data_5CRE # _entry.id 5CRE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5CRE pdb_00005cre 10.2210/pdb5cre/pdb WWPDB D_1000212078 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5CRH unspecified PDB . 5CRD unspecified PDB . 5CRG unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5CRE _pdbx_database_status.recvd_initial_deposition_date 2015-07-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lewis, K.M.' 1 'Ronish, L.A.' 2 'Kang, C.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 290 _citation.language ? _citation.page_first 28665 _citation.page_last 28674 _citation.title 'Characterization of Two Human Skeletal Calsequestrin Mutants Implicated in Malignant Hyperthermia and Vacuolar Aggregate Myopathy.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M115.686261 _citation.pdbx_database_id_PubMed 26416891 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lewis, K.M.' 1 ? primary 'Ronish, L.A.' 2 ? primary 'Rios, E.' 3 ? primary 'Kang, C.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5CRE _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.106 _cell.length_a_esd ? _cell.length_b 82.815 _cell.length_b_esd ? _cell.length_c 89.269 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5CRE _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Calsequestrin-1 41664.543 1 ? D210G 'residues 35-396' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Calmitine,Calsequestrin,skeletal muscle isoform' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QEGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKD AAVAKKLGLTEVDSMYVFKGDEVIEYDGEFSADTIVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKSKDSEHY KAFEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPGKPNSEEEIVNFVEEHRRSTLRKLKPESMYE TWEDDMDGIHIVAFAEEADPDGFEFLETLKAVAQDNTENPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDA DSVWMEMDDEEDLPSAEELEDWLEDVLEGEINTEDDDDDDDD ; _entity_poly.pdbx_seq_one_letter_code_can ;QEGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKD AAVAKKLGLTEVDSMYVFKGDEVIEYDGEFSADTIVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKSKDSEHY KAFEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPGKPNSEEEIVNFVEEHRRSTLRKLKPESMYE TWEDDMDGIHIVAFAEEADPDGFEFLETLKAVAQDNTENPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDA DSVWMEMDDEEDLPSAEELEDWLEDVLEGEINTEDDDDDDDD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 GLU n 1 3 GLY n 1 4 LEU n 1 5 ASP n 1 6 PHE n 1 7 PRO n 1 8 GLU n 1 9 TYR n 1 10 ASP n 1 11 GLY n 1 12 VAL n 1 13 ASP n 1 14 ARG n 1 15 VAL n 1 16 ILE n 1 17 ASN n 1 18 VAL n 1 19 ASN n 1 20 ALA n 1 21 LYS n 1 22 ASN n 1 23 TYR n 1 24 LYS n 1 25 ASN n 1 26 VAL n 1 27 PHE n 1 28 LYS n 1 29 LYS n 1 30 TYR n 1 31 GLU n 1 32 VAL n 1 33 LEU n 1 34 ALA n 1 35 LEU n 1 36 LEU n 1 37 TYR n 1 38 HIS n 1 39 GLU n 1 40 PRO n 1 41 PRO n 1 42 GLU n 1 43 ASP n 1 44 ASP n 1 45 LYS n 1 46 ALA n 1 47 SER n 1 48 GLN n 1 49 ARG n 1 50 GLN n 1 51 PHE n 1 52 GLU n 1 53 MET n 1 54 GLU n 1 55 GLU n 1 56 LEU n 1 57 ILE n 1 58 LEU n 1 59 GLU n 1 60 LEU n 1 61 ALA n 1 62 ALA n 1 63 GLN n 1 64 VAL n 1 65 LEU n 1 66 GLU n 1 67 ASP n 1 68 LYS n 1 69 GLY n 1 70 VAL n 1 71 GLY n 1 72 PHE n 1 73 GLY n 1 74 LEU n 1 75 VAL n 1 76 ASP n 1 77 SER n 1 78 GLU n 1 79 LYS n 1 80 ASP n 1 81 ALA n 1 82 ALA n 1 83 VAL n 1 84 ALA n 1 85 LYS n 1 86 LYS n 1 87 LEU n 1 88 GLY n 1 89 LEU n 1 90 THR n 1 91 GLU n 1 92 VAL n 1 93 ASP n 1 94 SER n 1 95 MET n 1 96 TYR n 1 97 VAL n 1 98 PHE n 1 99 LYS n 1 100 GLY n 1 101 ASP n 1 102 GLU n 1 103 VAL n 1 104 ILE n 1 105 GLU n 1 106 TYR n 1 107 ASP n 1 108 GLY n 1 109 GLU n 1 110 PHE n 1 111 SER n 1 112 ALA n 1 113 ASP n 1 114 THR n 1 115 ILE n 1 116 VAL n 1 117 GLU n 1 118 PHE n 1 119 LEU n 1 120 LEU n 1 121 ASP n 1 122 VAL n 1 123 LEU n 1 124 GLU n 1 125 ASP n 1 126 PRO n 1 127 VAL n 1 128 GLU n 1 129 LEU n 1 130 ILE n 1 131 GLU n 1 132 GLY n 1 133 GLU n 1 134 ARG n 1 135 GLU n 1 136 LEU n 1 137 GLN n 1 138 ALA n 1 139 PHE n 1 140 GLU n 1 141 ASN n 1 142 ILE n 1 143 GLU n 1 144 ASP n 1 145 GLU n 1 146 ILE n 1 147 LYS n 1 148 LEU n 1 149 ILE n 1 150 GLY n 1 151 TYR n 1 152 PHE n 1 153 LYS n 1 154 SER n 1 155 LYS n 1 156 ASP n 1 157 SER n 1 158 GLU n 1 159 HIS n 1 160 TYR n 1 161 LYS n 1 162 ALA n 1 163 PHE n 1 164 GLU n 1 165 ASP n 1 166 ALA n 1 167 ALA n 1 168 GLU n 1 169 GLU n 1 170 PHE n 1 171 HIS n 1 172 PRO n 1 173 TYR n 1 174 ILE n 1 175 PRO n 1 176 PHE n 1 177 PHE n 1 178 ALA n 1 179 THR n 1 180 PHE n 1 181 ASP n 1 182 SER n 1 183 LYS n 1 184 VAL n 1 185 ALA n 1 186 LYS n 1 187 LYS n 1 188 LEU n 1 189 THR n 1 