data_5CV1 # _entry.id 5CV1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5CV1 pdb_00005cv1 10.2210/pdb5cv1/pdb WWPDB D_1000211987 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details '5COW is C. remanei homolog of same domain' _pdbx_database_related.db_id 5COW _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5CV1 _pdbx_database_status.recvd_initial_deposition_date 2015-07-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Aoki, S.T.' 1 'Bingman, C.A.' 2 'Wickens, M.' 3 'Kimble, J.E.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 113 _citation.language ? _citation.page_first 1279 _citation.page_last 1284 _citation.title 'PGL germ granule assembly protein is a base-specific, single-stranded RNase.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1524400113 _citation.pdbx_database_id_PubMed 26787882 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aoki, S.T.' 1 ? primary 'Kershner, A.M.' 2 ? primary 'Bingman, C.A.' 3 ? primary 'Wickens, M.' 4 ? primary 'Kimble, J.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5CV1 _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.720 _cell.length_a_esd ? _cell.length_b 59.720 _cell.length_b_esd ? _cell.length_c 227.240 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5CV1 _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'P granule abnormality protein 1' _entity.formula_weight 27253.301 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KQLMLDGPKSEPADPFISLLMDPLEESVGKVVNHIAQLFEEASKNEGDESLVLRSQLGYQLFFLIVRSLADGKREVSKKI LSGIPTSVRAEVFPGLQRSVYKSAVFLGNHIIQVLLGSKKSFEDWDVVGVAKDLESAWKRRAIAELIKKFQVSILEQCFD KPVPLIPQSPLNNDAVIDNVNKALQFALWLTEFYGSENETEALGELRFLDSTSKNLLVDSFKKFVQGINSKTHVTRIVES LEK ; _entity_poly.pdbx_seq_one_letter_code_can ;KQLMLDGPKSEPADPFISLLMDPLEESVGKVVNHIAQLFEEASKNEGDESLVLRSQLGYQLFFLIVRSLADGKREVSKKI LSGIPTSVRAEVFPGLQRSVYKSAVFLGNHIIQVLLGSKKSFEDWDVVGVAKDLESAWKRRAIAELIKKFQVSILEQCFD KPVPLIPQSPLNNDAVIDNVNKALQFALWLTEFYGSENETEALGELRFLDSTSKNLLVDSFKKFVQGINSKTHVTRIVES LEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 GLN n 1 3 LEU n 1 4 MET n 1 5 LEU n 1 6 ASP n 1 7 GLY n 1 8 PRO n 1 9 LYS n 1 10 SER n 1 11 GLU n 1 12 PRO n 1 13 ALA n 1 14 ASP n 1 15 PRO n 1 16 PHE n 1 17 ILE n 1 18 SER n 1 19 LEU n 1 20 LEU n 1 21 MET n 1 22 ASP n 1 23 PRO n 1 24 LEU n 1 25 GLU n 1 26 GLU n 1 27 SER n 1 28 VAL n 1 29 GLY n 1 30 LYS n 1 31 VAL n 1 32 VAL n 1 33 ASN n 1 34 HIS n 1 35 ILE n 1 36 ALA n 1 37 GLN n 1 38 LEU n 1 39 PHE n 1 40 GLU n 1 41 GLU n 1 42 ALA n 1 43 SER n 1 44 LYS n 1 45 ASN n 1 46 GLU n 1 47 GLY n 1 48 ASP n 1 49 GLU n 1 50 SER n 1 51 LEU n 1 52 VAL n 1 53 LEU n 1 54 ARG n 1 55 SER n 1 56 GLN n 1 57 LEU n 1 58 GLY n 1 59 TYR n 1 60 GLN n 1 61 LEU n 1 62 PHE n 1 63 PHE n 1 64 LEU n 1 65 ILE n 1 66 VAL n 1 67 ARG n 1 68 SER n 1 69 LEU n 1 70 ALA n 1 71 ASP n 1 72 GLY n 1 73 LYS n 1 74 ARG n 1 75 GLU n 1 76 VAL n 1 77 SER n 1 78 LYS n 1 79 LYS n 1 80 ILE n 1 81 LEU n 1 82 SER n 1 83 GLY n 1 84 ILE n 1 85 PRO n 1 86 THR n 1 87 SER n 1 88 VAL n 1 89 ARG n 1 90 ALA n 1 91 GLU n 1 92 VAL n 1 93 PHE n 1 94 PRO n 1 95 GLY n 1 96 LEU n 1 97 GLN n 1 98 ARG n 1 99 SER