector RavZ Targets the Autophagosome via PI3P- and Curvature-Sensing Motifs.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.devcel.2015.08.010 _citation.pdbx_database_id_PubMed 26343456 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Horenkamp, F.A.' 1 ? primary 'Kauffman, K.J.' 2 ? primary 'Kohler, L.J.' 3 ? primary 'Sherwood, R.K.' 4 ? primary 'Krueger, K.P.' 5 ? primary 'Shteyn, V.' 6 ? primary 'Roy, C.R.' 7 ? primary 'Melia, T.J.' 8 ? primary 'Reinisch, K.M.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'putative RavZ protein' 47118.910 1 ? ? ? ? 2 non-polymer syn 'BARIUM ION' 137.327 1 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSKLIVDEFEELGEQELDKTTSIYPPETSWEVNKGMNSSRLHKLYSLFFDKSSAFYLGDDVSVLEDKPLTGAYGFQSKKN DQQIFLFRPDSDYVAGYHVDAKSDAGWVNDKLDRRLSEISEFCSKATQPATFILPFVEMPTDITKGVQHQVLLTISYDPK SKQLTPTVYDSIGRDTYSESLSSYFKGKYRTTCDEILTQSIEKAIKSTDFTLGKFTRAAYNHQNRLTEGNCGSYTFRTIK EVISSSAQGTEVKIPGSGYITSNSYLTSQHVQDIESCIKYRNLGVVDIESALTEGKTLPVQLSEFIVALEDYGKLRSQQS EKSMLNFIGYSKTAKLTAVELLIGILNDIKGKNEISESQYDKLVKEVDCLMDSSLGKLVQFHLKNLGAESLQKLVLPCVK FDDELFDVPDITGEELASKK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSKLIVDEFEELGEQELDKTTSIYPPETSWEVNKGMNSSRLHKLYSLFFDKSSAFYLGDDVSVLEDKPLTGAYGFQSKKN DQQIFLFRPDSDYVAGYHVDAKSDAGWVNDKLDRRLSEISEFCSKATQPATFILPFVEMPTDITKGVQHQVLLTISYDPK SKQLTPTVYDSIGRDTYSESLSSYFKGKYRTTCDEILTQSIEKAIKSTDFTLGKFTRAAYNHQNRLTEGNCGSYTFRTIK EVISSSAQGTEVKIPGSGYITSNSYLTSQHVQDIESCIKYRNLGVVDIESALTEGKTLPVQLSEFIVALEDYGKLRSQQS EKSMLNFIGYSKTAKLTAVELLIGILNDIKGKNEISESQYDKLVKEVDCLMDSSLGKLVQFHLKNLGAESLQKLVLPCVK FDDELFDVPDITGEELASKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'BARIUM ION' BA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 LEU n 1 5 ILE n 1 6 VAL n 1 7 ASP n 1 8 GLU n 1 9 PHE n 1 10 GLU n 1 11 GLU n 1 12 LEU n 1 13 GLY n 1 14 GLU n 1 15 GLN n 1 16 GLU n 1 17 LEU n 1 18 ASP n 1 19 LYS n 1 20 THR n 1 21 THR n 1 22 SER n 1 23 ILE n 1 24 TYR n 1 25 PRO n 1 26 PRO n 1 27 GLU n 1 28 THR n 1 29 SER n 1 30 TRP n 1 31 GLU n 1 32 VAL n 1 33 ASN n 1 34 LYS n 1 35 GLY n 1 36 MET n 1 37 ASN n 1 38 SER n 1 39 SER n 1 40 ARG n 1 41 LEU n 1 42 HIS n 1 43 LYS n 1 44 LEU n 1 45 TYR n 1 46 SER n 1 47 LEU n 1 48 PHE n 1 49 PHE n 1 50 ASP n 1 51 LYS n 1 52 SER n 1 53 SER n 1 54 ALA n 1 55 PHE n 1 56 TYR n 1 57 LEU n 1 58 GLY n 1 59 ASP n 1 60 ASP n 1 61 VAL n 1 62 SER n 1 63 VAL n 1 64 LEU n 1 65 GLU n 1 66 ASP n 1 67 LYS n 1 68 PRO n 1 69 LEU n 1 70 THR n 1 71 GLY n 1 72 ALA n 1 73 TYR n 1 74 GLY n 1 75 PHE n 1 76 GLN n 1 77 SER n 1 78 LYS n 1 79 LYS n 1 80 ASN n 1 81 ASP n 1 82 GLN n 1 83 GLN n 1 84 ILE n 1 85 PHE n 1 86 LEU n 1 87 PHE n 1 88 ARG n 1 89 PRO n 1 90 ASP n 1 91 SER n 1 92 ASP n 1 93 TYR n 1 94 VAL n 1 95 ALA n 1 96 GLY n 1 97 TYR n 1 98 HIS n 1 99 VAL n 1 100 ASP n 1 101 ALA n 1 102 LYS n 1 103 SER n 1 104 ASP n 1 105 ALA n 1 106 GLY n 1 107 TRP n 1 108 VAL n 1 109 ASN n 1 110 ASP n 1 111 LYS n 1 112 LEU n 1 113 ASP n 1 114 ARG n 1 115 ARG n 1 116 LEU n 1 117 SER n 1 118 GLU n 1 119 ILE n 1 120 SER n 1 121 GLU n 1 122 PHE n 1 123 CYS n 1 124 SER n 1 125 LYS n 1 126 ALA n 1 127 THR n 1 128 GLN n 1 129 PRO n 1 130 ALA n 1 131 THR n 1 132 PHE n 1 133 ILE n 1 134 LEU n 1 135 PRO n 1 136 PHE n 1 137 VAL n 1 138 GLU n 1 139 MET n 1 140 PRO n 1 141 THR n 1 142 ASP n 1 143 ILE n 1 144 THR n 1 145 LYS n 1 146 GLY n 1 147 VAL n 1 148 GLN n 1 149 HIS n 1 150 GLN n 1 151 VAL n 1 152 LEU n 1 153 LEU n 1 154 THR n 1 155 ILE n 1 156 SER n 1 157 TYR n 1 158 ASP n 1 159 PRO n 1 160 LYS n 1 161 SER n 1 162 LYS n 1 163 GLN n 1 164 LEU n 1 165 THR n 1 166 PRO n 1 167 THR n 1 168 VAL n 1 169 TYR n 1 170 ASP n 1 171 SER n 1 172 ILE n 1 173 GLY n 1 174 ARG n 1 175 ASP n 1 176 THR n 1 177 TYR n 1 178 SER n 1 179 GLU n 1 180 SER n 1 181 LEU n 1 182 SER n 1 183 SER n 1 184 TYR n 1 185 PHE n 1 186 LYS n 1 187 GLY n 1 188 LYS n 1 189 TYR n 1 190 ARG n 1 191 THR n 1 192 THR n 1 193 CYS n 1 194 ASP n 1 195 GLU n 1 196 ILE n 1 197 LEU n 1 198 THR n 1 199 GLN n 1 200 SER n 1 201 ILE n 1 202 GLU n 1 203 LYS n 1 204 ALA n 1 205 ILE n 1 206 LYS n 1 207 SER n 1 208 THR n 1 209 ASP n 1 210 PHE n 1 211 THR n 1 212 LEU n 1 213 GLY n 1 214 LYS n 1 215 PHE n 1 216 THR n 1 217 ARG n 1 218 ALA n 1 219 ALA n 1 220 TYR n 1 221 ASN n 1 222 HIS n 1 223 GLN n 1 224 ASN n 1 225 ARG n 1 226 LEU n 1 227 THR n 1 228 GLU n 1 229 GLY n 1 230 ASN n 1 231 CYS n 1 232 GLY n 1 233 SER n 1 234 TYR n 1 235 THR n 1 236 PHE n 1 237 ARG n 1 238 THR n 1 239 ILE n 1 240 LYS n 1 241 GLU n 1 242 VAL n 1 243 ILE n 1 244 SER n 1 245 SER n 1 246 SER n 1 247 ALA n 1 248 GLN n 1 249 GLY n 1 250 THR n 1 251 GLU n 1 252 VAL n 1 253 LYS n 1 254 ILE n 1 255 PRO n 1 256 GLY n 1 257 SER n 1 258 GLY n 1 259 TYR n 1 260 ILE n 1 261 THR n 1 262 SER n 1 263 ASN n 1 264 SER n 1 265 TYR n 1 266 LEU n 1 267 THR n 1 268 SER n 1 269 GLN n 1 270 HIS n 1 271 VAL n 1 272 GLN n 1 273 ASP n 1 274 ILE n 1 275 GLU n 1 276 SER n 1 277 CYS n 1 278 ILE n 1 279 LYS n 1 280 TYR n 1 281 ARG n 1 282 ASN n 1 283 LEU n 1 284 GLY n 1 285 VAL n 1 286 VAL n 1 287 ASP n 1 288 ILE n 1 289 GLU n 1 290 SER n 1 291 ALA n 1 292 LEU n 1 293 THR n 1 294 GLU n 1 295 GLY n 1 296 LYS n 1 297 THR n 1 298 LEU n 1 299 PRO n 1 300 VAL n 1 301 GLN n 1 302 LEU n 1 303 SER n 1 304 GLU n 1 305 PHE n 1 306 ILE n 1 307 VAL n 1 308 ALA n 1 309 LEU n 1 310 GLU n 1 311 ASP n 1 312 TYR n 1 313 GLY n 1 314 LYS n 1 315 LEU n 1 316 ARG n 1 317 SER n 1 318 GLN n 1 319 GLN n 1 320 SER n 1 321 GLU n 1 