190 LEU n 1 191 LYS n 1 192 LEU n 1 193 ASN n 1 194 GLU n 1 195 ILE n 1 196 ASP n 1 197 PHE n 1 198 TYR n 1 199 GLU n 1 200 ALA n 1 201 PHE n 1 202 MET n 1 203 GLU n 1 204 GLU n 1 205 PRO n 1 206 VAL n 1 207 THR n 1 208 ILE n 1 209 PRO n 1 210 GLY n 1 211 LYS n 1 212 PRO n 1 213 ASN n 1 214 SER n 1 215 GLU n 1 216 GLU n 1 217 GLU n 1 218 ILE n 1 219 VAL n 1 220 ASN n 1 221 PHE n 1 222 VAL n 1 223 GLU n 1 224 GLU n 1 225 HIS n 1 226 ARG n 1 227 ARG n 1 228 SER n 1 229 THR n 1 230 LEU n 1 231 ARG n 1 232 LYS n 1 233 LEU n 1 234 LYS n 1 235 PRO n 1 236 GLU n 1 237 SER n 1 238 MET n 1 239 TYR n 1 240 GLU n 1 241 THR n 1 242 TRP n 1 243 GLU n 1 244 ASP n 1 245 ASP n 1 246 MET n 1 247 ASP n 1 248 GLY n 1 249 ILE n 1 250 HIS n 1 251 ILE n 1 252 VAL n 1 253 ALA n 1 254 PHE n 1 255 ALA n 1 256 GLU n 1 257 GLU n 1 258 ALA n 1 259 ASP n 1 260 PRO n 1 261 ASP n 1 262 GLY n 1 263 PHE n 1 264 GLU n 1 265 PHE n 1 266 LEU n 1 267 GLU n 1 268 THR n 1 269 LEU n 1 270 LYS n 1 271 ALA n 1 272 VAL n 1 273 ALA n 1 274 GLN n 1 275 ASP n 1 276 ASN n 1 277 THR n 1 278 GLU n 1 279 ASN n 1 280 PRO n 1 281 ASP n 1 282 LEU n 1 283 SER n 1 284 ILE n 1 285 ILE n 1 286 TRP n 1 287 ILE n 1 288 ASP n 1 289 PRO n 1 290 ASP n 1 291 ASP n 1 292 PHE n 1 293 PRO n 1 294 LEU n 1 295 LEU n 1 296 VAL n 1 297 PRO n 1 298 TYR n 1 299 TRP n 1 300 GLU n 1 301 LYS n 1 302 THR n 1 303 PHE n 1 304 ASP n 1 305 ILE n 1 306 ASP n 1 307 LEU n 1 308 SER n 1 309 ALA n 1 310 PRO n 1 311 GLN n 1 312 ILE n 1 313 GLY n 1 314 VAL n 1 315 VAL n 1 316 ASN n 1 317 VAL n 1 318 THR n 1 319 ASP n 1 320 ALA n 1 321 ASP n 1 322 SER n 1 323 VAL n 1 324 TRP n 1 325 MET n 1 326 GLU n 1 327 MET n 1 328 ASP n 1 329 ASP n 1 330 GLU n 1 331 GLU n 1 332 ASP n 1 333 LEU n 1 334 PRO n 1 335 SER n 1 336 ALA n 1 337 GLU n 1 338 GLU n 1 339 LEU n 1 340 GLU n 1 341 ASP n 1 342 TRP n 1 343 LEU n 1 344 GLU n 1 345 ASP n 1 346 VAL n 1 347 LEU n 1 348 GLU n 1 349 GLY n 1 350 GLU n 1 351 ILE n 1 352 ASN n 1 353 THR n 1 354 GLU n 1 355 ASP n 1 356 ASP n 1 357 ASP n 1 358 ASP n 1 359 ASP n 1 360 ASP n 1 361 ASP n 1 362 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 362 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CASQ1, CASQ' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.db_code CASQ1_HUMAN _struct_ref.db_name UNP _struct_ref.details ? _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.seq_align ? _struct_ref.seq_dif ? _struct_ref.pdbx_db_accession P31415 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ;QEGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKD AAVAKKLGLTEVDSMYVFKGDEVIEYDGEFSADTIVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKSKDSEHY KAFEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYE TWEDDMDGIHIVAFAEEADPDGFEFLETLKAVAQDNTENPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDA DSVWMEMDDEEDLPSAEELEDWLEDVLEGEINTEDDDDDDDD ; _struct_ref.pdbx_align_begin 35 _struct_ref.pdbx_align_end ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5CRE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 362 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P31415 _struct_ref_seq.db_align_beg 35 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 396 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 362 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5CRE _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 210 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P31415 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 244 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 210 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5CRE _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.05 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MOPS, 27.5 % (v/v) 2-methyl-2,4-pentanediol, 0.2 M NaCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-02-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5CRE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.315 _reflns.d_resolution_low 44.716 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7649 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.62 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 31.