data_5CUL # _entry.id 5CUL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5CUL WWPDB D_1000212214 # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 5CUK _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5CUL _pdbx_database_status.recvd_initial_deposition_date 2015-07-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bergeron, J.R.C.' 1 'Strynadka, N.C.J.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 291 _citation.language ? _citation.page_first 1676 _citation.page_last 1691 _citation.title 'The Structure of a Type 3 Secretion System (T3SS) Ruler Protein Suggests a Molecular Mechanism for Needle Length Sensing.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M115.684423 _citation.pdbx_database_id_PubMed 26589798 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Bergeron, J.R.' 1 primary 'Fernandez, L.' 2 primary 'Wasney, G.A.' 3 primary 'Vuckovic, M.' 4 primary 'Reffuveille, F.' 5 primary 'Hancock, R.E.' 6 primary 'Strynadka, N.C.' 7 # _cell.entry_id 5CUL _cell.length_a 68.570 _cell.length_b 68.570 _cell.length_c 61.210 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5CUL _symmetry.space_group_name_H-M 'P 64' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 172 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Translocation protein in type III secretion' 14434.555 2 ? ? ? ? 2 water nat water 18.015 6 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHEVKREYKEMEGSPEIKSKRRQFHQELQSSNLRADVRRSSVIVANPTHVAIGIRYRRGETPLPLVTLKHTDALALRVR RIAEEEGIPVLQRIPLARALLRDGNVDQYIPADLIQATAEVLRWLE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHEVKREYKEMEGSPEIKSKRRQFHQELQSSNLRADVRRSSVIVANPTHVAIGIRYRRGETPLPLVTLKHTDALALRVR RIAEEEGIPVLQRIPLARALLRDGNVDQYIPADLIQATAEVLRWLE ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 GLU n 1 5 VAL n 1 6 LYS n 1 7 ARG n 1 8 GLU n 1 9 TYR n 1 10 LYS n 1 11 GLU n 1 12 MET n 1 13 GLU n 1 14 GLY n 1 15 SER n 1 16 PRO n 1 17 GLU n 1 18 ILE n 1 19 LYS n 1 20 SER n 1 21 LYS n 1 22 ARG n 1 23 ARG n 1 24 GLN n 1 25 PHE n 1 26 HIS n 1 27 GLN n 1 28 GLU n 1 29 LEU n 1 30 GLN n 1 31 SER n 1 32 SER n 1 33 ASN n 1 34 LEU n 1 35 ARG n 1 36 ALA n 1 37 ASP n 1 38 VAL n 1 39 ARG n 1 40 ARG n 1 41 SER n 1 42 SER n 1 43 VAL n 1 44 ILE n 1 45 VAL n 1 46 ALA n 1 47 ASN n 1 48 PRO n 1 49 THR n 1 50 HIS n 1 51 VAL n 1 52 ALA n 1 53 ILE n 1 54 GLY n 1 55 ILE n 1 56 ARG n 1 57 TYR n 1 58 ARG n 1 59 ARG n 1 60 GLY n 1 61 GLU n 1 62 THR n 1 63 PRO n 1 64 LEU n 1 65 PRO n 1 66 LEU n 1 67 VAL n 1 68 THR n 1 69 LEU n 1 70 LYS n 1 71 HIS n 1 72 THR n 1 73 ASP n 1 74 ALA n 1 75 LEU n 1 76 ALA