322 LYS n 1 323 SER n 1 324 MET n 1 325 LEU n 1 326 ASN n 1 327 PHE n 1 328 ILE n 1 329 GLY n 1 330 TYR n 1 331 SER n 1 332 LYS n 1 333 THR n 1 334 ALA n 1 335 LYS n 1 336 LEU n 1 337 THR n 1 338 ALA n 1 339 VAL n 1 340 GLU n 1 341 LEU n 1 342 LEU n 1 343 ILE n 1 344 GLY n 1 345 ILE n 1 346 LEU n 1 347 ASN n 1 348 ASP n 1 349 ILE n 1 350 LYS n 1 351 GLY n 1 352 LYS n 1 353 ASN n 1 354 GLU n 1 355 ILE n 1 356 SER n 1 357 GLU n 1 358 SER n 1 359 GLN n 1 360 TYR n 1 361 ASP n 1 362 LYS n 1 363 LEU n 1 364 VAL n 1 365 LYS n 1 366 GLU n 1 367 VAL n 1 368 ASP n 1 369 CYS n 1 370 LEU n 1 371 MET n 1 372 ASP n 1 373 SER n 1 374 SER n 1 375 LEU n 1 376 GLY n 1 377 LYS n 1 378 LEU n 1 379 VAL n 1 380 GLN n 1 381 PHE n 1 382 HIS n 1 383 LEU n 1 384 LYS n 1 385 ASN n 1 386 LEU n 1 387 GLY n 1 388 ALA n 1 389 GLU n 1 390 SER n 1 391 LEU n 1 392 GLN n 1 393 LYS n 1 394 LEU n 1 395 VAL n 1 396 LEU n 1 397 PRO n 1 398 CYS n 1 399 VAL n 1 400 LYS n 1 401 PHE n 1 402 ASP n 1 403 ASP n 1 404 GLU n 1 405 LEU n 1 406 PHE n 1 407 ASP n 1 408 VAL n 1 409 PRO n 1 410 ASP n 1 411 ILE n 1 412 THR n 1 413 GLY n 1 414 GLU n 1 415 GLU n 1 416 LEU n 1 417 ALA n 1 418 SER n 1 419 LYS n 1 420 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 420 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene lpg1683 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Legionella pneumophila' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 446 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGex6P1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BA non-polymer . 'BARIUM ION' ? 'Ba 2' 137.327 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 28 ? ? ? A . n A 1 2 SER 2 29 ? ? ? A . n A 1 3 LYS 3 30 ? ? ? A . n A 1 4 LEU 4 31 ? ? ? A . n A 1 5 ILE 5 32 ? ? ? A . n A 1 6 VAL 6 33 ? ? ? A . n A 1 7 ASP 7 34 ? ? ? A . n A 1 8 GLU 8 35 ? ? ? A . n A 1 9 PHE 9 36 ? ? ? A . n A 1 10 GLU 10 37 ? ? ? A . n A 1 11 GLU 11 38 ? ? ? A . n A 1 12 LEU 12 39 ? ? ? A . n A 1 13 GLY 13 40 ? ? ? A . n A 1 14 GLU 14 41 ? ? ? A . n A 1 15 GLN 15 42 ? ? ? A . n A 1 16 GLU 16 43 ? ? ? A . n A 1 17 LEU 17 44 ? ? ? A . n A 1 18 ASP 18 45 ? ? ? A . n A 1 19 LYS 19 46 ? ? ? A . n A 1 20 THR 20 47 ? ? ? A . n A 1 21 THR 21 48 ? ? ? A . n A 1 22 SER 22 49 49 SER SER A . n A 1 23 ILE 23 50 50 ILE ILE A . n A 1 24 TYR 24 51 51 TYR TYR A . n A 1 25 PRO 25 52 52 PRO PRO A . n A 1 26 PRO 26 53 53 PRO PRO A . n A 1 27 GLU 27 54 54 GLU GLU A . n A 1 28 THR 28 55 55 THR THR A . n A 1 29 SER 29 56 56 SER SER A . n A 1 30 TRP 30 57 57 TRP TRP A . n A 1 31 GLU 31 58 58 GLU GLU A . n A 1 32 VAL 32 59 59 VAL VAL A . n A 1 33 ASN 33 60 60 ASN ASN A . n A 1 34 LYS 34 61 61 LYS LYS A . n A 1 35 GLY 35 62 62 GLY GLY A . n A 1 36 MET 36 63 63 MET MET A . n A 1 37 ASN 37 64 64 ASN ASN A . n A 1 38 SER 38 65 65 SER SER A . n A 1 39 SER 39 66 66 SER SER A . n A 1 40 ARG 40 67 67 ARG ARG A . n A 1 41 LEU 41 68 68 LEU LEU A . n A 1 42 HIS 42 69 69 HIS HIS A . n A 1 43 LYS 43 70 70 LYS LYS A . n A 1 44 LEU 44 71 71 LEU LEU A . n A 1 45 TYR 45 72 72 TYR TYR A . n A 1 46 SER 46 73 73 SER SER A . n A 1 47 LEU 47 74 74 LEU LEU A . n A 1 48 PHE 48 75 75 PHE PHE A . n A 1 49 PHE 49 76 76 PHE PHE A . n A 1 50 ASP 50 77 77 ASP ASP A . n A 1 51 LYS 51 78 78 LYS LYS A . n A 1 52 SER 52 79 79 SER SER A . n A 1 53 SER 53 80 80 SER SER A . n A 1 54 ALA 54 81 81 ALA ALA A . n A 1 55 PHE 55 82 82 PHE PHE A . n A 1 56 TYR 56 83 83 TYR TYR A . n A 1 57 LEU 57 84 84 LEU LEU A . n A 1 58 GLY 58 85 85 GLY GLY A . n A 1 59 ASP 59 86 86 ASP ASP A . n A 1 60 ASP 60 87 87 ASP ASP A . n A 1 61 VAL 61 88 88 VAL VAL A . n A 1 62 SER 62 89 89 SER SER A . n A 1 63 VAL 63 90 90 VAL VAL A . n A 1 64 LEU 64 91 91 LEU LEU A . n A 1 65 GLU 65 92 ? ? ? A . n A 1 66 ASP 66 93 ? ? ? A . n A 1 67 LYS 67 94 ? ? ? A . n A 1 68 PRO 68 95 ? ? ? A . n A 1 69 LEU 69 96 96 LEU LEU A . n A 1 70 THR 70 97 97 THR THR A . n A 1 71 GLY 71 98 98 GLY GLY A . n A 1 72 ALA 72 99 99 ALA ALA A . n A 1 73 TYR 73 100 100 TYR TYR A . n A 1 74 GLY 74 101 101 GLY GLY A . n A 1 75 PHE 75 102 102 PHE PHE A . n A 1 76 GLN 76 103 103 GLN GLN A . n A 1 77 SER 77 104 104 SER SER A . n A 1 78 LYS 78 105 105 LYS LYS A . n A 1 79 LYS 79 106 106 LYS LYS A . n A 1 80 ASN 80 107 107 ASN ASN A . n A 1 81 ASP 81 108 108 ASP ASP A . n A 1 82 GLN 82 109 109 GLN GLN A . n A 1 83 GLN 83 110 110 GLN GLN A . n A 1 84 ILE 84 111 111 ILE ILE A . n A 1 85 PHE 85 112 112 PHE PHE A . n A 1 86 LEU 86 113 113 LEU LEU A . n A 1 87 PHE 87 114 114 PHE PHE A . n A 1 88 ARG 88 115 115 ARG ARG A . n A 1 89 PRO 89 116 116 PRO PRO A . n A 1 90 ASP 90 117 117 ASP ASP A . n A 1 91 SER 91 118 118 SER SER A . n A 1 92 ASP 92 119 119 ASP ASP A . n A 1 93 TYR 93 120 120 TYR TYR A . n A 1 94 VAL 94 121 121 VAL VAL A . n A 1 95 ALA 95 122 122 ALA ALA A . n A 1 96 GLY 96 123 123 GLY GLY A . n A 1 97 TYR 97 124 124 TYR TYR A . n A 1 98 HIS 98 125 125 HIS HIS A . n A 1 99 VAL 99 126 126 VAL VAL A . n A 1 100 ASP 100 127 127 ASP ASP A . n A 1 101 ALA 101 128 128 ALA ALA A . n A 1 102 LYS 102 129 129 LYS LYS A . n A 1 103 SER 103 130 130 SER SER A . n A 1 104 ASP 104 131 131 ASP ASP A . n A 1 105 ALA 105 132 132 ALA ALA A . n A 1 106 GLY 106 133 133 GLY GLY A . n A 1 107 TRP 107 134 134 TRP TRP A . n A 1 108 VAL 108 135 135 VAL VAL A . n A 1 109 ASN 109 136 136 ASN ASN A . n A 1 110 ASP 110 137 137 ASP ASP A . n A 1 111 LYS 111 138 138 LYS LYS A . n A 1 112 LEU 112 139 139 LEU