data_5D7E # _entry.id 5D7E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5D7E WWPDB D_1000212749 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5D7E _pdbx_database_status.recvd_initial_deposition_date 2015-08-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Andrews, F.H.' 1 'Shanle, E.K.' 2 'Strahl, B.D.' 3 'Kutateladze, T.G.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Genes Dev.' _citation.journal_id_ASTM GEDEEP _citation.journal_id_CSD 2056 _citation.journal_id_ISSN 0890-9369 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 1795 _citation.page_last 1800 _citation.title 'Association of Taf14 with acetylated histone H3 directs gene transcription and the DNA damage response.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1101/gad.269977.115 _citation.pdbx_database_id_PubMed 26341557 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shanle, E.K.' 1 ? primary 'Andrews, F.H.' 2 ? primary 'Meriesh, H.' 3 ? primary 'McDaniel, S.L.' 4 ? primary 'Dronamraju, R.' 5 ? primary 'DiFiore, J.V.' 6 ? primary 'Jha, D.' 7 ? primary 'Wozniak, G.G.' 8 ? primary 'Bridgers, J.B.' 9 ? primary 'Kerschner, J.L.' 10 ? primary 'Krajewski, K.' 11 ? primary 'Martin, G.M.' 12 ? primary 'Morrison, A.J.' 13 ? primary 'Kutateladze, T.G.' 14 ? primary 'Strahl, B.D.' 15 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5D7E _cell.details ? _cell.formula_units_Z ? _cell.length_a 113.164 _cell.length_a_esd ? _cell.length_b 113.164 _cell.length_b_esd ? _cell.length_c 26.524 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5D7E _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcription initiation factor TFIID subunit 14' 16026.331 1 ? ? ? ? 2 polymer syn H3K9ac 904.988 1 ? ? ? ? 3 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 3 ? ? ? ? 4 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237 1 ? ? ? ? 5 water nat water 18.015 67 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Actin non-complementing mutant 1,Chromosome stability protein 10,SWI/SNF chromatin-remodeling complex subunit TAF14,SWI/SNF complex 29 kDa subunit,SWI/SNF complex subunit TAF14,TBP-associated factor 14,TBP-associated factor 30 kDa,Transcription factor G 30 kDa subunit,Transcription initiation factor TFIIF 30 kDa subunit ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;LGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIE EQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST ; ;LGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIE EQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST ; A ? 2 'polypeptide(L)' no yes 'AQTAR(ALY)ST' AQTARKST C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 GLY n 1 3 SER n 1 4 MET n 1 5 VAL n 1 6 ALA n 1 7 THR n 1 8 VAL n 1 9 LYS n 1 10 ARG n 1 11 THR n 1 12 ILE n 1 13 ARG n 1 14 ILE n 1 15 LYS n 1 16 THR n 1 17 GLN n 1 18 GLN n 1 19 HIS n 1 20 ILE n 1 21 LEU n 1 22 PRO n 1 23 GLU n 1 24 VAL n 1 25 PRO n 1 26 PRO n 1 27 VAL n 1 28 GLU n 1 29 ASN n 1 30 PHE n 1 31 PRO n 1 32 VAL n 1 33 ARG n 1 34 GLN n 1 35 TRP n 1 36 SER n 1 37 ILE n 1 38 GLU n 1 39 ILE n 1 40 VAL n 1 41 LEU n 1 42 LEU n 1 43 ASP n 1 44 ASP n 1 45 GLU n 1 46 GLY n 1 47 LYS n 1 48 GLU n 1 49 ILE n 1 50 PRO n 1 51 ALA n 1 52 THR n 1 53 ILE n 1 54 PHE n 1 55 ASP n 1 56 LYS n 1 57 VAL n 1 58 ILE n 1 59 TYR n 1 60 HIS n 1 61 LEU n 1 62 HIS n 1 63 PRO n 1 64 THR n 1 65 PHE n 1 66 ALA n 1 67 ASN n 1 68 PRO n 1 69 ASN n 1 70 ARG n 1 71 THR n 1 72 PHE n 1 73 THR n 1 74 ASP n 1 75 PRO n 1 76 PRO n 1 77 PHE n 1 78 ARG n 1 79 ILE n 1 80 GLU n 1 81 GLU n 1 82 GLN n 1 83 GLY n 1 84 TRP n 1 85 GLY n 