n 1 77 LEU n 1 78 ARG n 1 79 VAL n 1 80 ARG n 1 81 ARG n 1 82 ILE n 1 83 ALA n 1 84 GLU n 1 85 GLU n 1 86 GLU n 1 87 GLY n 1 88 ILE n 1 89 PRO n 1 90 VAL n 1 91 LEU n 1 92 GLN n 1 93 ARG n 1 94 ILE n 1 95 PRO n 1 96 LEU n 1 97 ALA n 1 98 ARG n 1 99 ALA n 1 100 LEU n 1 101 LEU n 1 102 ARG n 1 103 ASP n 1 104 GLY n 1 105 ASN n 1 106 VAL n 1 107 ASP n 1 108 GLN n 1 109 TYR n 1 110 ILE n 1 111 PRO n 1 112 ALA n 1 113 ASP n 1 114 LEU n 1 115 ILE n 1 116 GLN n 1 117 ALA n 1 118 THR n 1 119 ALA n 1 120 GLU n 1 121 VAL n 1 122 LEU n 1 123 ARG n 1 124 TRP n 1 125 LEU n 1 126 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 126 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pscU, PA1690' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9I337_PSEAE _struct_ref.pdbx_db_accession Q9I337 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EVKREYKEMEGSPEIKSKRRQFHQELQSSNLRADVRRSSVIVANPTHVAIGIRYRRGETPLPLVTLKHTDALALRVRRIA EEEGIPVLQRIPLARALLRDGNVDQYIPADLIQATAEVLRWLE ; _struct_ref.pdbx_align_begin 220 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5CUL A 4 ? 126 ? Q9I337 220 ? 342 ? 4 126 2 1 5CUL B 4 ? 126 ? Q9I337 220 ? 342 ? 4 126 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5CUL GLY A 1 ? UNP Q9I337 ? ? 'expression tag' 1 1 1 5CUL SER A 2 ? UNP Q9I337 ? ? 'expression tag' 2 2 1 5CUL HIS A 3 ? UNP Q9I337 ? ? 'expression tag' 3 3 2 5CUL GLY B 1 ? UNP Q9I337 ? ? 'expression tag' 1 4 2 5CUL SER B 2 ? UNP Q9I337 ? ? 'expression tag' 2 5 2 5CUL HIS B 3 ? UNP Q9I337 ? ? 'expression tag' 3 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5CUL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.44 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 14.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1M di-ammonium hydrogen phosphate, 0.1 M sodium acetate, pH 4.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-08-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 08ID-1 _diffrn_source.pdbx_synchrotron_site CLSI # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5CUL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.90 _reflns.d_resolution_low 42.66 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3694 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.0 _reflns.pdbx_Rmerge_I_obs 0.387 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.9 _reflns_shell.d_res_low 3.06 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all 536 _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.799 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5CUL _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 