n 1 100 VAL n 1 101 TYR n 1 102 LYS n 1 103 SER n 1 104 ALA n 1 105 VAL n 1 106 PHE n 1 107 LEU n 1 108 GLY n 1 109 ASN n 1 110 HIS n 1 111 ILE n 1 112 ILE n 1 113 GLN n 1 114 VAL n 1 115 LEU n 1 116 LEU n 1 117 GLY n 1 118 SER n 1 119 LYS n 1 120 LYS n 1 121 SER n 1 122 PHE n 1 123 GLU n 1 124 ASP n 1 125 TRP n 1 126 ASP n 1 127 VAL n 1 128 VAL n 1 129 GLY n 1 130 VAL n 1 131 ALA n 1 132 LYS n 1 133 ASP n 1 134 LEU n 1 135 GLU n 1 136 SER n 1 137 ALA n 1 138 TRP n 1 139 LYS n 1 140 ARG n 1 141 ARG n 1 142 ALA n 1 143 ILE n 1 144 ALA n 1 145 GLU n 1 146 LEU n 1 147 ILE n 1 148 LYS n 1 149 LYS n 1 150 PHE n 1 151 GLN n 1 152 VAL n 1 153 SER n 1 154 ILE n 1 155 LEU n 1 156 GLU n 1 157 GLN n 1 158 CYS n 1 159 PHE n 1 160 ASP n 1 161 LYS n 1 162 PRO n 1 163 VAL n 1 164 PRO n 1 165 LEU n 1 166 ILE n 1 167 PRO n 1 168 GLN n 1 169 SER n 1 170 PRO n 1 171 LEU n 1 172 ASN n 1 173 ASN n 1 174 ASP n 1 175 ALA n 1 176 VAL n 1 177 ILE n 1 178 ASP n 1 179 ASN n 1 180 VAL n 1 181 ASN n 1 182 LYS n 1 183 ALA n 1 184 LEU n 1 185 GLN n 1 186 PHE n 1 187 ALA n 1 188 LEU n 1 189 TRP n 1 190 LEU n 1 191 THR n 1 192 GLU n 1 193 PHE n 1 194 TYR n 1 195 GLY n 1 196 SER n 1 197 GLU n 1 198 ASN n 1 199 GLU n 1 200 THR n 1 201 GLU n 1 202 ALA n 1 203 LEU n 1 204 GLY n 1 205 GLU n 1 206 LEU n 1 207 ARG n 1 208 PHE n 1 209 LEU n 1 210 ASP n 1 211 SER n 1 212 THR n 1 213 SER n 1 214 LYS n 1 215 ASN n 1 216 LEU n 1 217 LEU n 1 218 VAL n 1 219 ASP n 1 220 SER n 1 221 PHE n 1 222 LYS n 1 223 LYS n 1 224 PHE n 1 225 VAL n 1 226 GLN n 1 227 GLY n 1 228 ILE n 1 229 ASN n 1 230 SER n 1 231 LYS n 1 232 THR n 1 233 HIS n 1 234 VAL n 1 235 THR n 1 236 ARG n 1 237 ILE n 1 238 VAL n 1 239 GLU n 1 240 SER n 1 241 LEU n 1 242 GLU n 1 243 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 243 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pgl-1, ZK381.4' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caenorhabditis elegans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6239 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant Rosetta2 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PGL1_CAEEL _struct_ref.pdbx_db_accession Q9TZQ3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KQLMLDGPKSEPADPFISLLMDPLEESVGKVVNHIAQLFEEASKNEGDESLVLRSQLGYQLFFLIVRSLADGKREVSKKI LSGIPTSVRAEVFPGLQRSVYKSAVFLGNHIIQVLLGSKKSFEDWDVVGVAKDLESAWKRRAIAELIKKFQVSILEQCFD KPVPLIPQSPLNNDAVIDNVNKALQFALWLTEFYGSENETEALGELRFLDSTSKNLLVDSFKKFVQGINSKTHVTRIVES LEK ; _struct_ref.pdbx_align_begin 205 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5CV1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 243 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9TZQ3 _struct_ref_seq.db_align_beg 205 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 447 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 246 _struct_ref_seq.pdbx_auth_seq_align_end 488 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5CV1 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.69 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.575-1.625 M Sodium Malonate pH 5.9, 50-100 mM GuCl, 1 mM TCEP, 0.02% Na