1 86 GLY n 1 87 PHE n 1 88 PRO n 1 89 LEU n 1 90 ASP n 1 91 ILE n 1 92 SER n 1 93 VAL n 1 94 PHE n 1 95 LEU n 1 96 LEU n 1 97 GLU n 1 98 LYS n 1 99 ALA n 1 100 GLY n 1 101 GLU n 1 102 ARG n 1 103 LYS n 1 104 ILE n 1 105 PRO n 1 106 HIS n 1 107 ASP n 1 108 LEU n 1 109 ASN n 1 110 PHE n 1 111 LEU n 1 112 GLN n 1 113 GLU n 1 114 SER n 1 115 TYR n 1 116 GLU n 1 117 VAL n 1 118 GLU n 1 119 HIS n 1 120 VAL n 1 121 ILE n 1 122 GLN n 1 123 ILE n 1 124 PRO n 1 125 LEU n 1 126 ASN n 1 127 LYS n 1 128 PRO n 1 129 LEU n 1 130 LEU n 1 131 THR n 1 132 GLU n 1 133 GLU n 1 134 LEU n 1 135 ALA n 1 136 LYS n 1 137 SER n 1 138 GLY n 1 139 SER n 1 140 THR n 2 1 ALA n 2 2 GLN n 2 3 THR n 2 4 ALA n 2 5 ARG n 2 6 ALY n 2 7 SER n 2 8 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 140 _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TAF14, ANC1, CST10, SWP29, TAF30, TFG3, YPL129W' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 8 _pdbx_entity_src_syn.organism_scientific 'Saccharomyces cerevisiae' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 4932 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP TAF14_YEAST P35189 ? 1 ;MVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQG WGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST ; 1 2 PDB 5D7E 5D7E ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5D7E A 4 ? 140 ? P35189 1 ? 137 ? 1 137 2 2 5D7E C 1 ? 8 ? 5D7E 3 ? 10 ? 3 10 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5D7E LEU A 1 ? UNP P35189 ? ? 'expression tag' -2 1 1 5D7E GLY A 2 ? UNP P35189 ? ? 'expression tag' -1 2 1 5D7E SER A 3 ? UNP P35189 ? ? 'expression tag' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3' 188.224 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MES non-polymer . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S' 195.237 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5D7E _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.90 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M sodium citrate and 48% PEG600 (v/v)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type NOIR-1 _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-11-06 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 4.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 4.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5D7E _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.90 _reflns.d_resolution_low 56.52 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15763 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.2 _reflns.pdbx_Rmerge_I_obs 0.048 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.048 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 30.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.97 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.66 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5D7E _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.900 _refine.ls_d_res_low 56 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15750 _refine.ls_number_reflns_R_free 792 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.97 _refine.ls_percent_reflns_R_free 5.03 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1863 _refine.ls_R_factor_R_free 0.2179 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1847 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.60 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.21 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1194 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 67 _refine_hist.number_atoms_total 1294 _refine_hist.d_res_high 1.900 _refine_hist.d_res_low 56 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1273 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.220 ? 