3533 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 42.66 _refine.ls_d_res_high 2.90 _refine.ls_percent_reflns_obs 99.78 _refine.ls_R_factor_obs 0.19701 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19562 _refine.ls_R_factor_R_free 0.22452 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.4 _refine.ls_number_reflns_R_free 161 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.935 _refine.correlation_coeff_Fo_to_Fc_free 0.902 _refine.B_iso_mean 53.794 _refine.aniso_B[1][1] 1.18 _refine.aniso_B[2][2] 1.18 _refine.aniso_B[3][3] -3.82 _refine.aniso_B[1][2] 1.18 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 2JLI _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 2.042 _refine.pdbx_overall_ESU_R_Free 0.327 _refine.overall_SU_ML 0.298 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 16.790 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 860 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 866 _refine_hist.d_res_high 2.90 _refine_hist.d_res_low 42.66 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.012 0.019 ? 872 'X-RAY DIFFRACTION' ? r_bond_other_d 0.005 0.020 ? 894 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.110 1.971 ? 1180 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.729 3.000 ? 2030 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.787 5.000 ? 105 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 28.320 21.395 ? 43 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 18.692 15.000 ? 157 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.074 15.000 ? 15 'X-RAY DIFFRACTION' ? r_chiral_restr 0.050 0.200 ? 139 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.003 0.021 ? 968 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.002 0.020 ? 209 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.900 _refine_ls_shell.d_res_low 2.975 _refine_ls_shell.number_reflns_R_work 264 _refine_ls_shell.R_factor_R_work 0.310 _refine_ls_shell.percent_reflns_obs 99.64 _refine_ls_shell.R_factor_R_free 0.251 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 9 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 5CUL _struct.title 'crystal structure of the PscU C-terminal domain' _struct.pdbx_descriptor Autoprotease _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5CUL _struct_keywords.text 'secretion system, CELL INVASION' _struct_keywords.pdbx_keywords 'CELL INVASION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 20 ? LEU A 29 ? SER A 20 LEU A 29 1 ? 10 HELX_P HELX_P2 AA2 ASN A 33 ? SER A 41 ? ASN A 33 SER A 41 1 ? 