azide' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-08-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'DIAMOND (111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97857 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-G' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97857 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-G _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 107.320 _reflns.entry_id 5CV1 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.599 _reflns.d_resolution_low 47.07 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5264 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs 0.999 _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.2 _reflns.pdbx_Rmerge_I_obs 0.107 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.750 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.984 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.112 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 61362 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.599 3.726 ? 5.63 ? 4447 397 ? 397 100.000 ? ? 0.936 ? 0.7062 ? ? ? ? ? ? ? ? 19.5 ? ? ? ? 0.730 ? 0 1 1 ? ? 3.690 3.790 ? 6.050 ? 4350 373 ? 373 100.000 ? ? 0.969 ? 0.497 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.519 ? 0 2 1 ? ? 3.790 3.900 ? 7.800 ? 4273 364 ? 364 100.000 ? ? 0.976 ? 0.391 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.409 ? 0 3 1 ? ? 3.900 4.020 ? 9.340 ? 4348 368 ? 368 100.000 ? ? 0.983 ? 0.296 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.310 ? 0 4 1 ? ? 4.020 4.160 ? 13.680 ? 3974 339 ? 339 100.000 ? ? 0.995 ? 0.191 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.200 ? 0 5 1 ? ? 4.160 4.300 ? 15.020 ? 4056 342 ? 342 100.000 ? ? 0.993 ? 0.185 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.193 ? 0 6 1 ? ? 4.300 4.460 ? 16.050 ? 3724 318 ? 318 100.000 ? ? 0.995 ? 0.162 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.169 ? 0 7 1 ? ? 4.460 4.650 ? 17.090 ? 3755 319 ? 319 100.000 ? ? 0.996 ? 0.149 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.156 ? 0 8 1 ? ? 4.650 4.850 ? 20.930 ? 3474 298 ? 298 100.000 ? ? 0.997 ? 0.126 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.131 ? 0 9 1 ? ? 4.850 5.090 ? 18.840 ? 3347 284 ? 284 100.000 ? ? 0.994 ? 0.145 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.151 ? 0 10 1 ? ? 5.090 5.370 ? 17.010 ? 3186 270 ? 270 100.000 ? ? 0.995 ? 0.155 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.162 ? 0 11 1 ? ? 5.370 5.690 ? 20.600 ? 2982 256 ? 256 100.000 ? ? 0.997 ? 0.121 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.127 ? 0 12 1 ? ? 5.690 6.080 ? 19.580 ? 2948 248 ? 248 100.000 ? ? 0.997 ? 0.127 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.133 ? 0 13 1 ? ? 6.080 6.570 ? 22.990 ? 2688 231 ? 231 100.000 ? ? 0.998 ? 0.110 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.115 ? 0 14 1 ? ? 6.570 7.200 ? 30.430 ? 2319 199 ? 199 100.000 ? ? 0.998 ? 0.078 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.081 ? 0 15 1 ? ? 7.200 8.050 ? 44.230 ? 2140 186 ? 186 100.000 ? ? 0.999 ? 