LEU A . n A 1 113 ASP 113 140 140 ASP ASP A . n A 1 114 ARG 114 141 141 ARG ARG A . n A 1 115 ARG 115 142 142 ARG ARG A . n A 1 116 LEU 116 143 143 LEU LEU A . n A 1 117 SER 117 144 144 SER SER A . n A 1 118 GLU 118 145 145 GLU GLU A . n A 1 119 ILE 119 146 146 ILE ILE A . n A 1 120 SER 120 147 147 SER SER A . n A 1 121 GLU 121 148 148 GLU GLU A . n A 1 122 PHE 122 149 149 PHE PHE A . n A 1 123 CYS 123 150 150 CYS CYS A . n A 1 124 SER 124 151 151 SER SER A . n A 1 125 LYS 125 152 152 LYS LYS A . n A 1 126 ALA 126 153 153 ALA ALA A . n A 1 127 THR 127 154 154 THR THR A . n A 1 128 GLN 128 155 155 GLN GLN A . n A 1 129 PRO 129 156 156 PRO PRO A . n A 1 130 ALA 130 157 157 ALA ALA A . n A 1 131 THR 131 158 158 THR THR A . n A 1 132 PHE 132 159 159 PHE PHE A . n A 1 133 ILE 133 160 160 ILE ILE A . n A 1 134 LEU 134 161 161 LEU LEU A . n A 1 135 PRO 135 162 162 PRO PRO A . n A 1 136 PHE 136 163 163 PHE PHE A . n A 1 137 VAL 137 164 164 VAL VAL A . n A 1 138 GLU 138 165 165 GLU GLU A . n A 1 139 MET 139 166 166 MET MET A . n A 1 140 PRO 140 167 167 PRO PRO A . n A 1 141 THR 141 168 168 THR THR A . n A 1 142 ASP 142 169 169 ASP ASP A . n A 1 143 ILE 143 170 170 ILE ILE A . n A 1 144 THR 144 171 171 THR THR A . n A 1 145 LYS 145 172 172 LYS LYS A . n A 1 146 GLY 146 173 173 GLY GLY A . n A 1 147 VAL 147 174 174 VAL VAL A . n A 1 148 GLN 148 175 175 GLN GLN A . n A 1 149 HIS 149 176 176 HIS HIS A . n A 1 150 GLN 150 177 177 GLN GLN A . n A 1 151 VAL 151 178 178 VAL VAL A . n A 1 152 LEU 152 179 179 LEU LEU A . n A 1 153 LEU 153 180 180 LEU LEU A . n A 1 154 THR 154 181 181 THR THR A . n A 1 155 ILE 155 182 182 ILE ILE A . n A 1 156 SER 156 183 183 SER SER A . n A 1 157 TYR 157 184 184 TYR TYR A . n A 1 158 ASP 158 185 185 ASP ASP A . n A 1 159 PRO 159 186 186 PRO PRO A . n A 1 160 LYS 160 187 187 LYS LYS A . n A 1 161 SER 161 188 188 SER SER A . n A 1 162 LYS 162 189 189 LYS LYS A . n A 1 163 GLN 163 190 190 GLN GLN A . n A 1 164 LEU 164 191 191 LEU LEU A . n A 1 165 THR 165 192 192 THR THR A . n A 1 166 PRO 166 193 193 PRO PRO A . n A 1 167 THR 167 194 194 THR THR A . n A 1 168 VAL 168 195 195 VAL VAL A . n A 1 169 TYR 169 196 196 TYR TYR A . n A 1 170 ASP 170 197 197 ASP ASP A . n A 1 171 SER 171 198 198 SER SER A . n A 1 172 ILE 172 199 199 ILE ILE A . n A 1 173 GLY 173 200 200 GLY GLY A . n A 1 174 ARG 174 201 201 ARG ARG A . n A 1 175 ASP 175 202 202 ASP ASP A . n A 1 176 THR 176 203 203 THR THR A . n A 1 177 TYR 177 204 204 TYR TYR A . n A 1 178 SER 178 205 205 SER SER A . n A 1 179 GLU 179 206 206 GLU GLU A . n A 1 180 SER 180 207 207 SER SER A . n A 1 181 LEU 181 208 208 LEU LEU A . n A 1 182 SER 182 209 209 SER SER A . n A 1 183 SER 183 210 210 SER SER A . n A 1 184 TYR 184 211 211 TYR TYR A . n A 1 185 PHE 185 212 212 PHE PHE A . n A 1 186 LYS 186 213 213 LYS LYS A . n A 1 187 GLY 187 214 214 GLY GLY A . n A 1 188 LYS 188 215 215 LYS LYS A . n A 1 189 TYR 189 216 216 TYR TYR A . n A 1 190 ARG 190 217 217 ARG ARG A . n A 1 191 THR 191 218 218 THR THR A . n A 1 192 THR 192 219 219 THR THR A . n A 1 193 CYS 193 220 220 CYS CYS A . n A 1 194 ASP 194 221 221 ASP ASP A . n A 1 195 GLU 195 222 222 GLU GLU A . n A 1 196 ILE 196 223 223 ILE ILE A . n A 1 197 LEU 197 224 224 LEU LEU A . n A 1 198 THR 198 225 225 THR THR A . n A 1 199 GLN 199 226 226 GLN GLN A . n A 1 200 SER 200 227 227 SER SER A . n A 1 201 ILE 201 228 228 ILE ILE A . n A 1 202 GLU 202 229 229 GLU GLU A . n A 1 203 LYS 203 230 230 LYS LYS A . n A 1 204 ALA 204 231 231 ALA ALA A . n A 1 205 ILE 205 232 232 ILE ILE A . n A 1 206 LYS 206 233 233 LYS LYS A . n A 1 207 SER 207 234 234 SER SER A . n A 1 208 THR 208 235 235 THR THR A . n A 1 209 ASP 209 236 236 ASP ASP A . n A 1 210 PHE 210 237 237 PHE PHE A . n A 1 211 THR 211 238 238 THR THR A . n A 1 212 LEU 212 239 239 LEU LEU A . n A 1 213 GLY 213 240 240 GLY GLY A . n A 1 214 LYS 214 241 241 LYS LYS A . n A 1 215 PHE 215 242 242 PHE PHE A . n A 1 216 THR 216 243 243 THR THR A . n A 1 217 ARG 217 244 244 ARG ARG A . n A 1 218 ALA 218 245 245 ALA ALA A . n A 1 219 ALA 219 246 246 ALA ALA A . n A 1 220 TYR 220 247 247 TYR TYR A . n A 1 221 ASN 221 248 248 ASN ASN A . n A 1 222 HIS 222 249 ? ? ? A . n A 1 223 GLN 223 250 ? ? ? A . n A 1 224 ASN 224 251 ? ? ? A . n A 1 225 ARG 225 252 ? ? ? A . n A 1 226 LEU 226 253 ? ? ? A . n A 1 227 THR 227 254 254 THR THR A . n A 1 228 GLU 228 255 255 GLU GLU A . n A 1 229 GLY 229 256 256 GLY GLY A . n A 1 230 ASN 230 257 257 ASN ASN A . n A 1 231 CYS 231 258 258 CYS CYS A . n A 1 232 GLY 232 259 259 GLY GLY A . n A 1 233 SER 233 260 260 SER SER A . n A 1 234 TYR 234 261 261 TYR TYR A . n A 1 235 THR 235 262 262 THR THR A . n A 1 236 PHE 236 263 263 PHE PHE A . n A 1 237 ARG 237 264 264 ARG ARG A . n A 1 238 THR 238 265 265 THR THR A . n A 1 239 ILE 239 266 266 ILE ILE A . n A 1 240 LYS 240 267 267 LYS LYS A . n A 1 241 GLU 241 268 268 GLU GLU A . n A 1 242 VAL 242 269 269 VAL VAL A . n A 1 243 ILE 243 270 270 ILE ILE A . n A 1 244 SER 244 271 271 SER SER A . n A 1 245 SER 245 272 272 SER SER A . n A 1 246 SER 246 273 273 SER SER A . n A 1 247 ALA 247 274 274 ALA ALA A . n A 1 248 GLN 248 275 275 GLN GLN A . n A 1 249 GLY 249 276 276 GLY GLY A . n A 1 250 THR 250 277 277 THR THR A . n A 1 251 GLU 251 278 ? ? ? A . n A 1 252 VAL 252 279 ? ? ? A . n A 1 253 LYS 253 280 ? ? ? A . n A 1 254 ILE 254 281 ? ? ? A . n A 1 255 PRO 255 282 ? ? ? A . n A 1 256 GLY 256 283 ? ? ? A . n A 1 257 SER 257 284 ? ? ? A . n A 1 258 GLY 258 285 ? ? ? A . n A 1 259 TYR 259 286 ? ? ? A . n A 1 260 ILE 260 287 ? ? ? A . n A 1 261 THR 261 288 288 THR THR A . n A 1 262 SER 262 289 289 SER SER A . n A 1 263 ASN 263 290 290 ASN ASN A . n A 1 264 SER 264 291 291 SER SER A . n A 1 265 TYR 265 292 292 TYR TYR A . n A 1 266 LEU 266 293 293 LEU LEU A . n A 1 267 THR 267 294 294 THR THR A . n A 1 268 SER 268 295 295 SER SER A . n A 1 269 GLN 269 296 296 GLN GLN A . n A 1 270 HIS 270 297 297 HIS HIS A . n A 1 271 VAL 271 298 298 VAL VAL A . n A 1 272 GLN 272 299 299 GLN GLN A . n A 1 273 ASP 273 300 300 ASP ASP A . n A 1 274 ILE 274 301 301 ILE ILE A . n A 1 275 GLU 275 302 302 GLU GLU A . n A 1 276 SER 276 303 303 SER SER A . n A 1 277 CYS 277 304 304 CYS CYS A . n A 1 278 ILE 278 305 305 ILE ILE A . n A 1 279 LYS 279 306 306 LYS LYS A . n A 1 280 TYR 280 307 307 TYR TYR A . n A 1 281 ARG 281 308 308 ARG ARG A . n A 1 282 ASN 282 309 309 ASN ASN A . n A 1 283 LEU 283 310 310 LEU LEU A . n A 1 284 GLY 284 311 311 GLY GLY A . n A 1 285 VAL 285 312 312 VAL VAL A . n A 1 286 VAL 286 313 313 VAL VAL A . n A 1 287 ASP 287 314 314 ASP ASP A . n A 1 288 ILE 288 315 315 ILE ILE A . n A 1 289 GLU 289 316 316 GLU GLU A . n A 1 290 SER 290 317 317 SER SER A . n A 1 291 ALA 291 318 318 ALA ALA A . n A 1 292 LEU 292 319 319 LEU LEU A . n A 1 293 THR 293 320 320 THR THR A . n A 1 294 GLU 294 321 321 GLU GLU A . n A 1 295 GLY 295 322 322 GLY GLY A . n A 1 296 LYS 296 323 323 LYS LYS A . n A 1 297 THR 297 324 324 THR THR A . n A 1 298 LEU 298 325 325 LEU LEU A . n A 1 299 PRO 299 326 326 PRO PRO A . n A 1 300 VAL 300 327 327 VAL VAL A . n A 1 301 GLN 301 328 328 GLN GLN A . n A 1 302 LEU 302 329 329 LEU LEU A . n A 1 303 SER 303 330 330 SER SER A . n A 1 304 GLU 304 331 331 GLU GLU A . n A 1 305 PHE 305 332 332 PHE PHE A . n A 1 306 ILE 306 333 333 ILE ILE A . n A 1 307 VAL 307 334 334 VAL VAL A . n A 1 308 ALA 308 335 335 ALA ALA A . n A 1 309 LEU 309 336 336 LEU LEU A . n A 1 310 GLU 310 337 337 GLU GLU A . n A 1 311 ASP 311 338 338 ASP ASP A . n A 1 312 TYR 312 339 339 TYR TYR A . n A 1 313 GLY 313 340 340 GLY GLY A . n A 1 314 LYS 314 341 341 LYS LYS A . n A 1 315 LEU 315 342 342 LEU LEU A . n A 1 316 ARG 316 343 343 ARG ARG A . n A 1 317 SER 317 344 344 SER SER A . n A 1 318 GLN 318 345 345 GLN GLN A . n A 1 319 GLN 319 346 346 GLN GLN A . n A 1 320 SER 320 347 ? ? ? A . n A 1 321 GLU 321 348 ? ? ? A . n A 1 322 LYS 322 349 ? ? ? A . n A 1 323 SER 323 350 ? ? ? A . n A 1 324 MET 324 351 ? ? ? A . n A 1 325 LEU 325 352 ? ? ? A . n A 1 326 ASN 326 353 ? ? ? A . n A 1 327 PHE 327 354 ? ? ? A . n A 1 328 ILE 328 355 ? ? ? A . n A 1 329 GLY 329 356 ? ? ? A . n A 1 330 TYR 330 357 357 TYR TYR A . n A 1 331 SER 331 358 358 SER SER A . n A 1 332 LYS 332 359 359 LYS LYS A . n A 1 333 THR 333 360 360 THR THR A . n A 1 334 ALA 334 361 361 ALA ALA A . n A 1 335 LYS 335 362 362 LYS LYS A . n A 1 336 LEU 336 363 363 LEU LEU A . n A 1 337 THR 337 364 364 THR THR A . n A 1 338 ALA 338 365 365 ALA ALA A . n A 1 339 VAL 339 366 366 VAL VAL A . n A 1 340 GLU 340 367 367 GLU GLU A . n A 1 341 LEU 341 368 368 LEU LEU A . n A 1 342 LEU 342 369 369 LEU LEU A . n A 1 343 ILE 343 370 370 ILE ILE A . n A 1 344 GLY 344 371 371 GLY GLY A . n A 1 345 ILE 345 372 372 ILE ILE A . n A 1 346 LEU 346 373 373 LEU LEU A . n A 1 347 ASN 347 374 374 ASN ASN A . n A 1 348 ASP 348 375 375 ASP ASP A . n A 1 349 ILE 349 376 376 ILE ILE A . n A 1 350 LYS 350 377 377 LYS LYS A . n A 1 351 GLY 351 378 378 GLY GLY A . n A 1 352 LYS 352 379 379 LYS LYS A . n A 1 353 ASN 353 380 380 ASN ASN A . n A 1 354 GLU 354 381 381 GLU GLU A . n A 1 355 ILE 355 382 382 ILE ILE A . n A 1 356 SER 356 383 383 SER SER A . n A 1 357 GLU 357 384 384 GLU GLU A . n A 1 358 SER 358 385 385 SER SER A . n A 1 359 GLN 359 386 386 GLN GLN A . n A 1 360 TYR 360 387 387 TYR TYR A . n A 1 361 ASP 361 388 388 ASP ASP A . n A 1 362 LYS 362 389 389 LYS LYS A . n A 1 363 LEU 363 390 390 LEU LEU A . n A 1 364 VAL 364 391 391 VAL VAL A . n A 1 365 LYS 365 392 392 LYS LYS A . n A 1 366 GLU 366 393 393 GLU GLU A . n A 1 367 VAL 367 394 394 VAL VAL A . n A 1 368 ASP 368 395 395 ASP ASP A . n A 1 369 CYS 369 396 396 CYS CYS A . n A 1 370 LEU 370 397 397 LEU LEU A . n A 1 371 MET 371 398 398 MET MET A . n A 1 372 ASP 372 399 399 ASP ASP A . n A 1 373 SER 373 400 400 SER SER A . n A 1 374 SER 374 401 401 SER SER A . n A 1 375 LEU 375 402 402 LEU LEU A . n A 1 376 GLY 376 403 403 GLY GLY A . n A 1 377 LYS 377 404 404 LYS LYS A . n A 1 378 LEU 378 405 405 LEU LEU A . n A 1 379 VAL 379 406 406 VAL VAL A . n A 1 380 GLN 380 407 407 GLN GLN A . n A 1 381 PHE 381 408 408 PHE PHE A . n A 1 382 HIS 382 409 409 HIS HIS A . n A 1 383 LEU 383 410 410 LEU LEU A . n A 1 384 LYS 384 411 411 LYS LYS A . n A 1 385 ASN 385 412 412 ASN ASN A . n A 1 386 LEU 386 413 413 LEU LEU A . n A 1 387 GLY 387 414 414 GLY GLY A . n A 1 388 ALA 388 415 415 ALA ALA A . n A 1 389 GLU 389 416 416 GLU GLU A . n A 1 390 SER 390 417 417 SER SER A . n A 1 391 LEU 391 418 418 LEU LEU A . n A 1 392 GLN 392 419 419 GLN GLN A . n A 1 393 LYS 393 420 420 LYS LYS A . n A 1 394 LEU 394 421 421 LEU LEU A . n A 1 395 VAL 395 422 422 VAL VAL A . n A 1 396 LEU 396 423 423 LEU LEU A . n A 1 397 PRO 397 424 424 PRO PRO A . n A 1 398 CYS 398 425 425 CYS CYS A . n A 1 399 VAL 399 426 426 VAL VAL A . n A 1 400 LYS 400 427 427 LYS LYS A . n