9 HELX_P HELX_P3 AA3 ASP B 73 ? GLY B 87 ? ASP B 73 GLY B 87 1 ? 15 HELX_P HELX_P4 AA4 ARG B 93 ? GLY B 104 ? ARG B 93 GLY B 104 1 ? 12 HELX_P HELX_P5 AA5 PRO B 111 ? ASP B 113 ? PRO B 111 ASP B 113 5 ? 3 HELX_P HELX_P6 AA6 LEU B 114 ? GLU B 126 ? LEU B 114 GLU B 126 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU B 66 ? THR B 72 ? LEU B 66 THR B 72 AA1 2 VAL B 51 ? ARG B 56 ? VAL B 51 ARG B 56 AA1 3 VAL A 43 ? ALA A 46 ? VAL A 43 ALA A 46 AA1 4 VAL B 90 ? GLN B 92 ? VAL B 90 GLN B 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU B 66 ? O LEU B 66 N ARG B 56 ? N ARG B 56 AA1 2 3 O ILE B 53 ? O ILE B 53 N VAL A 45 ? N VAL A 45 AA1 3 4 N ALA A 46 ? N ALA A 46 O LEU B 91 ? O LEU B 91 # _atom_sites.entry_id 5CUL _atom_sites.fract_transf_matrix[1][1] 0.014584 _atom_sites.fract_transf_matrix[1][2] 0.008420 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016840 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016337 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 VAL 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 ARG 7 7 ? ? ? A . n A 1 8 GLU 8 8 ? ? ? A . n A 1 9 TYR 9 9 ? ? ? A . n A 1 10 LYS 10 10 ? ? ? A . n A 1 11 GLU 11 11 ? ? ? A . n A 1 12 MET 12 12 ? ? ? A . n A 1 13 GLU 13 13 ? ? ? A . n A 1 14 GLY 14 14 ? ? ? A . n A 1 15 SER 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 GLU 17 17 ? ? ? A . n A 1 18 ILE 18 18 ? ? ? A . n A 1 19 LYS 19 19 ? ? ? A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 PRO 48 48 ? ? ? A . n A 1 49 THR 49 49 ? ? ? A . n A 1 50 HIS 50 50 ? ? ? A . n A 1 51 VAL 51 51 ? ? ? A . n A 1 52 ALA 52 52 ? ? ? A . n A 1 53 ILE 53 53 ? ? ? A . n A 1 54 GLY 54 54 ? ? ? A . n A 1 55 ILE 55 55 ? ? ? A . n A 1 56 ARG 56 56 ? ? ? A . n A 1 57 TYR 57 57 ? ? ? A . n A 1 58 ARG 58 58 ? ? ? A . n A 1 59 ARG 59 59 ? ? ? A . n A 1 60 GLY 60 60 ? ? ? A . n A 1 61 GLU 61 61 ? ? ? A . n A 1 62 THR 62 62 ? ? ? A . n A 1 63 PRO 63 63 ? ? ? A . n A 1 64 LEU 64 64 ? ? ? A . n A 1 65 PRO 65 65 ? ? ? A . n A 1 66 LEU 66 66 ? ? ? A . n A 1 67 VAL 67 67 ? ? ? A . n A 1 68 THR 68 68 ? ? ? A . n A 1 69 LEU 69 69 ? ? ? A . n A 1 70 LYS 70 70 ? ? ? A . n A 1 71 HIS 71 71 ? ? ? A . n A 1 72 THR 72 72 ? ? ? A . n A 1 73 ASP 73 73 ? ? ? A . n A 1 74 ALA 74 74 ? ? ? A . n A 1 75 LEU 75 75 ? ? ? A . n A 1 76 ALA 76 76 ? ? ? A . n A 1 77 LEU 77 77 ? ? ? A . n A 1 78 ARG 78 78 ? ? ? A . n A 1 79 VAL 79 79 ? ? ? A . n A 1 80 ARG 80 80 ? ? ? A . n A 1 81 ARG 81 81 ? ? ? A . n A 1 82 ILE 82 82 ? ? ? A . n A 1 83 ALA 83 83 ? ? ? A . n A 1 84 GLU 84 84 ? ? ? A . n A 1 85 GLU 85 85 ? ? ? A . n A 1 86 GLU 86 86 ? ? ? A . n A 1 87 GLY 87 87 ? ? ? A . n A 1 88 ILE 88 88 ? ? ? A . n A 1 89 PRO 89 89 ? ? ? A . n A 1 90 VAL 90 90 ? ? ? A . n A 1 91 LEU 91 91 ? ? ? A . n A 1 92 GLN 92 92 ? ? ? A . n A 1 93 ARG 93 93 ? ? ? A . n A 1 94 ILE 94 94 ? ? ? A . n A 1 95 PRO 95 95 ? ? ? A . n A 1 96 LEU 96 96 ? ? ? A . n A 1 97 ALA 97 97 ? ? ? A . n A 1 98 ARG 98 98 ? ? ? A . n A 1 99 ALA 99 99 ? ? ? A . n A 1 100 LEU 100 100 ? ? ? A . n A 1 101 LEU 101 101 ? ? ? A . n A 1 102 ARG 102 102 ? ? ? A . n A 1 103 ASP 103 103 ? ? ? A . n A 1 104 GLY 104 104 ? ? ? A . n A 1 105 ASN 105 105 ? ? ? A . n A 1 106 VAL 106 106 ? ? ? A . n A 1 107 ASP 107 107 ? ? ? A . n A 1 108 GLN 108 108 ? ? ? A . n A 1 109 TYR 109 109 ? ? ? A . n A 1 110 ILE 110 110 ? ? ? A . n A 1 111 PRO 111 111 ? ? ? A . n A 1 112 ALA 112 112 ? ? ? A . n A 1 113 ASP 113 113 ? ? ? A . n A 1 114 LEU 114 114 ? ? ? A . n A 1 115 ILE 115 115 ? ? ? A . n A 1 116 GLN 116 116 ? ? ? A . n A 1 117 ALA 117 117 ? ? ? A . n A 1 118 THR 118 118 ? ? ? A . n A 1 119 ALA 119 119 ? ? ? A . n A 1 120 GLU 120 120 ? ? ? A . n A 1 121 VAL 121 121 ? ? ? A . n A 1 122 LEU 122 122 ? ? ? A . n A 1 123 ARG 123 123 ? ? ? A . n A 1 124 TRP 124 124 ? ? ? A . n A 1 125 LEU 125 125 ? ? ? A . n A 1 126 GLU 126 126 ? ? ? A . n B 1 1 GLY 1 1 ? ? ? B . n B 1 2 SER 2 2 ? ? ? B . n B 1 3 HIS 3 3 ? ? ? B . n B 1 4 GLU 4 4 ? ? ? B . n B 1 5 VAL 5 5 ? ? ? B . n B 1 6 LYS 6 6 ? ? ? B . n B 1 7 ARG 7 7 ? ? ? B . n B 1 8 GLU 8 8 ? ? ? B . n B 1 9 TYR 9 9 ? ? ? B . n B 1 10 LYS 10 10 ? ? ? B . n B 1 11 GLU 11 11 ? ? ? B . n B 1 12 MET 12 12 ? ? ? B . n B 1 13 GLU 13 13 ? ? ? B . n B 1 14 GLY 14 14 ? ? ? B . n B 1 15 SER 15 15 ? ? ? B . n B 1 16 PRO 16 16 ? ? ? B . n B 1 17 GLU 17 17 ? ? ? B . n B 1 18 ILE 18 18 ? ? ? B . n B 1 19 LYS 19 19 ? ? ? B . n B 1 20 SER 20 20 ? ? ? B . n B 1 21 LYS 21 21 ? ? ? B . n B 1 22 ARG 22 22 ? ? ? B . n B 1 23 ARG 23 23 ? ? ? B . n B 1 24 GLN 24 24 ? ? ? B . n B 1 25 PHE 25 25 ? ? ? B . n B 1 26 HIS 26 26 ? ? ? B . n B 1 27 GLN 27 27 ? ? ? B . n B 1 28 GLU 28 28 ? ? ? B . n B 1 29 LEU 29 29 ? ? ? B . n B 1 30 GLN 30 30 ? ? ? B . n B 1 31 SER 31 31 ? ? ? B . n B 1 32 SER 32 32 ? ? ? B . n B 1 33 ASN 33 33 ? ? ? B . n B 1 34 LEU 34 34 ? ? ? B . n B 1 35 ARG 35 35 ? ? ? B . n B 1 36 ALA 36 36 ? ? ? B . n B 1 37 ASP 37 37 ? ? ? B . n B 1 38 VAL 38 38 ? ? ? B . n B 1 39 ARG 39 39 ? ? ? B . n B 1 40 ARG 40 40 ? ? ? B . n B 1 41 SER 41 41 ? ? ? B . n B 1 42 SER 42 42 ? ? ? B . n B 1 43 VAL 43 43 ? ? ? B . n B 1 44 ILE 44 44 ? ? ? B . n B 1 45 VAL 45 45 ? ? ? B . n B 1 46 ALA 46 46 ? ? ? B . n B 1 47 