0.047 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.049 ? 0 16 1 ? ? 8.050 9.290 ? 53.320 ? 1950 169 ? 169 100.000 ? ? 1.000 ? 0.037 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.039 ? 0 17 1 ? ? 9.290 11.380 ? 64.380 ? 1647 141 ? 141 100.000 ? ? 0.999 ? 0.029 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.030 ? 0 18 1 ? ? 11.380 16.100 ? 65.200 ? 1182 104 ? 103 99.000 ? ? 0.999 ? 0.031 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.032 ? 0 19 1 ? ? 16.100 47.07 ? 46.430 ? 572 63 ? 59 93.700 ? ? 0.999 ? 0.042 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.044 ? 0 20 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 248.230 _refine.B_iso_mean 121.0369 _refine.B_iso_min 28.610 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5CV1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.5990 _refine.ls_d_res_low 47.07 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5263 _refine.ls_number_reflns_R_free 519 _refine.ls_number_reflns_R_work 4744 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9200 _refine.ls_percent_reflns_R_free 9.8600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3011 _refine.ls_R_factor_R_free 0.3211 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2986 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.950 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5COW _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.8000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 3.5990 _refine_hist.d_res_low 47.07 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1734 _refine_hist.pdbx_number_residues_total 218 _refine_hist.pdbx_number_atoms_protein 1734 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1764 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.625 ? 2383 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.022 ? 277 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 303 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.124 ? 656 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.5990 3.9610 . . 129 1204 100.0000 . . . 0.3611 . 0.2940 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9610 4.5338 . . 131 1175 100.0000 . . . 0.3204 . 0.2920 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.5338 5.7105 . . 130 1170 100.0000 . . . 0.3511 . 0.3211 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.7105 47.07 . . 129 1195 100.0000 . . . 0.2917 . 0.2907 . . . . . . . . . . # _struct.entry_id 5CV1 _struct.title 'C. elegans PGL-1 Dimerization Domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5CV1 _struct_keywords.text 'guanosine endonuclease, dimer, P-granule, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 14 ? LEU A 20 ? ASP A 259 LEU A 265 1 ? 7 HELX_P HELX_P2 AA2 LEU A 24 ? ASN A 45 ? LEU A 269 ASN A 290 1 ? 22 HELX_P HELX_P3 AA3 GLU A 46 ? ASP A 71 ? GLU A 291 ASP A 316 1 ? 26 HELX_P HELX_P4 AA4 LYS A 73 ? GLY A 83 ? LYS A 318 GLY A 328 1 ? 11 HELX_P HELX_P5 AA5 PRO A 85 ? PHE A 93 ? PRO A 330 PHE A 338 1 ? 9 HELX_P HELX_P6 AA6 PRO A 94 ? SER A 99 ? PRO A 339 SER A 344 5 ? 6 HELX_P HELX_P7 AA7 VAL A 100 ? GLY A 117 ? VAL A 345 GLY A 362 1 ? 