A 1 401 PHE 401 428 428 PHE PHE A . n A 1 402 ASP 402 429 429 ASP ASP A . n A 1 403 ASP 403 430 ? ? ? A . n A 1 404 GLU 404 431 ? ? ? A . n A 1 405 LEU 405 432 ? ? ? A . n A 1 406 PHE 406 433 ? ? ? A . n A 1 407 ASP 407 434 ? ? ? A . n A 1 408 VAL 408 435 ? ? ? A . n A 1 409 PRO 409 436 ? ? ? A . n A 1 410 ASP 410 437 ? ? ? A . n A 1 411 ILE 411 438 ? ? ? A . n A 1 412 THR 412 439 ? ? ? A . n A 1 413 GLY 413 440 ? ? ? A . n A 1 414 GLU 414 441 ? ? ? A . n A 1 415 GLU 415 442 ? ? ? A . n A 1 416 LEU 416 443 ? ? ? A . n A 1 417 ALA 417 444 ? ? ? A . n A 1 418 SER 418 445 ? ? ? A . n A 1 419 LYS 419 446 ? ? ? A . n A 1 420 LYS 420 447 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BA 1 501 1 BA BA A . C 3 HOH 1 601 1 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 61 ? CG ? A LYS 34 CG 2 1 Y 1 A LYS 61 ? CD ? A LYS 34 CD 3 1 Y 1 A LYS 61 ? CE ? A LYS 34 CE 4 1 Y 1 A LYS 61 ? NZ ? A LYS 34 NZ 5 1 Y 1 A LYS 78 ? CG ? A LYS 51 CG 6 1 Y 1 A LYS 78 ? CD ? A LYS 51 CD 7 1 Y 1 A LYS 78 ? CE ? A LYS 51 CE 8 1 Y 1 A LYS 78 ? NZ ? A LYS 51 NZ 9 1 Y 1 A ASP 87 ? CG ? A ASP 60 CG 10 1 Y 1 A ASP 87 ? OD1 ? A ASP 60 OD1 11 1 Y 1 A ASP 87 ? OD2 ? A ASP 60 OD2 12 1 Y 1 A LEU 91 ? CG ? A LEU 64 CG 13 1 Y 1 A LEU 91 ? CD1 ? A LEU 64 CD1 14 1 Y 1 A LEU 91 ? CD2 ? A LEU 64 CD2 15 1 Y 1 A LYS 105 ? CG ? A LYS 78 CG 16 1 Y 1 A LYS 105 ? CD ? A LYS 78 CD 17 1 Y 1 A LYS 105 ? CE ? A LYS 78 CE 18 1 Y 1 A LYS 105 ? NZ ? A LYS 78 NZ 19 1 Y 1 A LYS 106 ? CG ? A LYS 79 CG 20 1 Y 1 A LYS 106 ? CD ? A LYS 79 CD 21 1 Y 1 A LYS 106 ? CE ? A LYS 79 CE 22 1 Y 1 A LYS 106 ? NZ ? A LYS 79 NZ 23 1 Y 1 A ASP 108 ? CG ? A ASP 81 CG 24 1 Y 1 A ASP 108 ? OD1 ? A ASP 81 OD1 25 1 Y 1 A ASP 108 ? OD2 ? A ASP 81 OD2 26 1 Y 1 A LYS 129 ? CG ? A LYS 102 CG 27 1 Y 1 A LYS 129 ? CD ? A LYS 102 CD 28 1 Y 1 A LYS 129 ? CE ? A LYS 102 CE 29 1 Y 1 A LYS 129 ? NZ ? A LYS 102 NZ 30 1 Y 1 A LYS 152 ? CG ? A LYS 125 CG 31 1 Y 1 A LYS 152 ? CD ? A LYS 125 CD 32 1 Y 1 A LYS 152 ? CE ? A LYS 125 CE 33 1 Y 1 A LYS 152 ? NZ ? A LYS 125 NZ 34 1 Y 1 A GLN 155 ? CG ? A GLN 128 CG 35 1 Y 1 A GLN 155 ? CD ? A GLN 128 CD 36 1 Y 1 A GLN 155 ? OE1 ? A GLN 128 OE1 37 1 Y 1 A GLN 155 ? NE2 ? A GLN 128 NE2 38 1 Y 1 A LYS 172 ? CG ? A LYS 145 CG 39 1 Y 1 A LYS 172 ? CD ? A LYS 145 CD 40 1 Y 1 A LYS 172 ? CE ? A LYS 145 CE 41 1 Y 1 A LYS 172 ? NZ ? A LYS 145 NZ 42 1 Y 1 A LYS 187 ? CG ? A LYS 160 CG 43 1 Y 1 A LYS 187 ? CD ? A LYS 160 CD 44 1 Y 1 A LYS 187 ? CE ? A LYS 160 CE 45 1 Y 1 A LYS 187 ? NZ ? A LYS 160 NZ 46 1 Y 1 A LYS 189 ? CG ? A LYS 162 CG 47 1 Y 1 A LYS 189 ? CD ? A LYS 162 CD 48 1 Y 1 A LYS 189 ? CE ? A LYS 162 CE 49 1 Y 1 A LYS 189 ? NZ ? A LYS 162 NZ 50 1 Y 1 A ILE 199 ? CG1 ? A ILE 172 CG1 51 1 Y 1 A ILE 199 ? CG2 ? A ILE 172 CG2 52 1 Y 1 A ILE 199 ? CD1 ? A ILE 172 CD1 53 1 Y 1 A ARG 201 ? CG ? A ARG 174 CG 54 1 Y 1 A ARG 201 ? CD ? A ARG 174 CD 55 1 Y 1 A ARG 201 ? NE ? A ARG 174 NE 56 1 Y 1 A ARG 201 ? CZ ? A ARG 174 CZ 57 1 Y 1 A ARG 201 ? NH1 ? A ARG 174 NH1 58 1 Y 1 A ARG 201 ? NH2 ? A ARG 174 NH2 59 1 Y 1 A ASP 202 ? CG ? A ASP 175 CG 60 1 Y 1 A ASP 202 ? OD1 ? A ASP 175 OD1 61 1 Y 1 A ASP 202 ? OD2 ? A ASP 175 OD2 62 1 Y 1 A TYR 204 ? CG ? A TYR 177 CG 63 1 Y 1 A TYR 204 ? CD1 ? A TYR 177 CD1 64 1 Y 1 A TYR 204 ? CD2 ? A TYR 177 CD2 65 1 Y 1 A TYR 204 ? CE1 ? A TYR 177 CE1 66 1 Y 1 A TYR 204 ? CE2 ? A TYR 177 CE2 67 1 Y 1 A TYR 204 ? CZ ? A TYR 177 CZ 68 1 Y 1 A TYR 204 ? OH ? A TYR 177 OH 69 1 Y 1 A GLU 206 ? CG ? A GLU 179 CG 70 1 Y 1 A GLU 206 ? CD ? A GLU 179 CD 71 1 Y 1 A GLU 206 ? OE1 ? A GLU 179 OE1 72 1 Y 1 A GLU 206 ? OE2 ? A GLU 179 OE2 73 1 Y 1 A LEU 208 ? CG ? A LEU 181 CG 74 1 Y 1 A LEU 208 ? CD1 ? A LEU 181 CD1 75 1 Y 1 A LEU 208 ? CD2 ? A LEU 181 CD2 76 1 Y 1 A LYS 215 ? CG ? A LYS 188 CG 77 1 Y 1 A LYS 215 ? CD ? A LYS 188 CD 78 1 Y 1 A LYS 215 ? CE ? A LYS 188 CE 79 1 Y 1 A LYS 215 ? NZ ? A LYS 188 NZ 80 1 Y 1 A LYS 233 ? CG ? A LYS 206 CG 81 1 Y 1 A LYS 233 ? CD ? A LYS 206 CD 82 1 Y 1 A LYS 233 ? CE ? A LYS 206 CE 83 1 Y 1 A LYS 233 ? NZ ? A LYS 206 NZ 84 1 Y 1 A LEU 239 ? CG ? A LEU 212 CG 85 1 Y 1 A LEU 239 ? CD1 ? A LEU 212 CD1 86 1 Y 1 A LEU 239 ? CD2 ? A LEU 212 CD2 87 1 Y 1 A LYS 241 ? CG ? A LYS 214 CG 88 1 Y 1 A LYS 241 ? CD ? A LYS 214 CD 89 1 Y 1 A LYS 241 ? CE ? A LYS 214 CE 90 1 Y 1 A LYS 241 ? NZ ? A LYS 214 NZ 91 1 Y 1 A ASN 248 ? CG ? A ASN 221 CG 92 1 Y 1 A ASN 248 ? OD1 ? A ASN 221 OD1 93 1 Y 1 A ASN 248 ? ND2 ? A ASN 221 ND2 94 1 Y 1 A THR 254 ? OG1 ? A THR 227 OG1 95 1 Y 1 A THR 254 ? CG2 ? A THR 227 CG2 96 1 Y 1 A GLU 255 ? CG ? A GLU 228 CG 97 1 Y 1 A GLU 255 ? CD ? A GLU 228 CD 98 1 Y 1 A GLU 255 ? OE1 ? A GLU 228 OE1 99 1 Y 1 A GLU 255 ? OE2 ? A GLU 228 OE2 100 1 Y 1 A ASN 257 ? CG ? A ASN 230 CG 101 1 Y 1 A ASN 257 ? OD1 ? A ASN 230 OD1 102 1 Y 1 A ASN 257 ? ND2 ? A ASN 230 ND2 103 1 Y 1 A THR 277 ? OG1 ? A THR 250 OG1 104 1 Y 1 A THR 277 ? CG2 ? A THR 250 CG2 105 1 Y 1 A SER 289 ? OG ? A SER 262 OG 106 1 Y 1 A ASN 290 ? CG ? A ASN 263 CG 107 1 Y 1 A ASN 290 ? OD1 ? A ASN 263 OD1 108 1 Y 1 A ASN 290 ? ND2 ? A ASN 263 ND2 109 1 Y 1 A GLN 299 ? CG ? A GLN 272 CG 110 1 Y 1 A GLN 299 ? CD ? A GLN 272 CD 111 1 Y 1 A GLN 299 ? OE1 ? A GLN 272 OE1 112 1 Y 1 A GLN 299 ? NE2 ? A GLN 272 NE2 113 1 Y 1 A GLU 321 ? CG ? A GLU 294 CG 114 1 Y 1 A GLU 321 ? CD ? A GLU 294 CD 115 1 Y 1 A GLU 321 ? OE1 ? A GLU 294 OE1 116 1 Y 1 A GLU 321 ? OE2 ? A GLU 294 OE2 117 1 Y 1 A LYS 323 ? CG ? A LYS 296 CG 118 1 Y 1 A LYS 