1725 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.501 ? 493 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.052 ? 191 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 223 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9000 2.0191 . . 127 2448 100.00 . . . 0.2848 . 0.2119 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0191 2.1750 . . 132 2456 100.00 . . . 0.2291 . 0.1840 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1750 2.3938 . . 126 2476 100.00 . . . 0.2502 . 0.1900 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3938 2.7402 . . 134 2463 100.00 . . . 0.2247 . 0.1899 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7402 3.4524 . . 133 2521 100.00 . . . 0.2327 . 0.1923 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4524 . . . 140 2594 100.00 . . . 0.1924 . 0.1746 . . . . . . . . . . # _struct.entry_id 5D7E _struct.title 'Crystal structure of Taf14 YEATS domain in complex with H3K9ac' _struct.pdbx_descriptor 'Transcription initiation factor TFIID subunit 14, H3K9ac' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5D7E _struct_keywords.text 'acetylation histone YEATS reader, NUCLEAR PROTEIN' _struct_keywords.pdbx_keywords 'NUCLEAR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? H N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 1 ? VAL A 5 ? LEU A -2 VAL A 2 5 ? 5 HELX_P HELX_P2 AA2 GLU A 97 ? ALA A 99 ? GLU A 94 ALA A 96 5 ? 3 HELX_P HELX_P3 AA3 LYS A 127 ? ALA A 135 ? LYS A 124 ALA A 132 1 ? 9 HELX_P HELX_P4 AA4 LYS A 136 ? GLY A 138 ? LYS A 133 GLY A 135 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? B ARG 5 C ? ? ? 1_555 B ALY 6 N ? ? C ARG 7 C ALY 8 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale both ? B ALY 6 C ? ? ? 1_555 B SER 7 N ? ? C ALY 8 C SER 9 1_555 ? ? ? ? ? ? ? 1.335 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 75 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 72 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 76 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 73 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.64 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 48 ? PRO A 50 ? GLU A 45 PRO A 47 AA1 2 ARG A 33 ? LEU A 42 ? ARG A 30 LEU A 39 AA1 3 ILE A 79 ? GLY A 83 ? ILE A 76 GLY A 80 AA2 1 GLU A 48 ? PRO A 50 ? GLU A 45 PRO A 47 AA2 2 ARG A 33 ? LEU A 42 ? ARG A 30 LEU A 39 AA2 3 THR A 7 ? ILE A 20 ? THR A 4 ILE A 17 AA2 4 SER A 114 ? PRO A 124 ? SER A 111 PRO A 121 AA3 1 ASN A 69 ? PHE A 72 ? ASN A 66 PHE A 69 AA3 2 PHE A 54 ? HIS A 60 ? PHE A 51 HIS A 57 AA3 3 PHE A 87 ? LEU A 95 ? PHE A 84 LEU A 92 AA3 4 GLY A 100 ? LEU A 108 ? GLY A 97 LEU A 105 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 49 ? O ILE A 46 N LEU A 41 ? N LEU A 38 AA1 2 3 N ARG A 33 ? N ARG A 30 O GLY A 83 ? O GLY A 80 AA2 1 2 O ILE A 49 ? O ILE A 46 N LEU A 41 ? N LEU A 38 AA2 2 3 O GLN A 34 ? O GLN A 31 N HIS A 19 ? N HIS A 16 AA2 3 4 N VAL A 8 ? N VAL A 5 O ILE A 123 ? O ILE A 120 AA3 1 2 O PHE A 72 ? O PHE A 69 N VAL A 57 ? N VAL A 54 AA3 2 3 N ILE A 58 ? N ILE A 55 O SER A 92 ? O SER A 89 AA3 3 4 N LEU A 89 ? N LEU A 86 O HIS A 106 ? O HIS A 103 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A PEG 201 ? 4 'binding site for residue PEG A 201' AC2 Software A PEG 202 ? 2 'binding site for residue PEG A 202' AC3 Software A PEG 203 ? 4 'binding site for residue PEG A 203' AC4 Software A MES 204 ? 1 'binding site for residue MES A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 23 ? GLU A 20 . ? 