18 HELX_P HELX_P8 AA8 GLY A 129 ? SER A 136 ? GLY A 374 SER A 381 1 ? 8 HELX_P HELX_P9 AA9 SER A 136 ? GLU A 156 ? SER A 381 GLU A 401 1 ? 21 HELX_P HELX_P10 AB1 ASN A 172 ? PHE A 193 ? ASN A 417 PHE A 438 1 ? 22 HELX_P HELX_P11 AB2 GLU A 199 ? GLY A 204 ? GLU A 444 GLY A 449 1 ? 6 HELX_P HELX_P12 AB3 GLU A 205 ? ARG A 207 ? GLU A 450 ARG A 452 5 ? 3 HELX_P HELX_P13 AB4 THR A 212 ? PHE A 224 ? THR A 457 PHE A 469 1 ? 13 HELX_P HELX_P14 AB5 HIS A 233 ? LYS A 243 ? HIS A 478 LYS A 488 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 5CV1 _atom_sites.fract_transf_matrix[1][1] 0.016745 _atom_sites.fract_transf_matrix[1][2] 0.009668 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019335 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004401 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 246 ? ? ? A . n A 1 2 GLN 2 247 ? ? ? A . n A 1 3 LEU 3 248 ? ? ? A . n A 1 4 MET 4 249 ? ? ? A . n A 1 5 LEU 5 250 ? ? ? A . n A 1 6 ASP 6 251 ? ? ? A . n A 1 7 GLY 7 252 ? ? ? A . n A 1 8 PRO 8 253 ? ? ? A . n A 1 9 LYS 9 254 ? ? ? A . n A 1 10 SER 10 255 ? ? ? A . n A 1 11 GLU 11 256 256 GLU GLU A . n A 1 12 PRO 12 257 257 PRO PRO A . n A 1 13 ALA 13 258 258 ALA ALA A . n A 1 14 ASP 14 259 259 ASP ASP A . n A 1 15 PRO 15 260 260 PRO PRO A . n A 1 16 PHE 16 261 261 PHE PHE A . n A 1 17 ILE 17 262 262 ILE ILE A . n A 1 18 SER 18 263 263 SER SER A . n A 1 19 LEU 19 264 264 LEU LEU A . n A 1 20 LEU 20 265 265 LEU LEU A . n A 1 21 MET 21 266 266 MET MET A . n A 1 22 ASP 22 267 267 ASP ASP A . n A 1 23 PRO 23 268 268 PRO PRO A . n A 1 24 LEU 24 269 269 LEU LEU A . n A 1 25 GLU 25 270 270 GLU GLU A . n A 1 26 GLU 26 271 271 GLU GLU A . n A 1 27 SER 27 272 272 SER SER A . n A 1 28 VAL 28 273 273 VAL VAL A . n A 1 29 GLY 29 274 274 GLY GLY A . n A 1 30 LYS 30 275 275 LYS LYS A . n A 1 31 VAL 31 276 276 VAL VAL A . n A 1 32 VAL 32 277 277 VAL VAL A . n A 1 33 ASN 33 278 278 ASN ASN A . n A 1 34 HIS 34 279 279 HIS HIS A . n A 1 35 ILE 35 280 280 ILE ILE A . n A 1 36 ALA 36 281 281 ALA ALA A . n A 1 37 GLN 37 282 282 GLN GLN A . n A 1 38 LEU 38 283 283 LEU LEU A . n A 1 39 PHE 39 284 284 PHE PHE A . n A 1 40 GLU 40 285 285 GLU GLU A . n A 1 41 GLU 41 286 286 GLU GLU A . n A 1 42 ALA 42 287 287 ALA ALA A . n A 1 43 SER 43 288 288 SER SER A . n A 1 44 LYS 44 289 289 LYS LYS A . n A 1 45 ASN 45 290 290 ASN ASN A . n A 1 46 GLU 46 291 291 GLU GLU A . n A 1 47 GLY 47 292 292 GLY GLY A . n A 1 48 ASP 48 293 293 ASP ASP A . n A 1 49 GLU 49 294 294 GLU GLU A . n A 1 50 SER 50 295 295 SER SER A . n A 1 51 LEU 51 296 296 LEU LEU A . n A 1 52 VAL 52 297 297 VAL VAL A . n A 1 53 LEU 53 298 298 LEU LEU A . n A 1 54 ARG 54 299 299 ARG ARG A . n A 1 55 SER 55 300 300 SER SER A . n A 1 56 GLN 56 301 301 GLN GLN A . n A 1 57 LEU 57 302 302 LEU LEU A . n A 1 58 GLY 58 303 303 GLY GLY A . n A 1 59 TYR 59 304 304 TYR TYR A . n A 1 60 GLN 60 305 305 GLN GLN A . n A 1 61 LEU 61 306 306 LEU LEU A . n A 1 62 PHE 62 307 307 PHE PHE A . n A 1 63 PHE 63 308 308 PHE PHE A . n A 1 64 LEU 64 309 309 LEU LEU A . n A 1 65 ILE 65 310 310 ILE ILE A . n A 1 66 VAL 66 311 311 VAL VAL A . n A 1 67 