323 ? CD ? A LYS 296 CD 119 1 Y 1 A LYS 323 ? CE ? A LYS 296 CE 120 1 Y 1 A LYS 323 ? NZ ? A LYS 296 NZ 121 1 Y 1 A ASP 375 ? CG ? A ASP 348 CG 122 1 Y 1 A ASP 375 ? OD1 ? A ASP 348 OD1 123 1 Y 1 A ASP 375 ? OD2 ? A ASP 348 OD2 124 1 Y 1 A LYS 377 ? CG ? A LYS 350 CG 125 1 Y 1 A LYS 377 ? CD ? A LYS 350 CD 126 1 Y 1 A LYS 377 ? CE ? A LYS 350 CE 127 1 Y 1 A LYS 377 ? NZ ? A LYS 350 NZ 128 1 Y 1 A LYS 379 ? CG ? A LYS 352 CG 129 1 Y 1 A LYS 379 ? CD ? A LYS 352 CD 130 1 Y 1 A LYS 379 ? CE ? A LYS 352 CE 131 1 Y 1 A LYS 379 ? NZ ? A LYS 352 NZ 132 1 Y 1 A ASN 380 ? CG ? A ASN 353 CG 133 1 Y 1 A ASN 380 ? OD1 ? A ASN 353 OD1 134 1 Y 1 A ASN 380 ? ND2 ? A ASN 353 ND2 135 1 Y 1 A GLU 381 ? CG ? A GLU 354 CG 136 1 Y 1 A GLU 381 ? CD ? A GLU 354 CD 137 1 Y 1 A GLU 381 ? OE1 ? A GLU 354 OE1 138 1 Y 1 A GLU 381 ? OE2 ? A GLU 354 OE2 139 1 Y 1 A ILE 382 ? CG1 ? A ILE 355 CG1 140 1 Y 1 A ILE 382 ? CG2 ? A ILE 355 CG2 141 1 Y 1 A ILE 382 ? CD1 ? A ILE 355 CD1 142 1 Y 1 A SER 383 ? OG ? A SER 356 OG 143 1 Y 1 A GLU 384 ? CG ? A GLU 357 CG 144 1 Y 1 A GLU 384 ? CD ? A GLU 357 CD 145 1 Y 1 A GLU 384 ? OE1 ? A GLU 357 OE1 146 1 Y 1 A GLU 384 ? OE2 ? A GLU 357 OE2 147 1 Y 1 A ASP 388 ? CG ? A ASP 361 CG 148 1 Y 1 A ASP 388 ? OD1 ? A ASP 361 OD1 149 1 Y 1 A ASP 388 ? OD2 ? A ASP 361 OD2 150 1 Y 1 A LYS 392 ? CG ? A LYS 365 CG 151 1 Y 1 A LYS 392 ? CD ? A LYS 365 CD 152 1 Y 1 A LYS 392 ? CE ? A LYS 365 CE 153 1 Y 1 A LYS 392 ? NZ ? A LYS 365 NZ 154 1 Y 1 A GLU 416 ? CG ? A GLU 389 CG 155 1 Y 1 A GLU 416 ? CD ? A GLU 389 CD 156 1 Y 1 A GLU 416 ? OE1 ? A GLU 389 OE1 157 1 Y 1 A GLU 416 ? OE2 ? A GLU 389 OE2 158 1 Y 1 A LYS 420 ? CG ? A LYS 393 CG 159 1 Y 1 A LYS 420 ? CD ? A LYS 393 CD 160 1 Y 1 A LYS 420 ? CE ? A LYS 393 CE 161 1 Y 1 A LYS 420 ? NZ ? A LYS 393 NZ 162 1 Y 1 A LEU 421 ? CG ? A LEU 394 CG 163 1 Y 1 A LEU 421 ? CD1 ? A LEU 394 CD1 164 1 Y 1 A LEU 421 ? CD2 ? A LEU 394 CD2 165 1 Y 1 A LYS 427 ? CG ? A LYS 400 CG 166 1 Y 1 A LYS 427 ? CD ? A LYS 400 CD 167 1 Y 1 A LYS 427 ? CE ? A LYS 400 CE 168 1 Y 1 A LYS 427 ? NZ ? A LYS 400 NZ 169 1 Y 1 A ASP 429 ? CG ? A ASP 402 CG 170 1 Y 1 A ASP 429 ? OD1 ? A ASP 402 OD1 171 1 Y 1 A ASP 429 ? OD2 ? A ASP 402 OD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5CQC _cell.details ? _cell.formula_units_Z ? _cell.length_a 221.778 _cell.length_a_esd ? _cell.length_b 221.778 _cell.length_b_esd ? _cell.length_c 72.536 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5CQC _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5CQC _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 74.01 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.1 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '12% PEG 3350, 0.2 M BaCl2, 0.1 M MES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-07-09 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(220)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5CQC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.98 _reflns.d_resolution_low 110 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 18551 _reflns.number_obs 18194 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.7 _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.98 _reflns_shell.d_res_low 3.14 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 98.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5CQC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.985 _refine.ls_d_res_low 68.942 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18179 _refine.ls_number_reflns_R_free 1818 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.13 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2180 _refine.ls_R_factor_R_free 0.2504 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2143 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.61 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.44 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2606 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 2608 _refine_hist.d_res_high 2.985 _refine_hist.d_res_low 68.942 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 2653 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.329 ? 3609 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.432 ? 903 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.052 ? 428 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 460 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.9849 3.0656 . . 108 966 77.00 . . . 0.4484 . 0.3916 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0656 3.1558 . . 139 1249 97.00 . . . 0.4266 . 0.3682 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1558 3.2577 . . 139 1256 100.00 . . . 0.3857 . 0.3090 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2577 3.3741 . . 142 1275 100.00 . . . 0.3142 . 0.2641 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3741 3.5092 . . 140 1259 99.00 . . . 0.3075 . 0.2878 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5092 3.6689 . . 142 1290 99.00 . . . 0.3024 . 0.2164 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6689 3.8623 . . 140 1255 99.00 . . . 0.2469 . 0.2198 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8623 4.1042 . . 144 1291 99.00 . . . 0.2904 . 0.2042 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1042 4.4211 . . 140 1272 99.00 . . . 0.2931 . 0.1892 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4211 4.8659 . . 145 1299 99.00 . . . 0.1864 . 0.1703 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.8659 5.5697 . . 