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5CRE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.315 _refine.ls_d_res_low 44.716 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7649 _refine.ls_number_reflns_R_free 767 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.62 _refine.ls_percent_reflns_R_free 10.03 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2531 _refine.ls_R_factor_R_free 0.2904 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2488 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5CRD _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.61 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.37 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2682 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2700 _refine_hist.d_res_high 3.315 _refine_hist.d_res_low 44.716 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2756 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.513 ? 3763 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.059 ? 1639 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.041 ? 418 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 505 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.3151 3.5709 . . 147 1322 99.00 . . . 0.3221 . 0.2906 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5709 3.9301 . . 154 1356 100.00 . . . 0.3574 . 0.2934 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9301 4.4983 . . 146 1366 100.00 . . . 0.3019 . 0.2569 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4983 5.6656 . . 158 1372 100.00 . . . 0.2792 . 0.2436 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.6656 44.7197 . . 162 1466 99.00 . . . 0.2558 . 0.2208 . . . . . . . . . . # _struct.entry_id 5CRE _struct.title 'Human skeletal calsequestrin, D210G mutant low-calcium complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5CRE _struct_keywords.text 'Calsequestrin Calcium-binding protein, Calcium binding protein' _struct_keywords.pdbx_keywords 'Calcium binding protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 22 ? LYS A 28 ? ASN A 22 LYS A 28 1 ? 7 HELX_P HELX_P2 AA2 ASP A 44 ? LEU A 65 ? ASP A 44 LEU A 65 1 ? 22 HELX_P HELX_P3 AA3 ASP A 80 ? LEU A 87 ? ASP A 80 LEU A 87 1 ? 8 HELX_P HELX_P4 AA4 SER A 111 ? GLU A 124 ? SER A 111 GLU A 124 1 ? 14 HELX_P HELX_P5 AA5 GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9 HELX_P HELX_P6 AA6 SER A 157 ? GLU A 169 ? SER A 157 GLU A 169 1 ? 13 HELX_P HELX_P7 AA7 ASP A 181 ? LYS A 186 ? ASP A 181 LYS A 186 1 ? 6 HELX_P HELX_P8 AA8 SER A 214 ? ARG A 226 ? SER A 214 ARG A 226 1 ? 13 HELX_P HELX_P9 AA9 LYS A 234 ? GLU A 236 ? LYS A 234 GLU A 236 5 ? 3 HELX_P HELX_P10 AB1 SER A 237 ? ASP A 244 ? SER A 237 ASP A 244 1 ? 8 HELX_P HELX_P11 AB2 ASP A 259 ? ASN A 276 ? ASP A 259 ASN A 276 1 ? 18 HELX_P HELX_P12 AB3 ASP A 288 ? PHE A 292 ? ASP A 288 PHE A 292 5 ? 5 HELX_P HELX_P13 AB4 LEU A 295 ? ASP A 304 ? LEU A 295 ASP A 304 1 ? 10 HELX_P HELX_P14 AB5 SER A 335 ? GLU A 344 ? SER A 335 GLU A 344 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASN 17 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 17 A CA 401 1_555 ? ? ? ? ? ? ? 2.384 ? ? metalc2 metalc ? ? A VAL 18 O ? ? ? 1_555 B CA . CA ? ? A VAL 18 A CA 401 1_555 ? ? ? ? ? ? ? 2.551 ? ? metalc3 metalc ? ? A ASP 80 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 80 A CA 401 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc4 metalc ? ? A ASP 80 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 80 A CA 401 1_555 ? ? ? ? ? ? ? 2.450 ? ? metalc5 metalc ? ? A GLU 199 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 199 A CA 402 1_555 ? ? ? ? ? ? ? 2.500 ? ? metalc6 metalc ? ? A GLU 199 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 199 A CA 402 1_555 ? ? ? ? ? ? ? 2.877 ? ? metalc7 metalc ? ? A THR 229 OG1 ? ? ? 1_555 C CA . CA ? ? A THR 229 A CA 402 1_555 ? ? ? ? ? ? ? 2.525 ? ? metalc8 metalc ? ? A THR 277 OG1 ? ? ? 1_555 C CA . CA ? ? A THR 277 A CA 402 1_555 ? ? ? ? ? ? ? 2.784 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 HIS 171 A . ? HIS 171 A PRO 172 A ? PRO 172 A 1 -6.56 2 LYS 211 A . ? LYS 211 A PRO 212 A ? PRO 212 A 1 -0.39 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 16 ? ASN A 17 ? ILE A 16 ASN A 17 AA1 2 VAL A 70 ? ASP A 76 ? VAL A 70 ASP A 76 AA1 3 VAL A 32 ? HIS A 38 ? VAL A 32 HIS A 38 AA1 4 SER A 94 ? LYS A 99 ? SER A 94 LYS A 99 AA1 5 GLU A 102 ? TYR A 106 ? GLU A 102 TYR A 106 AA2 1 VAL A 127 ? ILE A 130 ? VAL A 127 ILE A 130 AA2 2 PHE A 176 ? THR A 179 ? PHE A 176 THR A 179 AA2 3 LYS A 147 ? TYR A 151 ? LYS A 147 TYR A 151 AA2 4 GLU A 194 ? TYR A 198 ? GLU A 194 TYR A 198 AA2 5 VAL A 206 ? THR A 207 ? VAL A 206 THR A 207 AA3 1 LEU A 230 ? LYS A 232 ? LEU A 230 LYS A 232 AA3 2 ILE A 284 ? ILE A 287 ? ILE A 284 ILE A 287 AA3 3 ILE A 249 ? PHE A 254 ? ILE A 249 PHE A 254 AA3 4 GLN A 311 ? ASN A 316 ? GLN A 311 ASN A 316 AA3 5 ASP A 321 ? TRP A 324 ? ASP A 321 TRP A 324 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 16 ? N ILE A 16 O PHE A 72 ? O PHE A 72 AA1 2 3 O GLY A 71 ? O GLY A 71 N ALA A 34 ? N ALA A 34 AA1 3 4 N LEU A 35 ? N LEU A 35 O TYR A 96 ? O TYR A 96 AA1 4 5 N VAL A 97 ? N VAL A 97 O ILE A 104 ? O ILE A 104 AA2 1 2 N GLU A 128 ? N GLU A 128 O PHE A 176 ? O PHE A 176 AA2 2 3 O THR A 179 ? O THR A 179 N GLY A 150 ? N GLY A 150 AA2 3 4 N LYS A 147 ? N LYS A 147 O TYR A 198 ? O TYR A 198 AA2 4 5 N PHE A 197 ? N PHE A 197 O VAL A 206 ? O VAL A 206 AA3 1 2 N ARG A 231 ? N ARG A 231 O TRP A 286 ? O TRP A 286 AA3 2 3 O ILE A 285 ? O ILE A 285 N ILE A 251 ? N ILE A 251 AA3 3 4 N PHE A 254 ? N PHE A 254 O GLN A 311 ? O GLN A 311 AA3 4 5 N ASN A 316 ? N ASN A 316 O ASP A 321 ? O ASP A 321 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 401 ? 3 'binding site for residue CA A 401' AC2 Software A CA 402 ? 3 'binding site for residue CA A 402' AC3 Software A MPD 403 ? 4 'binding site for residue MPD A 403' AC4 Software A MPD 404 ? 5 'binding site for residue MPD A 404' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ASN A 17 ? ASN A 17 . ? 1_555 ? 2 AC1 3 VAL A 18 ? VAL A 18 . ? 1_555 ? 3 AC1 3 ASP A 80 ? ASP A 80 . ? 1_555 ? 4 AC2 3 GLU A 199 ? GLU A 199 . ? 1_555 ? 5 AC2 3 THR A 229 ? THR A 229 . ? 1_555 ? 6 AC2 3 THR A 277 ? THR A 277 . ? 1_555 ? 7 AC3 4 PRO A 7 ? PRO A 7 . ? 2_555 ? 8 AC3 4 GLU A 8 ? GLU A 8 . ? 2_555 ? 9 AC3 4 TYR A 9 ? TYR A 9 . ? 2_555 ? 10 AC3 4 LEU A 295 ? LEU A 295 . ? 1_555 ? 11 AC4 5 LEU A 233 ? LEU A 233 . ? 1_555 ? 12 AC4 5 MET A 238 ? MET A 238 . ? 1_555 ? 13 AC4 5 TRP A 242 ? TRP A 242 . ? 1_555 ? 14 AC4 5 TYR A 298 ? TYR A 298 . ? 1_555 ? 15 AC4 5 TRP A 299 ? TRP A 299 . ? 1_555 ? # _atom_sites.entry_id 5CRE _atom_sites.fract_transf_matrix[1][1] 0.015127 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012075 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011202 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 PHE 163 163 163 PHE PHE A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 HIS 171 171 171 HIS HIS A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 TYR 173 173 173 TYR TYR A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 PHE 180 180 180 PHE PHE A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 ILE 195 195 195 ILE ILE A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 PHE 197 197 197 PHE PHE A . n A 1 198 TYR 198 198 198 TYR TYR A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 MET 202 202 202 MET MET A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 THR 207 207 207 THR THR A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 PRO 212 212 212 PRO PRO A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 ASN 220 220 220 ASN ASN A . n A 1 221 PHE 221 221 221 PHE PHE A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 HIS 225 225 225 HIS HIS A . n A 1 226 ARG 226 226 226 ARG ARG A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 SER 228 228 228 SER SER A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 ARG 231 231 231 ARG ARG A . n A 1 232 LYS 232 232 232 LYS LYS A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 LYS 234 234 234 LYS LYS A . n A 1 235 PRO 235 235 235 PRO PRO A . n A 1 236 GLU 236 236 236 GLU GLU A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 MET 238 238 238 MET MET A . n A 1 239 TYR 239 239 239 TYR TYR A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 THR 241 241 241 THR THR A . n A 1 242 TRP 242 242 242 TRP TRP A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 ASP 244 244 244 ASP ASP A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 MET 246 246 246 MET MET A . n A 1 247 ASP 247 247 247 ASP ASP A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 HIS 250 250 250 HIS HIS A . n A 1 251 ILE 251 251 251 ILE ILE A . n A 1 252 VAL 252 252 252 VAL VAL A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 PHE 254 254 254 PHE PHE A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 GLU 256 256 256 GLU GLU A . n A 1 257 GLU 257 257 257 GLU GLU A . n A 1 258 ALA 258 258 258 ALA ALA A . n A 1 259 ASP 259 259 259 ASP ASP A . n A 1 260 PRO 260 260 260 PRO PRO A . n A 1 261 ASP 261 261 261 ASP ASP A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 PHE 263 263 263 PHE PHE A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 PHE 265 265 265 PHE PHE A . n A 1 266 LEU 266 266 266 LEU LEU A . n A 1 267 GLU 267 267 267 GLU GLU A . n A 1 268 THR 268 268 268 THR THR A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 LYS 270 270 270 LYS LYS A . n A 1 271 ALA 271 271 271 ALA ALA A . n A 1 272 VAL 272 272 272 VAL VAL A . n A 1 273 ALA 273 273 273 ALA ALA A . n A 1 274 GLN 274 274 274 GLN GLN A . n A 1 275 ASP 275 275 275 ASP ASP A . n A 1 276 ASN 276 276 276 ASN ASN A . n A 1 277 THR 277 277 277 THR THR A . n A 1 278 GLU 278 278 278 GLU GLU A . n A 1 279 ASN 279 279 279 ASN ASN A . n A 1 280 PRO 280 280 280 PRO PRO A . n A 1 281 ASP 281 281 281 ASP ASP A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 SER 283 283 283 SER SER A . n A 1 284 ILE 284 284 284 ILE ILE A . n A 1 285 ILE 285 285 285 ILE ILE A . n A 1 286 TRP 286 286 286 TRP TRP A . n A 1 287 ILE 287 287 287 ILE ILE A . n A 1 288 ASP 288 288 288 ASP ASP A . n A 1 289 PRO 289 289 289 PRO PRO A . n A 1 290 ASP 290 290 290 ASP ASP A . n A 1 291 ASP 291 291 291 ASP ASP A . n A 1 292 PHE 292 292 292 PHE PHE A . n A 1 293 PRO 293 293 293 PRO PRO A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 VAL 296 296 296 VAL VAL A . n A 1 297 PRO 297 297 297 PRO PRO A . n A 1 298 TYR 298 298 298 TYR TYR A . n A 1 299 TRP 299 299 299 TRP TRP A . n A 1 300 GLU 300 300 300 GLU GLU A . n A 1 301 LYS 301 301 301 LYS LYS A . n A 1 302 THR 302 302 302 THR THR A . n A 1 303 PHE 303 303 303 PHE PHE A . n A 1 304 ASP 304 304 304 ASP ASP A . n A 1 305 ILE 305 305 305 ILE ILE A . n A 1 306 ASP 306 306 306 ASP ASP A . n A 1 307 LEU 307 307 307 LEU LEU A . n A 1 308 SER 308 308 308 SER SER A . n A 1 309 ALA 309 309 309 ALA ALA A . n A 1 310 PRO 310 310 310 PRO PRO A . n A 1 311 GLN 311 311 311 GLN GLN A . n A 1 312 ILE 312 312 312 ILE ILE A . n A 1 313 GLY 313 313 313 GLY GLY A . n A 1 314 VAL 314 314 314 VAL VAL A . n A 1 315 VAL 315 315 315 VAL VAL A . n A 1 316 ASN 316 316 316 ASN ASN A . n A 1 317 VAL 317 317 317 VAL VAL A . n A 1 318 THR 318 318 318 THR THR A . n A 1 319 ASP 319 319 319 ASP ASP A . n A 1 320 ALA 320 320 320 ALA ALA A . n A 1 321 ASP 321 321 321 ASP ASP A . n A 1 322 SER 322 322 322 SER SER A . n A 1 323 VAL 323 323 323 VAL VAL A . n A 1 324 TRP 324 324 324 TRP TRP A . n A 1 325 MET 325 325 325 MET MET A . n A 1 326 GLU 326 326 326 GLU GLU A . n A 1 327 MET 327 327 327 MET MET A . n A 1 328 ASP 328 328 328 ASP ASP A . n A 1 329 ASP 329 329 329 ASP ASP A . n A 1 330 GLU 330 330 330 GLU GLU A . n A 1 331 GLU 331 331 331 GLU GLU A . n A 1 332 ASP 332 332 332 ASP ASP A . n A 1 333 LEU 333 333 333 LEU LEU A . n A 1 334 PRO 334 334 334 PRO PRO A . n A 1 335 SER 335 335 335 SER SER A . n A 1 336 ALA 336 336 336 ALA ALA A . n A 1 337 GLU 337 337 337 GLU GLU A . n A 1 338 GLU 338 338 338 GLU GLU A . n A 1 339 LEU 339 339 339 LEU LEU A . n A 1 340 GLU 340 340 340 GLU GLU A . n A 1 341 ASP 341 341 341 ASP ASP A . n A 1 342 TRP 342 342 342 TRP TRP A . n A 1 343 LEU 343 343 343 LEU LEU A . n A 1 344 GLU 344 344 344 GLU GLU A . n A 1 345 ASP 345 345 345 ASP ASP A . n A 1 346 VAL 346 346 346 VAL VAL A . n A 1 347 LEU 347 347 347 LEU LEU A . n A 1 348 GLU 348 348 348 GLU GLU A . n A 1 349 GLY 349 349 349 GLY GLY A . n A 1 350 GLU 350 350 ? ? ? A . n A 1 351 ILE 351 351 ? ? ? A . n A 1 352 ASN 352 352 ? ? ? A . n A 1 353 THR 353 353 ? ? ? A . n A 1 354 GLU 354 354 ? ? ? A . n A 1 355 ASP 355 355 ? ? ? A . n A 1 356 ASP 356 356 ? ? ? A . n A 1 357 ASP 357 357 ? ? ? A . n A 1 358 ASP 358 358 ? ? ? A . n A 1 359 ASP 359 359 ? ? ? A . n A 1 360 ASP 360 360 ? ? ? A . n A 1 361 ASP 361 361 ? ? ? A . n A 1 362 ASP 362 362 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 401 1 CA CA A . C 2 CA 1 402 2 CA CA A . D 3 MPD 1 403 1 MPD MPD A . E 3 MPD 1 404 2 MPD MPD A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6220 ? 1 MORE -124 ? 1 'SSA (A^2)' 33940 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASN 17 ? A ASN 17 ? 1_555 CA ? B CA . ? A CA 401 ? 1_555 O ? A VAL 18 ? A VAL 18 ? 1_555 87.4 ? 2 OD1 ? A ASN 17 ? A ASN 17 ? 1_555 CA ? B CA . ? A CA 401 ? 1_555 OD1 ? A ASP 80 ? A ASP 80 ? 1_555 160.8 ? 3 O ? A VAL 18 ? A VAL 18 ? 1_555 CA ? B CA . ? A CA 401 ? 1_555 OD1 ? A ASP 80 ? A ASP 80 ? 1_555 77.9 ? 4 OD1 ? A ASN 17 ? A ASN 17 ? 1_555 CA ? B CA . ? A CA 401 ? 1_555 OD2 ? A ASP 80 ? A ASP 80 ? 1_555 108.5 ? 5 O ? A VAL 18 ? A VAL 18 ? 1_555 CA ? B CA . ? A CA 401 ? 1_555 OD2 ? A ASP 80 ? A ASP 80 ? 1_555 69.4 ? 6 OD1 ? A ASP 80 ? A ASP 80 ? 1_555 CA ? B CA . ? A CA 401 ? 1_555 OD2 ? A ASP 80 ? A ASP 80 ? 1_555 54.8 ? 7 OE1 ? A GLU 199 ? A GLU 199 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 OE2 ? A GLU 199 ? A GLU 199 ? 1_555 47.5 ? 8 OE1 ? A GLU 199 ? A GLU 199 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 OG1 ? A THR 229 ? A THR 229 ? 