ASN 47 47 ? ? ? B . n B 1 48 PRO 48 48 48 PRO PRO B . n B 1 49 THR 49 49 49 THR THR B . n B 1 50 HIS 50 50 50 HIS HIS B . n B 1 51 VAL 51 51 51 VAL VAL B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 ILE 53 53 53 ILE ILE B . n B 1 54 GLY 54 54 54 GLY GLY B . n B 1 55 ILE 55 55 55 ILE ILE B . n B 1 56 ARG 56 56 56 ARG ARG B . n B 1 57 TYR 57 57 57 TYR TYR B . n B 1 58 ARG 58 58 58 ARG ARG B . n B 1 59 ARG 59 59 59 ARG ARG B . n B 1 60 GLY 60 60 60 GLY GLY B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 THR 62 62 62 THR THR B . n B 1 63 PRO 63 63 63 PRO PRO B . n B 1 64 LEU 64 64 64 LEU LEU B . n B 1 65 PRO 65 65 65 PRO PRO B . n B 1 66 LEU 66 66 66 LEU LEU B . n B 1 67 VAL 67 67 67 VAL VAL B . n B 1 68 THR 68 68 68 THR THR B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 LYS 70 70 70 LYS LYS B . n B 1 71 HIS 71 71 71 HIS HIS B . n B 1 72 THR 72 72 72 THR THR B . n B 1 73 ASP 73 73 73 ASP ASP B . n B 1 74 ALA 74 74 74 ALA ALA B . n B 1 75 LEU 75 75 75 LEU LEU B . n B 1 76 ALA 76 76 76 ALA ALA B . n B 1 77 LEU 77 77 77 LEU LEU B . n B 1 78 ARG 78 78 78 ARG ARG B . n B 1 79 VAL 79 79 79 VAL VAL B . n B 1 80 ARG 80 80 80 ARG ARG B . n B 1 81 ARG 81 81 81 ARG ARG B . n B 1 82 ILE 82 82 82 ILE ILE B . n B 1 83 ALA 83 83 83 ALA ALA B . n B 1 84 GLU 84 84 84 GLU GLU B . n B 1 85 GLU 85 85 85 GLU GLU B . n B 1 86 GLU 86 86 86 GLU GLU B . n B 1 87 GLY 87 87 87 GLY GLY B . n B 1 88 ILE 88 88 88 ILE ILE B . n B 1 89 PRO 89 89 89 PRO PRO B . n B 1 90 VAL 90 90 90 VAL VAL B . n B 1 91 LEU 91 91 91 LEU LEU B . n B 1 92 GLN 92 92 92 GLN GLN B . n B 1 93 ARG 93 93 93 ARG ARG B . n B 1 94 ILE 94 94 94 ILE ILE B . n B 1 95 PRO 95 95 95 PRO PRO B . n B 1 96 LEU 96 96 96 LEU LEU B . n B 1 97 ALA 97 97 97 ALA ALA B . n B 1 98 ARG 98 98 98 ARG ARG B . n B 1 99 ALA 99 99 99 ALA ALA B . n B 1 100 LEU 100 100 100 LEU LEU B . n B 1 101 LEU 101 101 101 LEU LEU B . n B 1 102 ARG 102 102 102 ARG ARG B . n B 1 103 ASP 103 103 103 ASP ASP B . n B 1 104 GLY 104 104 104 GLY GLY B . n B 1 105 ASN 105 105 105 ASN ASN B . n B 1 106 VAL 106 106 106 VAL VAL B . n B 1 107 ASP 107 107 107 ASP ASP B . n B 1 108 GLN 108 108 108 GLN GLN B . n B 1 109 TYR 109 109 109 TYR TYR B . n B 1 110 ILE 110 110 110 ILE ILE B . n B 1 111 PRO 111 111 111 PRO PRO B . n B 1 112 ALA 112 112 112 ALA ALA B . n B 1 113 ASP 113 113 113 ASP ASP B . n B 1 114 LEU 114 114 114 LEU LEU B . n B 1 115 ILE 115 115 115 ILE ILE B . n B 1 116 GLN 116 116 116 GLN GLN B . n B 1 117 ALA 117 117 117 ALA ALA B . n B 1 118 THR 118 118 118 THR THR B . n B 1 119 ALA 119 119 119 ALA