144 1291 99.00 . . . 0.1985 . 0.1868 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.5697 7.0162 . . 144 1303 99.00 . . . 0.2539 . 0.2449 . . . . . . . . . . 'X-RAY DIFFRACTION' 7.0162 68.9606 . . 151 1355 96.00 . . . 0.2267 . 0.2015 . . . . . . . . . . # _struct.entry_id 5CQC _struct.title 'Crystal structure of the legionella pneumophila effector protein RavZ' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5CQC _struct_keywords.text 'Ulp-family cysteine protease, autophagy inhibitor, PI3P binding domain, legionella pneumophila effector protein, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5ZUV9_LEGPH _struct_ref.pdbx_db_accession Q5ZUV9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KLIVDEFEELGEQESDIDEFDLLEGDEKLPGDSELDKTTSIYPPETSWEVNKGMNSSRLHKLYSLFFDKSSAFYLGDDVS VLEDKPLTGAYGFQSKKNDQQIFLFRPDSDYVAGYHVDAKSDAGWVNDKLDRRLSEISEFCSKATQPATFILPFVEMPTD ITKGVQHQVLLTISYDPKSKQLTPTVYDSIGRDTYSESLSSYFKGKYRTTCDEILTQSIEKAIKSTDFTLGKFTRAAYNH QNRLTEGNCGSYTFRTIKEVISSSAQGTEVKIPGSGYITSNSYLTSQHVQDIESCIKYRNLGVVDIESALTEGKTLPVQL SEFIVALEDYGKLRSQQSEKSMLNFIGYSKTAKLTAVELLIGILNDIKGKNEISESQYDKLVKEVDCLMDSSLGKLVQFH LKNLGAESLQKLVLPCVKFDDTIDDFVTIEKDELFDVPDITGEELASKK ; _struct_ref.pdbx_align_begin 10 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5CQC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 420 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5ZUV9 _struct_ref_seq.db_align_beg 10 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 458 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 30 _struct_ref_seq.pdbx_auth_seq_align_end 447 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5CQC GLY A 1 ? UNP Q5ZUV9 ? ? 'expression tag' 28 1 1 5CQC SER A 2 ? UNP Q5ZUV9 ? ? 'expression tag' 29 2 1 5CQC ? A ? ? UNP Q5ZUV9 GLU 23 deletion ? 3 1 5CQC ? A ? ? UNP Q5ZUV9 SER 24 deletion ? 4 1 5CQC ? A ? ? UNP Q5ZUV9 ASP 25 deletion ? 5 1 5CQC ? A ? ? UNP Q5ZUV9 ILE 26 deletion ? 6 1 5CQC ? A ? ? UNP Q5ZUV9 ASP 27 deletion ? 7 1 5CQC ? A ? ? UNP Q5ZUV9 GLU 28 deletion ? 8 1 5CQC ? A ? ? UNP Q5ZUV9 PHE 29 deletion ? 9 1 5CQC ? A ? ? UNP Q5ZUV9 ASP 30 deletion ? 10 1 5CQC ? A ? ? UNP Q5ZUV9 LEU 31 deletion ? 11 1 5CQC ? A ? ? UNP Q5ZUV9 LEU 32 deletion ? 12 1 5CQC ? A ? ? UNP Q5ZUV9 GLU 33 deletion ? 13 1 5CQC ? A ? ? UNP Q5ZUV9 GLY 34 deletion ? 14 1 5CQC ? A ? ? UNP Q5ZUV9 ASP 35 deletion ? 15 1 5CQC ? A ? ? UNP Q5ZUV9 GLU 36 deletion ? 16 1 5CQC ? A ? ? UNP Q5ZUV9 LYS 37 deletion ? 17 1 5CQC ? A ? ? UNP Q5ZUV9 LEU 38 deletion ? 18 1 5CQC ? A ? ? UNP Q5ZUV9 PRO 39 deletion ? 19 1 5CQC ? A ? ? UNP Q5ZUV9 GLY 40 deletion ? 20 1 5CQC ? A ? ? UNP Q5ZUV9 ASP 41 deletion ? 21 1 5CQC ? A ? ? UNP Q5ZUV9 SER 42 deletion ? 22 1 5CQC ? A ? ? UNP Q5ZUV9 ASP 430 deletion ? 23 1 5CQC ? A ? ? UNP Q5ZUV9 THR 431 deletion ? 24 1 5CQC ? A ? ? UNP Q5ZUV9 ILE 432 deletion ? 25 1 5CQC ? A ? ? UNP Q5ZUV9 ASP 433 deletion ? 26 1 5CQC ? A ? ? UNP Q5ZUV9 ASP 434 deletion ? 27 1 5CQC ? A ? ? UNP Q5ZUV9 PHE 435 deletion ? 28 1 5CQC ? A ? ? UNP Q5ZUV9 VAL 436 deletion ? 29 1 5CQC ? A ? ? UNP Q5ZUV9 THR 437 deletion ? 30 1 5CQC ? A ? ? UNP Q5ZUV9 ILE 438 deletion ? 31 1 5CQC ? A ? ? UNP Q5ZUV9 GLU 439 deletion ? 32 1 5CQC ? A ? ? UNP Q5ZUV9 LYS 440 deletion ? 33 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 37 ? TYR A 45 ? ASN A 64 TYR A 72 1 ? 9 HELX_P HELX_P2 AA2 SER A 46 ? ASP A 50 ? SER A 73 ASP A 77 5 ? 5 HELX_P HELX_P3 AA3 ASN A 109 ? ALA A 126 ? ASN A 136 ALA A 153 1 ? 18 HELX_P HELX_P4 AA4 SER A 182 ? TYR A 189 ? SER A 209 TYR A 216 1 ? 8 HELX_P HELX_P5 AA5 CYS A 193 ? ILE A 205 ? CYS A 220 ILE A 232 1 ? 13 HELX_P HELX_P6 AA6 ASN A 230 ? GLY A 249 ? ASN A 257 GLY A 276 1 ? 20 HELX_P HELX_P7 AA7 THR A 267 ? ARG A 281 ? THR A 294 ARG A 308 1 ? 15 HELX_P HELX_P8 AA8 VAL A 285 ? GLY A 295 ? VAL A 312 GLY A 322 1 ? 11 HELX_P HELX_P9 AA9 GLN A 301 ? GLN A 319 ? GLN A 328 GLN A 346 1 ? 19 HELX_P HELX_P10 AB1 SER A 331 ? GLY A 351 ? SER A 358 GLY A 378 1 ? 21 HELX_P HELX_P11 AB2 GLU A 357 ? ASP A 372 ? GLU A 384 ASP A 399 1 ? 16 HELX_P HELX_P12 AB3 ASP A 372 ? ASN A 385 ? ASP A 399 ASN A 412 1 ? 14 HELX_P HELX_P13 AB4 SER A 390 ? LEU A 396 ? SER A 417 LEU A 423 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A VAL 108 O ? ? ? 1_555 B BA . BA ? ? A VAL 135 A BA 501 1_555 ? ? ? ? ? ? ? 3.077 ? ? metalc2 metalc ? ? A ASP 110 OD1 ? ? ? 1_555 B BA . BA ? ? A ASP 137 A BA 501 1_555 ? ? ? ? ? ? ? 2.773 ? ? metalc3 metalc ? ? A ASP 113 OD2 ? ? ? 1_555 B BA . BA ? ? A ASP 140 A BA 501 1_555 ? ? ? ? ? ? ? 3.226 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A VAL 108 ? A VAL 135 ? 1_555 BA ? B BA . ? A BA 501 ? 1_555 OD1 ? A ASP 110 ? A ASP 137 ? 1_555 88.6 ? 2 O ? A VAL 108 ? A VAL 135 ? 1_555 BA ? B BA . ? A BA 501 ? 1_555 OD2 ? A ASP 113 ? A ASP 140 ? 1_555 87.0 ? 3 OD1 ? A ASP 110 ? A ASP 137 ? 1_555 BA ? B BA . ? A BA 501 ? 1_555 OD2 ? A ASP 113 ? A ASP 140 ? 1_555 105.1 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 7 ? AA3 ? 