1_555 118.2 ? 9 OE2 ? A GLU 199 ? A GLU 199 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 OG1 ? A THR 229 ? A THR 229 ? 1_555 70.8 ? 10 OE1 ? A GLU 199 ? A GLU 199 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 OG1 ? A THR 277 ? A THR 277 ? 1_555 94.4 ? 11 OE2 ? A GLU 199 ? A GLU 199 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 OG1 ? A THR 277 ? A THR 277 ? 1_555 87.0 ? 12 OG1 ? A THR 229 ? A THR 229 ? 1_555 CA ? C CA . ? A CA 402 ? 1_555 OG1 ? A THR 277 ? A THR 277 ? 1_555 83.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-10-07 2 'Structure model' 1 1 2015-10-28 3 'Structure model' 1 2 2015-12-09 4 'Structure model' 1 3 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' citation 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10-2152_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 8.1 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9-1692 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 68 ? ? -68.93 7.54 2 1 ASP A 107 ? ? -142.69 40.57 3 1 PHE A 110 ? ? -101.73 69.56 4 1 LYS A 191 ? ? -82.30 -158.39 5 1 PRO A 205 ? ? -75.88 -167.99 6 1 SER A 237 ? ? -147.92 24.28 7 1 MET A 325 ? ? -59.05 109.16 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 5 ? CG ? A ASP 5 CG 2 1 Y 1 A ASP 5 ? OD1 ? A ASP 5 OD1 3 1 Y 1 A ASP 5 ? OD2 ? A ASP 5 OD2 4 1 Y 1 A PHE 6 ? CG ? A PHE 6 CG 5 1 Y 1 A PHE 6 ? CD1 ? A PHE 6 CD1 6 1 Y 1 A PHE 6 ? CD2 ? A PHE 6 CD2 7 1 Y 1 A PHE 6 ? CE1 ? A PHE 6 CE1 8 1 Y 1 A PHE 6 ? CE2 ? A PHE 6 CE2 9 1 Y 1 A PHE 6 ? CZ ? A PHE 6 CZ 10 1 Y 1 A GLU 39 ? CG ? A GLU 39 CG 11 1 Y 1 A GLU 39 ? CD ? A GLU 39 CD 12 1 Y 1 A GLU 39 ? OE1 ? A GLU 39 OE1 13 1 Y 1 A GLU 39 ? OE2 ? A GLU 39 OE2 14 1 Y 1 A LYS 45 ? CG ? A LYS 45 CG 15 1 Y 1 A LYS 45 ? CD ? A LYS 45 CD 16 1 Y 1 A LYS 45 ? CE ? A LYS 45 CE 17 1 Y 1 A LYS 45 ? NZ ? A LYS 45 NZ 18 1 Y 1 A LYS 85 ? CG ? A LYS 85 CG 19 1 Y 1 A LYS 85 ? CD ? A LYS 85 CD 20 1 Y 1 A LYS 85 ? CE ? A LYS 85 CE 21 1 Y 1 A LYS 85 ? NZ ? A LYS 85 NZ 22 1 Y 1 A ARG 134 ? CG ? A ARG 134 CG 23 1 Y 1 A ARG 134 ? CD ? A ARG 134 CD 24 1 Y 1 A ARG 134 ? NE ? A ARG 134 NE 25 1 Y 1 A ARG 134 ? CZ ? A ARG 134 CZ 26 1 Y 1 A ARG 134 ? NH1 ? A ARG 134 NH1 27 1 Y 1 A ARG 134 ? NH2 ? A ARG 134 NH2 28 1 Y 1 A LEU 136 ? CG ? A LEU 136 CG 29 1 Y 1 A LEU 136 ? CD1 ? A LEU 136 CD1 30 1 Y 1 A LEU 136 ? CD2 ? A LEU 136 CD2 31 1 Y 1 A LYS 147 ? CG ? A LYS 147 CG 32 1 Y 1 A LYS 147 ? CD ? A LYS 147 CD 33 1 Y 1 A LYS 147 ? CE ? A LYS 147 CE 34 1 Y 1 A LYS 147 ? NZ ? A LYS 147 NZ 35 1 Y 1 A TYR 151 ? CG ? A TYR 151 CG 36 1 Y 1 A TYR 151 ? CD1 ? A TYR 151 CD1 37 1 Y 1 A TYR 151 ? CD2 ? A TYR 151 CD2 38 1 Y 1 A TYR 151 ? CE1 ? A TYR 151 CE1 39 1 Y 1 A TYR 151 ? CE2 ? A TYR 151 CE2 40 1 Y 1 A TYR 151 ? CZ ? A TYR 151 CZ 41 1 Y 1 A TYR 151 ? OH ? A TYR 151 OH 42 1 Y 1 A LYS 153 ? CG ? A LYS 153 CG 43 1 Y 1 A LYS 153 ? CD ? A LYS 153 CD 44 1 Y 1 A LYS 153 ? CE ? A LYS 153 CE 45 1 Y 1 A LYS 153 ? NZ ? A LYS 153 NZ 46 1 Y 1 A LYS 155 ? CG ? A LYS 155 CG 47 1 Y 1 A LYS 155 ? CD ? A LYS 155 CD 48 1 Y 1 A LYS 155 ? CE ? A LYS 155 CE 49 1 Y 1 A LYS 155 ? NZ ? A LYS 155 NZ 50 1 Y 1 A HIS 159 ? CG ? A HIS 159 CG 51 1 Y 1 A HIS 159 ? ND1 ? A HIS 159 ND1 52 1 Y 1 A HIS 159 ? CD2 ? A HIS 159 CD2 53 1 Y 1 A HIS 159 ? CE1 ? A HIS 159 CE1 54 1 Y 1 A HIS 159 ? NE2 ? A HIS 159 NE2 55 1 Y 1 A TYR 160 ? CG ? A TYR 160 CG 56 1 Y 1 A TYR 160 ? CD1 ? A TYR 160 CD1 57 1 Y 1 A TYR 160 ? CD2 ? A TYR 160 CD2 58 1 Y 1 A TYR 160 ? CE1 ? A TYR 160 CE1 59 1 Y 1 A TYR 160 ? CE2 ? A TYR 160 CE2 60 1 Y 1 A TYR 160 ? CZ ? A TYR 160 CZ 61 1 Y 1 A TYR 160 ? OH ? A TYR 160 OH 62 1 Y 1 A LYS 161 ? CG ? A LYS 161 CG 63 1 Y 1 A LYS 161 ? CD ? A LYS 161 CD 64 1 Y 1 A LYS 161 ? CE ? A LYS 161 CE 65 1 Y 1 A LYS 161 ? NZ ? A LYS 161 NZ 66 1 Y 1 A LYS 183 ? CG ? A LYS 183 CG 67 1 Y 1 A LYS 183 ? CD ? A LYS 183 CD 68 1 Y 1 A LYS 183 ? CE ? A LYS 183 CE 69 1 Y 1 A LYS 183 ? NZ ? A LYS 183 NZ 70 1 Y 1 A LYS 186 ? CG ? A LYS 186 CG 71 1 Y 1 A LYS 186 ? CD ? A LYS 186 CD 72 1 Y 1 A LYS 186 ? CE ? A LYS 186 CE 73 1 Y 1 A LYS 186 ? NZ ? A LYS 186 NZ 74 1 Y 1 A LEU 188 ? CG ? A LEU 188 CG 75 1 Y 1 A LEU 188 ? CD1 ? A LEU 188 CD1 76 1 Y 1 A LEU 188 ? CD2 ? A LEU 188 CD2 77 1 Y 1 A LEU 190 ? CG ? A LEU 190 CG 78 1 Y 1 A LEU 190 ? CD1 ? A LEU 190 CD1 79 1 Y 1 A LEU 190 ? CD2 ? A LEU 190 CD2 80 1 Y 1 A LYS 191 ? CG ? A LYS 191 CG 81 1 Y 1 A LYS 191 ? CD ? A LYS 191 CD 82 1 Y 1 A LYS 191 ? CE ? A LYS 191 CE 83 1 Y 1 A LYS 191 ? NZ ? A LYS 191 NZ 84 1 Y 1 A GLU 194 ? CG ? A GLU 194 CG 85 1 Y 1 A GLU 194 ? CD ? A GLU 194 CD 86 1 Y 1 A GLU 194 ? OE1 ? A GLU 194 OE1 87 1 Y 1 A GLU 194 ? OE2 ? A GLU 194 OE2 88 1 Y 1 A ILE 208 ? CG1 ? A ILE 208 CG1 89 1 Y 1 A ILE 208 ? CG2 ? A ILE 208 CG2 90 1 Y 1 A ILE 208 ? CD1 ? A ILE 208 CD1 91 1 Y 1 A LYS 211 ? CG ? A LYS 211 CG 92 1 Y 1 A LYS 211 ? CD ? A LYS 211 CD 93 1 Y 1 A LYS 211 ? CE ? A LYS 211 CE 94 1 Y 1 A LYS 211 ? NZ ? A LYS 211 NZ 95 1 Y 1 A GLU 217 ? CG ? A GLU 217 CG 96 1 Y 1 A GLU 217 ? CD ? A GLU 217 CD 97 1 Y 1 A GLU 217 ? OE1 ? A GLU 217 OE1 98 1 Y 1 A GLU 217 ? OE2 ? A GLU 217 OE2 99 1 Y 1 A GLU 224 ? CG ? A GLU 224 CG 100 1 Y 1 A GLU 224 ? CD ? A GLU 224 CD 101 1 Y 1 A GLU 224 ? OE1 ? A GLU 224 OE1 102 1 Y 1 A GLU 224 ? OE2 ? A GLU 224 OE2 103 1 Y 1 A PHE 263 ? CG ? A PHE 263 CG 104 1 Y 1 A PHE 263 ? CD1 ? A PHE 263 CD1 105 1 Y 1 A PHE 263 ? CD2 ? A PHE 263 CD2 106 1 Y 1 A PHE 263 ? CE1 ? A PHE 263 CE1 107 1 Y 1 A PHE 263 ? CE2 ? A PHE 263 CE2 108 1 Y 1 A PHE 263 ? CZ ? A PHE 263 CZ 109 1 Y 1 A LYS 270 ? CG ? A LYS 270 CG 110 1 Y 1 A LYS 270 ? CD ? A LYS 270 CD 111 1 Y 1 A LYS 270 ? CE ? A LYS 270 CE 112 1 Y 1 A LYS 270 ? NZ ? A LYS 270 NZ 113 1 Y 1 A GLU 278 ? CG ? A GLU 278 CG 114 1 Y 1 A GLU 278 ? CD ? A GLU 278 CD 115 1 Y 1 A GLU 278 ? OE1 ? A GLU 278 OE1 116 1 Y 1 A GLU 278 ? OE2 ? A GLU 278 OE2 117 1 Y 1 A ASP 328 ? CG ? A ASP 328 CG 118 1 Y 1 A ASP 328 ? OD1 ? A ASP 328 OD1 119 1 Y 1 A ASP 328 ? OD2 ? A ASP 328 OD2 120 1 Y 1 A GLU 330 ? CG ? A GLU 330 CG 121 1 Y 1 A GLU 330 ? CD ? A GLU 330 CD 122 1 Y 1 A GLU 330 ? OE1 ? A GLU 330 OE1 123 1 Y 1 A GLU 330 ? OE2 ? A GLU 330 OE2 124 1 Y 1 A GLU 331 ? CG ? A GLU 331 CG 125 1 Y 1 A GLU 331 ? CD ? A GLU 331 CD 126 1 Y 1 A GLU 331 ? OE1 ? A GLU 331 OE1 127 1 Y 1 A GLU 331 ? OE2 ? A GLU 331 OE2 128 1 Y 1 A ASP 332 ? CG ? A ASP 332 CG 129 1 Y 1 A ASP 332 ? OD1 ? A ASP 332 OD1 130 1 Y 1 A ASP 332 ? OD2 ? A ASP 332 OD2 131 1 Y 1 A LEU 333 ? CG ? A LEU 333 CG 132 1 Y 1 A LEU 333 ? CD1 ? A LEU 333 CD1 133 1 Y 1 A LEU 333 ? CD2 ? A LEU 333 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 1 ? A GLN 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A GLU 350 ? A GLU 350 4 1 Y 1 A ILE 351 ? A ILE 351 5 1 Y 1 A ASN 352 ? A ASN 352 6 1 Y 1 A THR 353 ? A THR 353 7 1 Y 1 A GLU 354 ? A GLU 354 8 1 Y 1 A ASP 355 ? A ASP 355 9 1 Y 1 A ASP 356 ? A ASP 356 10 1 Y 1 A ASP 357 ? A ASP 357 11 1 Y 1 A ASP 358 ? A ASP 358 12 1 Y 1 A ASP 359 ? A ASP 359 13 1 Y 1 A ASP 360 ? A ASP 360 14 1 Y 1 A ASP 361 ? A ASP 361 15 1 Y 1 A ASP 362 ? A ASP 362 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 MPD C1 C N N 234 MPD C2 C N N 235 MPD O2 O N N 236 MPD CM C N N 237 MPD C3 C N N 238 MPD C4 C N S 239 MPD O4 O N N 240 MPD C5 C N N 241 MPD H11 H N N 242 MPD H12 H N N 243 MPD H13 H N N 244 MPD HO2 H N N 245 MPD HM1 H N N 246 MPD HM2 H N N 247 MPD HM3 H N N 248 MPD H31 H N N 249 MPD H32 H N N 250 MPD H4 H N N 251 MPD HO4 H N N 252 MPD H51 H N N 253 MPD H52 H N N 254 MPD H53 H N N 255 PHE N N N N 256 PHE CA C N S 257 PHE C C N N 258 PHE O O N N 259 PHE CB C N N 260 PHE CG C Y N 261 PHE CD1 C Y N 262 PHE CD2 C Y N 263 PHE CE1 C Y N 264 PHE CE2 C Y N 265 PHE CZ C Y N 266 PHE OXT O N N 267 PHE H H N N 268 PHE H2 H N N 269 PHE HA H N N 270 PHE HB2 H N N 271 PHE HB3 H N N 272 PHE HD1 H N N 273 PHE HD2 H N N 274 PHE HE1 H N N 275 PHE HE2 H N N 276 PHE HZ H N N 277 PHE HXT H N N 278 PRO N N N N 279 PRO CA C N S 280 PRO C C N N 281 PRO O O N N 282 PRO CB C N N 283 PRO CG C N N 284 PRO CD C N N 285 PRO OXT O N N 286 PRO H H N N 287 PRO HA H N N 288 PRO HB2 H N N 289 PRO HB3 H N N 290 PRO HG2 H N N 291 PRO HG3 H N N 292 PRO HD2 H N N 293 PRO HD3 H N N 294 PRO HXT H N N 295 SER N N N N 296 SER CA C N S 297 SER C C N N 298 SER O O N N 299 SER CB C N N 300 SER OG O N N 301 SER OXT O N N 302 SER H H N N 303 SER H2 H N N 304 SER HA H N N 305 SER HB2 H N N 306 SER HB3 H N N 307 SER HG H N N 308 SER HXT H N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TRP N N N N 327 TRP CA C N S 328 TRP C C N N 329 TRP O O N N 330 TRP CB C N N 331 TRP CG C Y N 332 TRP CD1 C Y N 333 TRP CD2 C Y N 334 TRP NE1 N Y N 335 TRP CE2 C Y N 336 TRP CE3 C Y N 337 TRP CZ2 C Y N 338 TRP CZ3 C Y N 339 TRP CH2 C Y N 340 TRP OXT O N N 341 TRP H H N N 342 TRP H2 H N N 343 TRP HA H N N 344 TRP HB2 H N N 345 TRP HB3 H N N 346 TRP HD1 H N N 347 TRP HE1 H N N 348 TRP HE3 H N N 349 TRP HZ2 H N N 350 TRP HZ3 H N N 351 TRP HH2 H N N 352 TRP HXT H N N 353 TYR N N N N 354 TYR CA C N S 355 TYR C C N N 356 TYR O O N N 357 TYR CB C N N 358 TYR CG C Y N 359 TYR CD1 C Y N 360 TYR CD2 C Y N 361 TYR CE1 C Y N 362 TYR CE2 C Y N 363 TYR CZ C Y N 364 TYR OH O N N 365 TYR OXT O N N 366 TYR H H N N 367 TYR H2 H N N 368 TYR HA H N N 369 TYR HB2 H N N 370 TYR HB3 H N N 371 TYR HD1 H N N 372 TYR HD2 H N N 373 TYR HE1 H N N 374 TYR HE2 H N N 375 TYR HH H N N 376 TYR HXT H N N 377 VAL N N N N 378 VAL CA C N S 379 VAL C C N N 380 VAL O O N N 381 VAL CB C N N 382 VAL CG1 C N N 383 VAL CG2 C N N 384 VAL OXT O N N 385 VAL H H N N 386 VAL H2 H N N 387 VAL HA H N N 388 VAL HB H N N 389 VAL HG11 H N N 390 VAL HG12 H N N 391 VAL HG13 H N N 392 VAL HG21 H N N 393 VAL HG22 H N N 394 VAL HG23 H N N 395 VAL HXT H N N 396 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 MPD C1 C2 sing N N 222 MPD C1 H11 sing N N 223 MPD C1 H12 sing N N 224 MPD C1 H13 sing N N 225 MPD C2 O2 sing N N 226 MPD C2 CM sing N N 227 MPD C2 C3 sing N N 228 MPD O2 HO2 sing N N 229 MPD CM HM1 sing N N 230 MPD CM HM2 sing N N 231 MPD CM HM3 sing N N 232 MPD C3 C4 sing N N 233 MPD C3 H31 sing N N 234 MPD C3 H32 sing N N 235 MPD C4 O4 sing N N 236 MPD C4 C5 sing N N 237 MPD C4 H4 sing N N 238 MPD O4 HO4 sing N N 239 MPD C5 H51 sing N N 240 MPD C5 H52 sing N N 241 MPD C5 H53 sing N N 242 PHE N CA sing N N 243 PHE N H sing N N 244 PHE N H2 sing N N 245 PHE CA C sing N N 246 PHE CA CB sing N N 247 PHE CA HA sing N N 248 PHE C O doub N N 249 PHE C OXT sing N N 250 PHE CB CG sing N N 251 PHE CB HB2 sing N N 252 PHE CB HB3 sing N N 253 PHE CG CD1 doub Y N 254 PHE CG CD2 sing Y N 255 PHE CD1 CE1 sing Y N 256 PHE CD1 HD1 sing N N 257 PHE CD2 CE2 doub Y N 258 PHE CD2 HD2 sing N N 259 PHE CE1 CZ doub Y N 260 PHE CE1 HE1 sing N N 261 PHE CE2 CZ sing Y N 262 PHE CE2 HE2 sing N N 263 PHE CZ HZ sing N N 264 PHE OXT HXT sing N N 265 PRO N CA sing N N 266 PRO N CD sing N N 267 PRO N H sing N N 268 PRO CA C sing N N 269 PRO CA CB sing N N 270 PRO CA HA sing N N 271 PRO C O doub N N 272 PRO C OXT sing N N 273 PRO CB CG sing N N 274 PRO CB HB2 sing N N 275 PRO CB HB3 sing N N 276 PRO CG CD sing N N 277 PRO CG HG2 sing N N 278 PRO CG HG3 sing N N 279 PRO CD HD2 sing N N 280 PRO CD HD3 sing N N 281 PRO OXT HXT sing N N 282 SER N CA sing N N 283 SER N H sing N N 284 SER N H2 sing N N 285 SER CA C sing N N 286 SER CA CB sing N N 287 SER CA HA sing N N 288 SER C O doub N N 289 SER C OXT sing N N 290 SER CB OG sing N N 291 SER CB HB2 sing N N 292 SER CB HB3 sing N N 293 SER OG HG sing N N 294 SER OXT HXT sing N N 295 THR N CA sing N N 296 THR N H sing N N 297 THR N H2 sing N N 298 THR CA C sing N N 299 THR CA CB sing N N 300 THR CA HA sing N N 301 THR C O doub N N 302 THR C OXT sing N N 303 THR CB OG1 sing N N 304 THR CB CG2 sing N N 305 THR CB HB sing N N 306 THR OG1 HG1 sing N N 307 THR CG2 HG21 sing N N 308 THR CG2 HG22 sing N N 309 THR CG2 HG23 sing N N 310 THR OXT HXT sing N N 311 TRP N CA sing N N 312 TRP N H sing N N 313 TRP N H2 sing N N 314 TRP CA C sing N N 315 TRP CA CB sing N N 316 TRP CA HA sing N N 317 TRP C O doub N N 318 TRP C OXT sing N N 319 TRP CB CG sing N N 320 TRP CB HB2 sing N N 321 TRP CB HB3 sing N N 322 TRP CG CD1 doub Y N 323 TRP CG CD2 sing Y N 324 TRP CD1 NE1 sing Y N 325 TRP CD1 HD1 sing N N 326 TRP CD2 CE2 doub Y N 327 TRP CD2 CE3 sing Y N 328 TRP NE1 CE2 sing Y N 329 TRP NE1 HE1 sing N N 330 TRP CE2 CZ2 sing Y N 331 TRP CE3 CZ3 doub Y N 332 TRP CE3 HE3 sing N N 333 TRP CZ2 CH2 doub Y N 334 TRP CZ2 HZ2 sing N N 335 TRP CZ3 CH2 sing Y N 336 TRP CZ3 HZ3 sing N N 337 TRP CH2 HH2 sing N N 338 TRP OXT HXT sing N N 339 TYR N CA sing N N 340 TYR N H sing N N 341 TYR N H2 sing N N 342 TYR CA C sing N N 343 TYR CA CB sing N N 344 TYR CA HA sing N N 345 TYR C O doub N N 346 TYR C OXT sing N N 347 TYR CB CG sing N N 348 TYR CB HB2 sing N N 349 TYR CB HB3 sing N N 350 TYR CG CD1 doub Y N 351 TYR CG CD2 sing Y N 352 TYR CD1 CE1 sing Y N 353 TYR CD1 HD1 sing N N 354 TYR CD2 CE2 doub Y N 355 TYR CD2 HD2 sing N N 356 TYR CE1 CZ doub Y N 357 TYR CE1 HE1 sing N N 358 TYR CE2 CZ sing Y N 359 TYR CE2 HE2 sing N N 360 TYR CZ OH sing N N 361 TYR OH HH sing N N 362 TYR OXT HXT sing N N 363 VAL N CA sing N N 364 VAL N H sing N N 365 VAL N H2 sing N N 366 VAL CA C sing N N 367 VAL CA CB sing N N 368 VAL CA HA sing N N 369 VAL C O doub N N 370 VAL C OXT sing N N 371 VAL CB CG1 sing N N 372 VAL CB CG2 sing N N 373 VAL CB HB sing N N 374 VAL CG1 HG11 sing N N 375 VAL CG1 HG12 sing N N 376 VAL CG1 HG13 sing N N 377 VAL CG2 HG21 sing N N 378 VAL CG2 HG22 sing N N 379 VAL CG2 HG23 sing N N 380 VAL OXT HXT sing N N 381 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5CRD _pdbx_initial_refinement_model.details ? #