ARG 67 312 312 ARG ARG A . n A 1 68 SER 68 313 313 SER SER A . n A 1 69 LEU 69 314 314 LEU LEU A . n A 1 70 ALA 70 315 315 ALA ALA A . n A 1 71 ASP 71 316 316 ASP ASP A . n A 1 72 GLY 72 317 317 GLY GLY A . n A 1 73 LYS 73 318 318 LYS LYS A . n A 1 74 ARG 74 319 319 ARG ARG A . n A 1 75 GLU 75 320 320 GLU GLU A . n A 1 76 VAL 76 321 321 VAL VAL A . n A 1 77 SER 77 322 322 SER SER A . n A 1 78 LYS 78 323 323 LYS LYS A . n A 1 79 LYS 79 324 324 LYS LYS A . n A 1 80 ILE 80 325 325 ILE ILE A . n A 1 81 LEU 81 326 326 LEU LEU A . n A 1 82 SER 82 327 327 SER SER A . n A 1 83 GLY 83 328 328 GLY GLY A . n A 1 84 ILE 84 329 329 ILE ILE A . n A 1 85 PRO 85 330 330 PRO PRO A . n A 1 86 THR 86 331 331 THR THR A . n A 1 87 SER 87 332 332 SER SER A . n A 1 88 VAL 88 333 333 VAL VAL A . n A 1 89 ARG 89 334 334 ARG ARG A . n A 1 90 ALA 90 335 335 ALA ALA A . n A 1 91 GLU 91 336 336 GLU GLU A . n A 1 92 VAL 92 337 337 VAL VAL A . n A 1 93 PHE 93 338 338 PHE PHE A . n A 1 94 PRO 94 339 339 PRO PRO A . n A 1 95 GLY 95 340 340 GLY GLY A . n A 1 96 LEU 96 341 341 LEU LEU A . n A 1 97 GLN 97 342 342 GLN GLN A . n A 1 98 ARG 98 343 343 ARG ARG A . n A 1 99 SER 99 344 344 SER SER A . n A 1 100 VAL 100 345 345 VAL VAL A . n A 1 101 TYR 101 346 346 TYR TYR A . n A 1 102 LYS 102 347 347 LYS LYS A . n A 1 103 SER 103 348 348 SER SER A . n A 1 104 ALA 104 349 349 ALA ALA A . n A 1 105 VAL 105 350 350 VAL VAL A . n A 1 106 PHE 106 351 351 PHE PHE A . n A 1 107 LEU 107 352 352 LEU LEU A . n A 1 108 GLY 108 353 353 GLY GLY A . n A 1 109 ASN 109 354 354 ASN ASN A . n A 1 110 HIS 110 355 355 HIS HIS A . n A 1 111 ILE 111 356 356 ILE ILE A . n A 1 112 ILE 112 357 357 ILE ILE A . n A 1 113 GLN 113 358 358 GLN GLN A . n A 1 114 VAL 114 359 359 VAL VAL A . n A 1 115 LEU 115 360 360 LEU LEU A . n A 1 116 LEU 116 361 361 LEU LEU A . n A 1 117 GLY 117 362 362 GLY GLY A . n A 1 118 SER 118 363 ? ? ? A . n A 1 119 LYS 119 364 ? ? ? A . n A 1 120 LYS 120 365 ? ? ? A . n A 1 121 SER 121 366 ? ? ? A . n A 1 122 PHE 122 367 ? ? ? A . n A 1 123 GLU 123 368 368 GLU GLU A . n A 1 124 ASP 124 369 369 ASP ASP A . n A 1 125 TRP 125 370 370 TRP TRP A . n A 1 126 ASP 126 371 371 ASP ASP A . n A 1 127 VAL 127 372 372 VAL VAL A . n A 1 128 VAL 128 373 373 VAL VAL A . n A 1 129 GLY 129 374 374 GLY GLY A . n A 1 130 VAL 130 375 375 VAL VAL A . n A 1 131 ALA 131 376 376 ALA ALA A . n A 1 132 LYS 132 377 377 LYS LYS A . n A 1 133 ASP 133 378 378 ASP ASP A . n A 1 134 LEU 134 379 379 LEU LEU A . n A 1 135 GLU 135 380 380 GLU GLU A . n A 1 136 SER 136 381 381 SER SER A . n A 1 137 ALA 137 382 382 ALA ALA A . n A 1 138 TRP 138 383 383 TRP TRP A . n A 1 139 LYS 139 384 384 LYS LYS A . n A 1 140 ARG 140 385 385 ARG ARG A . n A 1 141 ARG 141 386 386 ARG ARG A . n A 1 142 ALA 142 387 387 ALA ALA A . n A 1 143 ILE 143 388 388 ILE ILE A . n A 1 144 ALA 144 389 389 ALA ALA A . n A 1 145 GLU 145 390 390 GLU GLU A . n A 1 146 LEU 146 391 391 LEU LEU A . n A 1 147 ILE 147 392 392 ILE ILE A . n A 1 148 LYS 148 393 393 LYS LYS A . n A 1 149 LYS 149 394 394 LYS LYS A . n A 1 150 PHE 150 395 395 PHE PHE A . n A 1 151 GLN 151 396 396 GLN GLN A . n A 1 152 VAL 152 397 397 VAL VAL A . n A 1 153 SER 153 398 398 SER SER A . n A 1 154 ILE 154 399 399 ILE ILE A . n A 1 155 LEU 155 400 400 LEU LEU A . n A 1 156 GLU 156 401 401 GLU GLU A . n A 1 157 GLN 157 402 402 GLN GLN A . n A 1 158 CYS 158 403 403 CYS CYS A . n A 1 159 PHE 159 404 404 PHE PHE A . n A 1 160 ASP 160 405 405 ASP ASP A . n A 1 161 LYS 161 406 406 LYS LYS A . n A 1 162 PRO 162 407 407 PRO PRO A . n A 1 163 VAL 163 408 408 VAL VAL A . n A 1 164 PRO 164 409 409 PRO PRO A . n A 1 165 LEU 165 410 410 LEU LEU A . n A 1 166 ILE 166 411 411 ILE ILE A . n A 1 167 PRO 167 412 412 PRO PRO A . n A 1 168 GLN 168 413 413 GLN GLN A . n A 1 169 SER 169 414 414 SER SER A . n A 1 170 PRO 170 415 415 PRO PRO A . n A 1 171 LEU 171 416 416 LEU LEU A . n A 1 172 ASN 172 417 417 ASN ASN A . n A 1 173 ASN 173 418 418 ASN ASN A . n A 1 174 ASP 174 419 419 ASP ASP A . n A 1 175 ALA 175 420 420 ALA ALA A . n A 1 176 VAL 176 421 421 VAL VAL A . n A 1 177 ILE 177 422 422 ILE ILE A . n A 1 178 ASP 178 423 423 ASP ASP A . n A 1 179 ASN 179 424 424 ASN ASN A . n A 1 180 VAL 180 425 425 VAL VAL A . n A 1 181 ASN 181 426 426 ASN ASN A . n A 1 182 LYS 182 427 427 LYS LYS A . n A 1 183 ALA 183 428 428 ALA ALA A . n A 1 184 LEU 184 429 429 LEU LEU A . n A 1 185 GLN 185 430 430 GLN GLN A . n A 1 186 PHE 186 431 431 PHE PHE A . n A 1 187 ALA 187 432 432 ALA ALA A . n A 1 188 LEU 188 433 433 LEU LEU A . n A 1 189 TRP 189 434 434 TRP TRP A . n A 1 190 LEU 190 435 435 LEU LEU A . n A 1 191 THR 191 436 436 THR THR A . n A 1 192 GLU 192 437 437 GLU GLU A . n A 1 193 PHE 193 438 438 PHE PHE A . n A 1 194 TYR 194 439 439 TYR TYR A . n A 1 195 GLY 195 440 ? ? ? A . n A 1 196 SER 196 441 ? ? ? A . n A 1 197 GLU 197 442 ? ? ? A . n A 1 198 ASN 198 443 443 ASN ASN A . n A 1 199 GLU 199 444 444 GLU GLU A . n A 1 200 THR 200 445 445 THR THR A . n A 1 201 GLU 201 446 446 GLU GLU A . n A 1 202 ALA 202 447 447 ALA ALA A . n A 1 203 LEU 203 448 448 LEU LEU A . n A 1 204 GLY 204 449 449 GLY GLY A . n A 1 205 GLU 205 450 450 GLU GLU A . n A 1 206 LEU 206 451 451 LEU LEU A . n A 1 207 ARG 207 452 452 ARG ARG A . n A 1 208 PHE 208 453 453 PHE PHE A . n A 1 209 LEU 209 454 454 LEU LEU A . n A 1 210 ASP 210 455 455 ASP ASP A . n A 1 211 SER 211 456 456 SER SER A . n A 1 212 THR 212 457 457 THR THR A . n A 1 213 SER 213 458 458 SER SER A . n A 1 214 LYS 214 459 459 LYS LYS A . n A 1 215 ASN 215 460 460 ASN ASN A . n A 1 216 LEU 216 461 461 LEU LEU A . n A 1 217 LEU 217 462 462 LEU LEU A . n A 1 218 VAL 218 463 463 VAL VAL A . n A 1 219 ASP 219 464 464 ASP ASP A . n A 1 220 SER 220 465 465 SER SER A . n A 1 221 PHE 221 466 466 PHE PHE A . n A 1 222 LYS 222 467 467 LYS LYS A . n A 1 223 LYS 223 468 468 LYS LYS A . n A 1 224 PHE 224 469 469 PHE PHE A . n A 1 225 VAL 225 470 ? ? ? A . n A 1 226 GLN 226 471 ? ? ? A . n A 1 227 GLY 227 472 ? ? ? A . n A 1 228 ILE 228 473 ? ? ? A . n A 1 229 ASN 229 474 ? ? ? A . n A 1 230 SER 230 475 ? ? ? A . n A 1 231 LYS 231 476 ? ? ? A . n A 1 232 THR 232 477 477 THR THR A . n A 1 233 HIS 233 478 478 HIS HIS A . n A 1 234 VAL 234 479 479 VAL VAL A . n A 1 235 THR 235 480 480 THR THR A . n A 1 236 ARG 236 481 481 ARG ARG A . n A 1 237 ILE 237 482 482 ILE ILE A . n A 1 238 VAL 238 483 483 VAL VAL A . n A 1 239 GLU 239 484 484 GLU GLU A . n A 1 240 SER 240 485 485 SER SER A . n A 1 241 LEU 241 486 486 LEU LEU A . n A 1 242 GLU 242 487 487 GLU GLU A . n A 1 243 LYS 243 488 488 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2370 ? 