2_654 ? 2 AC1 4 LYS A 56 ? LYS A 53 . ? 1_555 ? 3 AC1 4 THR A 71 ? THR A 68 . ? 1_555 ? 4 AC1 4 GLU A 132 ? GLU A 129 . ? 4_654 ? 5 AC2 2 LYS A 98 ? LYS A 95 . ? 4_655 ? 6 AC2 2 LYS A 136 ? LYS A 133 . ? 1_555 ? 7 AC3 4 GLU A 97 ? GLU A 94 . ? 1_555 ? 8 AC3 4 GLU A 101 ? GLU A 98 . ? 4_655 ? 9 AC3 4 LYS A 103 ? LYS A 100 . ? 4_655 ? 10 AC3 4 LYS A 127 ? LYS A 124 . ? 1_555 ? 11 AC4 1 TRP A 84 ? TRP A 81 . ? 1_555 ? # _atom_sites.entry_id 5D7E _atom_sites.fract_transf_matrix[1][1] 0.008837 _atom_sites.fract_transf_matrix[1][2] 0.005102 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010204 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.037702 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 -2 -2 LEU LEU A . n A 1 2 GLY 2 -1 -1 GLY GLY A . n A 1 3 SER 3 0 0 SER SER A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 VAL 5 2 2 VAL VAL A . n A 1 6 ALA 6 3 3 ALA ALA A . n A 1 7 THR 7 4 4 THR THR A . n A 1 8 VAL 8 5 5 VAL VAL A . n A 1 9 LYS 9 6 6 LYS LYS A . n A 1 10 ARG 10 7 7 ARG ARG A . n A 1 11 THR 11 8 8 THR THR A . n A 1 12 ILE 12 9 9 ILE ILE A . n A 1 13 ARG 13 10 10 ARG ARG A . n A 1 14 ILE 14 11 11 ILE ILE A . n A 1 15 LYS 15 12 12 LYS LYS A . n A 1 16 THR 16 13 13 THR THR A . n A 1 17 GLN 17 14 14 GLN GLN A . n A 1 18 GLN 18 15 15 GLN GLN A . n A 1 19 HIS 19 16 16 HIS HIS A . n A 1 20 ILE 20 17 17 ILE ILE A . n A 1 21 LEU 21 18 18 LEU LEU A . n A 1 22 PRO 22 19 19 PRO PRO A . n A 1 23 GLU 23 20 20 GLU GLU A . n A 1 24 VAL 24 21 21 VAL VAL A . n A 1 25 PRO 25 22 22 PRO PRO A . n A 1 26 PRO 26 23 23 PRO PRO A . n A 1 27 VAL 27 24 24 VAL VAL A . n A 1 28 GLU 28 25 25 GLU GLU A . n A 1 29 ASN 29 26 26 ASN ASN A . n A 1 30 PHE 30 27 27 PHE PHE A . n A 1 31 PRO 31 28 28 PRO PRO A . n A 1 32 VAL 32 29 29 VAL VAL A . n A 1 33 ARG 33 30 30 ARG ARG A . n A 1 34 GLN 34 31 31 GLN GLN A . n A 1 35 TRP 35 32 32 TRP TRP A . n A 1 36 SER 36 33 33 SER SER A . n A 1 37 ILE 37 34 34 ILE ILE A . n A 1 38 GLU 38 35 35 GLU GLU A . n A 1 39 ILE 39 36 36 ILE ILE A . n A 1 40 VAL 40 37 37 VAL VAL A . n A 1 41 LEU 41 38 38 LEU LEU A . n A 1 42 LEU 42 39 39 LEU LEU A . n A 1 43 ASP 43 40 40 ASP ASP A . n A 1 44 ASP 44 41 41 ASP ASP A . n A 1 45 GLU 45 42 42 GLU GLU A . n A 1 46 GLY 46 43 43 GLY GLY A . n A 1 47 LYS 47 44 44 LYS LYS A . n A 1 48 GLU 48 45 45 GLU GLU A . n A 1 49 ILE 49 46 46 ILE ILE A . n A 1 50 PRO 50 47 47 PRO PRO A . n A 1 51 ALA 51 48 48 ALA ALA A . n A 1 52 THR 52 49 49 THR THR A . n A 1 53 ILE 53 50 50 ILE ILE A . n A 1 54 PHE 54 51 51 PHE PHE A . n A 1 55 ASP 55 52 52 ASP ASP A . n A 1 56 LYS 56 53 53 LYS LYS A . n A 1 57 VAL 57 54 54 VAL VAL A . n A 1 58 ILE 58 55 55 ILE ILE A . n A 1 59 TYR 59 56 56 TYR TYR A . n A 1 60 HIS 60 57 57 HIS HIS A . n A 1 61 LEU 61 58 58 LEU LEU A . n A 1 62 HIS 62 59 59 HIS HIS A . n A 1 63 PRO 63 60 60 PRO PRO A . n A 1 64 THR 64 61 61 THR THR A . n A 1 65 PHE 65 62 62 PHE PHE A . n A 1 66 ALA 66 63 63 ALA ALA A . n A 1 67 ASN 67 64 64 ASN ASN A . n A 1 68 PRO 68 65 65 PRO PRO A . n A 1 69 ASN 69 66 66 ASN ASN A . n A 1 70 ARG 70 67 67 ARG ARG A . n A 1 71 THR 71 68 68 THR THR A . n A 1 72 PHE 72 69 69 PHE PHE A . n A 1 73 THR 73 70 70 THR THR A . n A 1 74 ASP 74 71 71 ASP ASP A . n A 1 75 PRO 75 72 72 PRO PRO A . n A 1 76 PRO 76 73 73 PRO PRO A . n A 1 77 PHE 77 74 74 PHE PHE A . n A 1 78 ARG 78 75 75 ARG ARG A . n A 1 79 ILE 79 76 76 ILE ILE A . n A 1 80 GLU 80 77 77 GLU GLU A . n A 1 81 GLU 81 78 78 GLU GLU A . n A 1 82 GLN 82 79 79 GLN GLN A . n A 1 83 GLY 83 80 80 GLY GLY A . n A 1 84 TRP 84 81 