ALA B . n B 1 120 GLU 120 120 120 GLU GLU B . n B 1 121 VAL 121 121 121 VAL VAL B . n B 1 122 LEU 122 122 122 LEU LEU B . n B 1 123 ARG 123 123 123 ARG ARG B . n B 1 124 TRP 124 124 124 TRP TRP B . n B 1 125 LEU 125 125 125 LEU LEU B . n B 1 126 GLU 126 126 126 GLU GLU B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 201 26 HOH HOH B . C 2 HOH 2 202 7 HOH HOH B . C 2 HOH 3 203 4 HOH HOH B . C 2 HOH 4 204 13 HOH HOH B . C 2 HOH 5 205 19 HOH HOH B . C 2 HOH 6 206 23 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2330 ? 1 MORE -7 ? 1 'SSA (A^2)' 6820 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-02 2 'Structure model' 1 1 2016-02-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0029 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 29 ? ? -84.64 34.82 2 1 GLN A 30 ? ? -109.18 64.42 3 1 ASP B 73 ? ? 59.95 -131.73 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A VAL 5 ? A VAL 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A ARG 7 ? A ARG 7 8 1 Y 1 A GLU 8 ? A GLU 8 9 1 Y 1 A TYR 9 ? A TYR 9 10 1 Y 1 A LYS 10 ? A LYS 10 11 1 Y 1 A GLU 11 ? A GLU 11 12 1 Y 1 A MET 12 ? A MET 12 13 1 Y 1 A GLU 13 ? A GLU 13 14 1 Y 1 A GLY 14 ? A GLY 14 15 1 Y 1 A SER 15 ? A SER 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A GLU 17 ? A GLU 17 18 1 Y 1 A ILE 18 ? A ILE 18 19 1 Y 1 A LYS 19 ? A LYS 19 20 1 Y 1 A PRO 48 ? A PRO 48 21 1 Y 1 A THR 49 ? A THR 49 22 1 Y 1 A HIS 50 ? A HIS 50 23 1 Y 1 A VAL 51 ? A VAL 51 24 1 Y 1 A ALA 52 ? A ALA 52 25 1 Y 1 A ILE 53 ? A ILE 53 26 1 Y 1 A GLY 54 ? A GLY 54 27 1 Y 1 A ILE 55 ? A ILE 55 28 1 Y 1 A ARG 56 ? A ARG 56 29 1 Y 1 A TYR 57 ? A TYR 57 30 1 Y 1 A ARG 58 ? A ARG 58 31 1 Y 1 A ARG 59 ? A ARG 59 32 1 Y 1 A GLY 60 ? A GLY 60 33 1 Y 1 A GLU 61 ? A GLU 61 34 1 Y 1 A THR 62 ? A THR 62 35 1 Y 1 A PRO 63 ? A PRO 63 36 1 Y 1 A LEU 64 ? A LEU 64 37 1 Y 1 A PRO 65 ? A PRO 65 38 1 Y 1 A LEU 66 ? A LEU 66 39 1 Y 1 A VAL 67 ? A VAL 67 40 1 Y 1 A THR 68 ? A THR 68 41 1 Y 1 A LEU 69 ? A LEU 69 42 1 Y 1 A LYS 70 ? A LYS 70 43 1 Y 1 A HIS 71 ? A HIS 71 44 1 Y 1 A THR 72 ? A THR 72 45 1 Y 1 A ASP 73 ? A ASP 73 46 1 Y 1 A ALA 74 ? A ALA 74 47 1 Y 1 A LEU 75 ? A LEU 75 48 1 Y 1 A ALA 76 ? A ALA 76 49 1 Y 1 A LEU 77 ? A LEU 77 50 1 Y 1 A ARG 78 ? A ARG 78 51 1 Y 1 A VAL 79 ? A VAL 79 52 1 Y 1 A ARG 80 ? A ARG 80 53 1 Y 1 A ARG 81 ? A ARG 81 54 1 Y 1 A ILE 82 ? A ILE 82 55 1 Y 1 A ALA 83 ? A ALA 83 56 1 Y 1 A GLU 84 ? A GLU 84 57 1 Y 1 A GLU 85 ? A GLU 85 58 1 Y 1 A GLU 86 ? A GLU 86 59 1 Y 1 A GLY 87 ? A GLY 87 60 1 Y 1 A ILE 88 ? A ILE 88 61 1 Y 1 A PRO 89 ? A PRO 89 62 1 