1 MORE -10 ? 1 'SSA (A^2)' 21570 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-02-03 2 'Structure model' 1 1 2016-02-10 3 'Structure model' 1 2 2017-09-06 4 'Structure model' 1 3 2019-11-20 5 'Structure model' 1 4 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 4 'Structure model' '_pdbx_audit_support.funding_organization' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 34.6805 -13.9360 -5.2329 0.5556 ? 0.1383 ? -0.2509 ? 0.8724 ? -0.9131 ? 1.1755 ? 0.1996 ? 0.0872 ? -0.0803 ? 0.0324 ? -0.0280 ? 0.0635 ? 0.2314 ? -0.0730 ? 0.2986 ? 0.0368 ? 0.0950 ? -0.1430 ? 0.0508 ? 0.2725 ? 0.5776 ? 2 'X-RAY DIFFRACTION' ? refined 14.1761 -10.4472 8.2153 0.8051 ? 0.1067 ? 0.0160 ? 0.2400 ? -0.0107 ? 0.3692 ? 0.9722 ? 0.0086 ? -0.6383 ? 0.3270 ? -0.1790 ? 0.6038 ? -0.3387 ? 0.0103 ? -0.1688 ? 0.1796 ? 0.2174 ? -0.0790 ? 1.1963 ? 0.0225 ? -0.0460 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 443 ? ? A 488 ? ;chain 'A' and resseq 443:488 ; 2 'X-RAY DIFFRACTION' 2 ? ? A 256 ? ? A 439 ? ;chain 'A' and resseq 256:439 ; # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? RESOLVE ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLY _pdbx_validate_close_contact.auth_seq_id_1 292 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 295 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 258 ? ? -162.06 -34.29 2 1 MET A 266 ? ? -81.73 -121.66 3 1 ASN A 290 ? ? -120.92 -88.66 4 1 GLU A 291 ? ? -71.15 40.90 5 1 PHE A 338 ? ? -116.19 75.75 6 1 ASP A 455 ? ? -101.28 -87.60 7 1 THR A 457 ? ? 63.76 -26.13 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 246 ? A LYS 1 2 1 Y 1 A GLN 247 ? A GLN 2 3 1 Y 1 A LEU 248 ? A LEU 3 4 1 Y 1 A MET 249 ? A MET 4 5 1 Y 1 A LEU 250 ? A LEU 5 6 1 Y 1 A ASP 251 ? A ASP 6 7 1 Y 1 A GLY 252 ? A GLY 7 8 1 Y 1 A PRO 253 ? A PRO 8 9 1 Y 1 A LYS 254 ? A LYS 9 10 1 Y 1 A SER 255 ? A SER 10 11 1 Y 1 A SER 363 ? A SER 118 12 1 Y 1 A LYS 364 ? A LYS 119 13 1 Y 1 A LYS 365 ? A LYS 120 14 1 Y 1 A SER 366 ? A SER 121 15 1 Y 1 A PHE 367 ? A PHE 122 16 1 Y 1 A GLY 440 ? A GLY 195 17 1 Y 1 A SER 441 ? A SER 196 18 1 Y 1 A GLU 442 ? A GLU 197 19 1 Y 1 A VAL 470 ? A VAL 225 20 1 Y 1 A GLN 471 ? A GLN 226 21 1 Y 1 A GLY 472 ? A GLY 227 22 1 Y 1 A ILE 473 ? A ILE 228 23 1 Y 1 A ASN 474 ? A ASN 229 24 1 Y 1 A SER 475 ? A SER 230 25 1 Y 1 A LYS 476 ? A LYS 231 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Howard Hughes Medical Institute (HHMI)' 'United States' ? 1 'National Institutes of Health/Eunice Kennedy Shriver National Institute of Child Health & Human Development (NIH/NICHD)' 'United States' 5F32HD071692 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5COW _pdbx_initial_refinement_model.details ? #