6 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? parallel AA4 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 23 ? TYR A 24 ? ILE A 50 TYR A 51 AA1 2 LEU A 283 ? GLY A 284 ? LEU A 310 GLY A 311 AA2 1 ASP A 60 ? SER A 62 ? ASP A 87 SER A 89 AA2 2 ALA A 72 ? SER A 77 ? ALA A 99 SER A 104 AA2 3 GLN A 83 ? PHE A 87 ? GLN A 110 PHE A 114 AA2 4 ALA A 130 ? PRO A 140 ? ALA A 157 PRO A 167 AA2 5 HIS A 149 ? ASP A 158 ? HIS A 176 ASP A 185 AA2 6 GLN A 163 ? ASP A 170 ? GLN A 190 ASP A 197 AA2 7 THR A 211 ? LEU A 212 ? THR A 238 LEU A 239 AA3 1 GLY A 106 ? VAL A 108 ? GLY A 133 VAL A 135 AA3 2 VAL A 94 ? TYR A 97 ? VAL A 121 TYR A 124 AA3 3 ALA A 130 ? PRO A 140 ? ALA A 157 PRO A 167 AA3 4 HIS A 149 ? ASP A 158 ? HIS A 176 ASP A 185 AA3 5 GLN A 163 ? ASP A 170 ? GLN A 190 ASP A 197 AA3 6 THR A 216 ? ALA A 219 ? THR A 243 ALA A 246 AA4 1 ILE A 355 ? SER A 356 ? ILE A 382 SER A 383 AA4 2 VAL A 399 ? LYS A 400 ? VAL A 426 LYS A 427 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 24 ? N TYR A 51 O LEU A 283 ? O LEU A 310 AA2 1 2 N VAL A 61 ? N VAL A 88 O GLN A 76 ? O GLN A 103 AA2 2 3 N PHE A 75 ? N PHE A 102 O ILE A 84 ? O ILE A 111 AA2 3 4 N PHE A 85 ? N PHE A 112 O THR A 131 ? O THR A 158 AA2 4 5 N GLU A 138 ? N GLU A 165 O HIS A 149 ? O HIS A 176 AA2 5 6 N LEU A 152 ? N LEU A 179 O TYR A 169 ? O TYR A 196 AA2 6 7 N LEU A 164 ? N LEU A 191 O THR A 211 ? O THR A 238 AA3 1 2 O TRP A 107 ? O TRP A 134 N GLY A 96 ? N GLY A 123 AA3 2 3 N ALA A 95 ? N ALA A 122 O VAL A 137 ? O VAL A 164 AA3 3 4 N GLU A 138 ? N GLU A 165 O HIS A 149 ? O HIS A 176 AA3 4 5 N LEU A 152 ? N LEU A 179 O TYR A 169 ? O TYR A 196 AA3 5 6 N ASP A 170 ? N ASP A 197 O ALA A 218 ? O ALA A 245 AA4 1 2 N ILE A 355 ? N ILE A 382 O LYS A 400 ? O LYS A 427 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id BA _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue BA A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 VAL A 108 ? VAL A 135 . ? 1_555 ? 2 AC1 3 ASP A 110 ? ASP A 137 . ? 1_555 ? 3 AC1 3 ASP A 113 ? ASP A 140 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 76 ? ? CG2 A THR 324 ? ? 1.96 2 1 OD1 A ASP 127 ? ? N A LYS 129 ? ? 2.02 3 1 O A SER 272 ? ? N A GLY 276 ? ? 2.09 4 1 OD1 A ASP 221 ? ? NH1 A ARG 244 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 58 ? ? 56.43 19.19 2 1 ARG A 201 ? ? 54.35 -131.45 3 1 LYS A 379 ? ? 86.72 0.11 4 1 SER A 400 ? ? 54.68 -127.11 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 277.7170 187.2208 3.1378 0.6985 ? -0.0739 ? -0.0160 ? 0.4480 ? 0.0834 ? 0.6864 ? 5.1532 ? 0.3505 ? 0.4688 ? 4.6440 ? 2.8961 ? 8.1669 ? -0.2944 ? 0.0486 ? 0.3533 ? -0.3192 ? 0.0667 ? -0.0586 ? -0.5721 ? -0.1821 ? 0.2860 ? 2 'X-RAY DIFFRACTION' ? refined 288.9077 180.9791 -6.3251 0.9138 ? -0.1783 ? 0.0335 ? 0.7620 ? 0.0670 ? 0.8192 ? 2.5210 ? -3.5722 ? -0.9987 ? 7.4004 ? -1.6236 ? 4.8628 ? 0.0018 ? 0.4952 ? 0.9204 ? -0.3643 ? -0.0905 ? -0.8412 ? -0.5009 ? 0.7819 ? 0.0946 ? 3 'X-RAY DIFFRACTION' ? refined 279.7884 203.5680 22.7047 1.5120 ? -0.1154 ? -0.0563 ? 0.5664 ? -0.0836 ? 1.2897 ? 1.1550 ? 0.2186 ? -0.1395 ? 1.8226 ? 2.1508 ? 5.5478 ? 0.0697 ? -0.1239 ? 0.7190 ? -0.1280 ? -0.0256 ? 0.1130 ? -1.7614 ? 0.2896 ? -0.1124 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 49 through 167 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 168 through 256 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 257 through 429 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 28 ? A GLY 1 2 1 Y 1 A SER 29 ? A SER 2 3 1 Y 1 A LYS 30 ? A LYS 3 4 1 Y 1 A LEU 31 ? A LEU 4 5 1 Y 1 A ILE 32 ? A ILE 5 6 1 Y 1 A VAL 33 ? A VAL 6 7 1 Y 1 A ASP 34 ? A ASP 7 8 1 Y 1 A GLU 35 ? A GLU 8 9 1 Y 1 A PHE 36 ? A PHE 9 10 1 Y 1 A GLU 37 ? A GLU 10 11 1 Y 1 A GLU 38 ? A GLU 11 12 1 Y 1 A LEU 39 ? A LEU 12 13 1 Y 1 A GLY 40 ? A GLY 13 14 1 Y 1 A GLU 41 ? A GLU 14 15 1 Y 1 A GLN 42 ? A GLN 15 16 1 Y 1 A GLU 43 ? A GLU 16 17 1 Y 1 A LEU 44 ? A LEU 17 18 1 Y 1 A ASP 45 ? A ASP 18 19 1 Y 1 A LYS 46 ? A LYS 19 20 1 Y 1 A THR 47 ? A THR 20 21 1 Y 1 A THR 48 ? A THR 21 22 1 Y 1 A GLU 92 ? A GLU 65 23 1 Y 1 A ASP 93 ? A ASP 66 24 1 Y 1 A LYS 94 ? A LYS 67 25 1 Y 1 A PRO 95 ? A PRO 68 26 1 Y 1 A HIS 249 ? A HIS 222 27 1 Y 1 A GLN 250 ? A GLN 223 28 1 Y 1 A ASN 251 ? A ASN 224 29 1 Y 1 A ARG 252 ? A ARG 225 30 1 Y 1 A LEU 253 ? A LEU 226 31 1 Y 1 A GLU 278 ? A GLU 251 32 1 Y 1 A VAL 279 ? A VAL 252 33 1 Y 1 A LYS 280 ? A LYS 253 34 1 Y 1 A ILE 281 ? A ILE 254 35 1 Y 1 A PRO 282 ? A PRO 255 36 1 Y 1 A GLY 283 ? A GLY 256 37 1 Y 1 A SER 284 ? A SER 257 38 1 Y 1 A GLY 285 ? A GLY 258 39 1 Y 1 A TYR 286 ? A TYR 259 40 1 Y 1 A ILE 287 ? A ILE 260 41 1 Y 1 A SER 347 ? A SER 320 42 1 Y 1 A GLU 348 ? A GLU 321 43 1 Y 1 A LYS 349 ? A LYS 322 44 1 Y 1 A SER 350 ? A SER 323 45 1 Y 1 A MET 351 ? A MET 324 46 1 Y 1 A LEU 352 ? A LEU 325 47 1 Y 1 A ASN 353 ? A ASN 326 48 1 Y 1 A PHE 354 ? A PHE 327 49 1 Y 1 A ILE 355 ? A ILE 328 50 1 Y 1 A GLY 356 ? A GLY 329 51 1 Y 1 A ASP 430 ? A ASP 403 52 1 Y 1 A GLU 431 ? A GLU 404 53 1 Y 1 A LEU 432 ? A LEU 405 54 1 Y 1 A PHE 433 ? A PHE 406 55 1 Y 1 A ASP 434 ? A ASP 407 56 1 Y 1 A VAL 435 ? A VAL 408 57 1 Y 1 A PRO 436 ? A PRO 409 58 1 Y 1 A ASP 437 ? A ASP 410 59 1 Y 1 A ILE 438 ? A ILE 411 60 1 Y 1 A THR 439 ? A THR 412 61 1 Y 1 A GLY 440 ? A GLY 413 62 1 Y 1 A GLU 441 ? A GLU 414 63 1 Y 1 A GLU 442 ? A GLU 415 64 1 Y 1 A LEU 443 ? A LEU 416 65 1 Y 1 A ALA 444 ? A ALA 417 66 1 Y 1 A SER 445 ? A SER 418 67 1 Y 1 A LYS 446 ? A LYS 419 68 1 Y 1 A LYS 447 ? A LYS 420 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BA BA BA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _atom_sites.entry_id 5CQC _atom_sites.fract_transf_matrix[1][1] 0.004509 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.004509 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013786 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol BA C N O S # loop_