81 TRP TRP A . n A 1 85 GLY 85 82 82 GLY GLY A . n A 1 86 GLY 86 83 83 GLY GLY A . n A 1 87 PHE 87 84 84 PHE PHE A . n A 1 88 PRO 88 85 85 PRO PRO A . n A 1 89 LEU 89 86 86 LEU LEU A . n A 1 90 ASP 90 87 87 ASP ASP A . n A 1 91 ILE 91 88 88 ILE ILE A . n A 1 92 SER 92 89 89 SER SER A . n A 1 93 VAL 93 90 90 VAL VAL A . n A 1 94 PHE 94 91 91 PHE PHE A . n A 1 95 LEU 95 92 92 LEU LEU A . n A 1 96 LEU 96 93 93 LEU LEU A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 LYS 98 95 95 LYS LYS A . n A 1 99 ALA 99 96 96 ALA ALA A . n A 1 100 GLY 100 97 97 GLY GLY A . n A 1 101 GLU 101 98 98 GLU GLU A . n A 1 102 ARG 102 99 99 ARG ARG A . n A 1 103 LYS 103 100 100 LYS LYS A . n A 1 104 ILE 104 101 101 ILE ILE A . n A 1 105 PRO 105 102 102 PRO PRO A . n A 1 106 HIS 106 103 103 HIS HIS A . n A 1 107 ASP 107 104 104 ASP ASP A . n A 1 108 LEU 108 105 105 LEU LEU A . n A 1 109 ASN 109 106 106 ASN ASN A . n A 1 110 PHE 110 107 107 PHE PHE A . n A 1 111 LEU 111 108 108 LEU LEU A . n A 1 112 GLN 112 109 109 GLN GLN A . n A 1 113 GLU 113 110 110 GLU GLU A . n A 1 114 SER 114 111 111 SER SER A . n A 1 115 TYR 115 112 112 TYR TYR A . n A 1 116 GLU 116 113 113 GLU GLU A . n A 1 117 VAL 117 114 114 VAL VAL A . n A 1 118 GLU 118 115 115 GLU GLU A . n A 1 119 HIS 119 116 116 HIS HIS A . n A 1 120 VAL 120 117 117 VAL VAL A . n A 1 121 ILE 121 118 118 ILE ILE A . n A 1 122 GLN 122 119 119 GLN GLN A . n A 1 123 ILE 123 120 120 ILE ILE A . n A 1 124 PRO 124 121 121 PRO PRO A . n A 1 125 LEU 125 122 122 LEU LEU A . n A 1 126 ASN 126 123 123 ASN ASN A . n A 1 127 LYS 127 124 124 LYS LYS A . n A 1 128 PRO 128 125 125 PRO PRO A . n A 1 129 LEU 129 126 126 LEU LEU A . n A 1 130 LEU 130 127 127 LEU LEU A . n A 1 131 THR 131 128 128 THR THR A . n A 1 132 GLU 132 129 129 GLU GLU A . n A 1 133 GLU 133 130 130 GLU GLU A . n A 1 134 LEU 134 131 131 LEU LEU A . n A 1 135 ALA 135 132 132 ALA ALA A . n A 1 136 LYS 136 133 133 LYS LYS A . n A 1 137 SER 137 134 134 SER SER A . n A 1 138 GLY 138 135 135 GLY GLY A . n A 1 139 SER 139 136 136 SER SER A . n A 1 140 THR 140 137 137 THR THR A . n B 2 1 ALA 1 3 3 ALA ALA C . n B 2 2 GLN 2 4 4 GLN GLN C . n B 2 3 THR 3 5 5 THR THR C . n B 2 4 ALA 4 6 6 ALA ALA C . n B 2 5 ARG 5 7 7 ARG ARG C . n B 2 6 ALY 6 8 8 ALY ALY C . n B 2 7 SER 7 9 9 SER SER C . n B 2 8 THR 8 10 10 THR THR C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 PEG 1 201 1 PEG PEG A . D 3 PEG 1 202 2 PEG PEG A . E 3 PEG 1 203 3 PEG PEG A . F 4 MES 1 204 1 MES MES A . G 5 HOH 1 301 5 HOH HOH A . G 5 HOH 2 302 40 HOH HOH A . G 5 HOH 3 303 29 HOH HOH A . G 5 HOH 4 304 58 HOH HOH A . G 5 HOH 5 305 38 HOH HOH A . G 5 HOH 6 306 16 HOH HOH A . G 5 HOH 7 307 67 HOH HOH A . G 5 HOH 8 308 62 HOH HOH A . G 5 HOH 9 309 27 HOH HOH A . G 5 HOH 10 310 18 HOH HOH A . G 5 HOH 11 311 9 HOH HOH A . G 5 HOH 12 312 13 HOH HOH A . G 5 HOH 13 313 45 HOH HOH A . G 5 HOH 14 314 51 HOH HOH A . G 5 HOH 15 315 20 HOH HOH A . G 5 HOH 16 316 6 HOH HOH A . G 5 HOH 17 317 37 HOH HOH A . G 5 HOH 18 318 14 HOH HOH A . G 5 HOH 19 319 3 HOH HOH A . G 5 HOH 20 320 4 HOH HOH A . G 5 HOH 21 321 41 HOH HOH A . G 5 HOH 22 322 56 HOH HOH A . G 5 HOH 23 323 1 HOH HOH A . G 5 HOH 24 324 26 HOH HOH A . G 5 HOH 25 325 52 HOH HOH A . G 5 HOH 26 326 28 HOH HOH A . G 5 HOH 27 327 48 HOH HOH A . G 5 HOH 28 328 7 HOH HOH A . G 5 HOH 29 329 22 HOH HOH A . G 5 HOH 30 330 64 HOH HOH A . G 5 HOH 31 331 31 HOH HOH A . G 5 HOH 32 332 24 HOH HOH A . G 5 HOH 33 333 21 HOH HOH A . G 5 HOH 34 334 11 HOH HOH A . G 5 HOH 35 335 49 HOH HOH A . G 5 HOH 36 336 33 HOH HOH A . G 5 HOH 37 337 44 HOH HOH A . G 5 HOH 38 338 63 HOH HOH A . G 5 HOH 39 339 2 HOH HOH A . G 5 HOH 40 340 50 HOH HOH A . G 5 HOH 41 341 23 HOH HOH A . G 5 HOH 42 342 25 HOH HOH A . G 5 HOH 43 343 36 HOH HOH A . G 5 HOH 44 344 54 HOH HOH A . G 5 HOH 45 345 8 HOH HOH A . G 5 HOH 46 346 30 HOH HOH A . G 5 HOH 47 347 35 HOH HOH A . G 5 HOH 48 348 42 HOH HOH A . G 5 HOH 49 349 60 HOH HOH A . G 5 HOH 50 350 43 HOH HOH A . G 5 HOH 51 351 17 HOH HOH A . G 5 HOH 52 352 47 HOH HOH A . G 5 HOH 53 353 34 HOH HOH A . G 5 HOH 54 354 53 HOH HOH A . G 5 HOH 55 355 39 HOH HOH A . G 5 HOH 56 356 61 HOH HOH A . G 5 HOH 57 357 19 HOH HOH A . G 5 HOH 58 358 46 HOH HOH A . G 5 HOH 59 359 55 HOH HOH A . G 5 HOH 60 360 59 HOH HOH A . G 5 HOH 61 361 65 HOH HOH A . H 5 HOH 1 101 15 HOH HOH C . H 5 HOH 2 102 10 HOH HOH C . H 5 HOH 3 103 12 HOH HOH C . H 5 HOH 4 104 66 HOH HOH C . H 5 HOH 5 105 32 HOH HOH C . H 5 HOH 6 106 57 HOH HOH C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1280 ? 1 MORE -3 ? 1 'SSA (A^2)' 9160 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-23 2 'Structure model' 1 1 2017-09-20 3 'Structure model' 1 2 2019-12-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_audit_support 3 2 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_CSD' 2 2 'Structure model' '_pdbx_audit_support.funding_organization' 3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 3 'Structure model' '_pdbx_audit_support.funding_organization' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 43.7059 _pdbx_refine_tls.origin_y 13.7370 _pdbx_refine_tls.origin_z 1.3062 _pdbx_refine_tls.T[1][1] 0.2380 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0392 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0064 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.1983 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0402 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.2042 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.0994 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -2.4508 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.5902 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 5.9918 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.7938 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.9006 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0866 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0594 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0525 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0932 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.1194 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.2075 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.1037 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.1338 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0464 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.2_1309 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? d*TREK ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 3 ? ? -85.83 49.83 2 1 PRO A 60 ? ? -68.74 0.90 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 C ALA 3 ? N ? B ALA 1 N 2 1 Y 1 C ALA 3 ? CB ? B ALA 1 CB # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM110058 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM100907 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' K12-GM000678 3 'National Institutes of Health/National Institute on Alcohol Abuse and Alcoholism (NIH/NIAAA)' 'United States' T32AA007464 4 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'DI(HYDROXYETHYL)ETHER' PEG 4 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 5 water HOH #