Y 1 A VAL 90 ? A VAL 90 63 1 Y 1 A LEU 91 ? A LEU 91 64 1 Y 1 A GLN 92 ? A GLN 92 65 1 Y 1 A ARG 93 ? A ARG 93 66 1 Y 1 A ILE 94 ? A ILE 94 67 1 Y 1 A PRO 95 ? A PRO 95 68 1 Y 1 A LEU 96 ? A LEU 96 69 1 Y 1 A ALA 97 ? A ALA 97 70 1 Y 1 A ARG 98 ? A ARG 98 71 1 Y 1 A ALA 99 ? A ALA 99 72 1 Y 1 A LEU 100 ? A LEU 100 73 1 Y 1 A LEU 101 ? A LEU 101 74 1 Y 1 A ARG 102 ? A ARG 102 75 1 Y 1 A ASP 103 ? A ASP 103 76 1 Y 1 A GLY 104 ? A GLY 104 77 1 Y 1 A ASN 105 ? A ASN 105 78 1 Y 1 A VAL 106 ? A VAL 106 79 1 Y 1 A ASP 107 ? A ASP 107 80 1 Y 1 A GLN 108 ? A GLN 108 81 1 Y 1 A TYR 109 ? A TYR 109 82 1 Y 1 A ILE 110 ? A ILE 110 83 1 Y 1 A PRO 111 ? A PRO 111 84 1 Y 1 A ALA 112 ? A ALA 112 85 1 Y 1 A ASP 113 ? A ASP 113 86 1 Y 1 A LEU 114 ? A LEU 114 87 1 Y 1 A ILE 115 ? A ILE 115 88 1 Y 1 A GLN 116 ? A GLN 116 89 1 Y 1 A ALA 117 ? A ALA 117 90 1 Y 1 A THR 118 ? A THR 118 91 1 Y 1 A ALA 119 ? A ALA 119 92 1 Y 1 A GLU 120 ? A GLU 120 93 1 Y 1 A VAL 121 ? A VAL 121 94 1 Y 1 A LEU 122 ? A LEU 122 95 1 Y 1 A ARG 123 ? A ARG 123 96 1 Y 1 A TRP 124 ? A TRP 124 97 1 Y 1 A LEU 125 ? A LEU 125 98 1 Y 1 A GLU 126 ? A GLU 126 99 1 Y 1 B GLY 1 ? B GLY 1 100 1 Y 1 B SER 2 ? B SER 2 101 1 Y 1 B HIS 3 ? B HIS 3 102 1 Y 1 B GLU 4 ? B GLU 4 103 1 Y 1 B VAL 5 ? B VAL 5 104 1 Y 1 B LYS 6 ? B LYS 6 105 1 Y 1 B ARG 7 ? B ARG 7 106 1 Y 1 B GLU 8 ? B GLU 8 107 1 Y 1 B TYR 9 ? B TYR 9 108 1 Y 1 B LYS 10 ? B LYS 10 109 1 Y 1 B GLU 11 ? B GLU 11 110 1 Y 1 B MET 12 ? B MET 12 111 1 Y 1 B GLU 13 ? B GLU 13 112 1 Y 1 B GLY 14 ? B GLY 14 113 1 Y 1 B SER 15 ? B SER 15 114 1 Y 1 B PRO 16 ? B PRO 16 115 1 Y 1 B GLU 17 ? B GLU 17 116 1 Y 1 B ILE 18 ? B ILE 18 117 1 Y 1 B LYS 19 ? B LYS 19 118 1 Y 1 B SER 20 ? B SER 20 119 1 Y 1 B LYS 21 ? B LYS 21 120 1 Y 1 B ARG 22 ? B ARG 22 121 1 Y 1 B ARG 23 ? B ARG 23 122 1 Y 1 B GLN 24 ? B GLN 24 123 1 Y 1 B PHE 25 ? B PHE 25 124 1 Y 1 B HIS 26 ? B HIS 26 125 1 Y 1 B GLN 27 ? B GLN 27 126 1 Y 1 B GLU 28 ? B GLU 28 127 1 Y 1 B LEU 29 ? B LEU 29 128 1 Y 1 B GLN 30 ? B GLN 30 129 1 Y 1 B SER 31 ? B SER 31 130 1 Y 1 B SER 32 ? B SER 32 131 1 Y 1 B ASN 33 ? B ASN 33 132 1 Y 1 B LEU 34 ? B LEU 34 133 1 Y 1 B ARG 35 ? B ARG 35 134 1 Y 1 B ALA 36 ? B ALA 36 135 1 Y 1 B ASP 37 ? B ASP 37 136 1 Y 1 B VAL 38 ? B VAL 38 137 1 Y 1 B ARG 39 ? B ARG 39 138 1 Y 1 B ARG 40 ? B ARG 40 139 1 Y 1 B SER 41 ? B SER 41 140 1 Y 1 B SER 42 ? B SER 42 141 1 Y 1 B VAL 43 ? B VAL 43 142 1 Y 1 B ILE 44 ? B ILE 44 143 1 Y 1 B VAL 45 ? B VAL 45 144 1 Y 1 B ALA 46 ? B ALA 46 145 1 Y 1 B ASN 47 ? B ASN 47 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #