data_5DAD # _entry.id 5DAD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5DAD pdb_00005dad 10.2210/pdb5dad/pdb WWPDB D_1000212860 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5DAF _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DAD _pdbx_database_status.recvd_initial_deposition_date 2015-08-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Huerta, C.' 1 'Jiang, X.' 2 'Trevino, I.' 3 'Bender, C.F.' 4 'Swinger, K.K.' 5 'Stoll, V.S.' 6 'Ferguson, D.A.' 7 'Thomas, P.J.' 8 'Probst, B.' 9 'Dulubova, I.' 10 'Visnick, M.' 11 'Wigley, W.C.' 12 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_id_ASTM BBACAQ _citation.journal_id_CSD 0113 _citation.journal_id_ISSN 0006-3002 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 1860 _citation.language ? _citation.page_first 2537 _citation.page_last 2552 _citation.title 'Characterization of novel small-molecule NRF2 activators: Structural and biochemical validation of stereospecific KEAP1 binding.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbagen.2016.07.026 _citation.pdbx_database_id_PubMed 27474998 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huerta, C.' 1 ? primary 'Jiang, X.' 2 ? primary 'Trevino, I.' 3 ? primary 'Bender, C.F.' 4 ? primary 'Ferguson, D.A.' 5 ? primary 'Probst, B.' 6 ? primary 'Swinger, K.K.' 7 ? primary 'Stoll, V.S.' 8 ? primary 'Thomas, P.J.' 9 ? primary 'Dulubova, I.' 10 ? primary 'Visnick, M.' 11 ? primary 'Wigley, W.C.' 12 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5DAD _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.220 _cell.length_a_esd ? _cell.length_b 43.220 _cell.length_b_esd ? _cell.length_c 135.171 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DAD _symmetry.cell_setting ? _symmetry.Int_Tables_number 151 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 1 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Kelch-like ECH-associated protein 1' 15594.950 1 ? ? 'BTB domain, residues 49-182' ? 2 non-polymer syn '(6aS,7S,10aS)-8-hydroxy-4-methoxy-2,7,10a-trimethyl-5,6,6a,7,10,10a-hexahydrobenzo[h]quinazoline-9-carbonitrile' 299.368 1 ? ? ? ? 3 water nat water 18.015 9 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytosolic inhibitor of Nrf2,INrf2,Kelch-like protein 19' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMASNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEV VSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMASNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEV VSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 SER n 1 7 ASN n 1 8 ARG n 1 9 THR n 1 10 PHE n 1 11 SER n 1 12 TYR n 1 13 THR n 1 14 LEU n 1 15 GLU n 1 16 ASP n 1 17 HIS n 1 18 THR n 1 19 LYS n 1 20 GLN n 1 21 ALA n 1 22 PHE n 1 23 GLY n 1 24 ILE n 1 25 MET n 1 26 ASN n 1 27 GLU n 1 28 LEU n 1 29 ARG n 1 30 LEU n 1 31 SER n 1 32 GLN n 1 33 GLN n 1 34 LEU n 1 35 CYS n 1 36 ASP n 1 37 VAL n 1 38 THR n 1 39 LEU n 1 40 GLN n 1 41 VAL n 1 42 LYS n 1 43 TYR n 1 44 GLN n 1 45 ASP n 1 46 ALA n 1 47 PRO n 1 48 ALA n 1 49 ALA n 1 50 GLN n 1 51 PHE n 1 52 MET n 1 53 ALA n 1 54 HIS n 1 55 LYS n 1 56 VAL n 1 57 VAL n 1 58 LEU n 1 59 ALA n 1 60 SER n 1 61 SER n 1 62 SER n 1 63 PRO n 1 64 VAL n 1 65 PHE n 1 66 LYS n 1 67 ALA n 1 68 MET n 1 69 PHE n 1 70 THR n 1 71 ASN n 1 72 GLY n 1 73 LEU n 1 74 ARG n 1 75 GLU n 1 76 GLN n 1 77 GLY n 1 78 MET n 1 79 GLU n 1 80 VAL n 1 81 VAL n 1 82 SER n 1 83 ILE n 1 84 GLU n 1 85 GLY n 1 86 ILE n 1 87 HIS n 1 88 PRO n 1 89 LYS n 1 90 VAL n 1 91 MET n 1 92 GLU n 1 93 ARG n 1 94 LEU n 1 95 ILE n 1 96 GLU n 1 97 PHE n 1 98 ALA n 1 99 TYR n 1 100 THR n 1 101 ALA n 1 102 SER n 1 103 ILE n 1 104 SER n 1 105 MET n 1 106 GLY n 1 107 GLU n 1 108 LYS n 1 109 CYS n 1 110 VAL n 1 111 LEU n 1 112 HIS n 1 113 VAL n 1 114 MET n 1 115 ASN n 1 116 GLY n 1 117 ALA n 1 118 VAL n 1 119 MET n 1 120 TYR n 1 121 GLN n 1 122 ILE n 1 123 ASP n 1 124 SER n 1 125 VAL n 1 126 VAL n 1 127 ARG n 1 128 ALA n 1 129 CYS n 1 130 SER n 1 131 ASP n 1 132 PHE n 1 133 LEU n 1 134 VAL n 1 135 GLN n 1 136 GLN n 1 137 LEU n 1 138 ASP n 1 139 PRO n 1 140 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 140 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KEAP1, INRF2, KIAA0132, KLHL19' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-CodonPlus(DE3)-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KEAP1_HUMAN _struct_ref.pdbx_db_accession Q14145 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGI HPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPS ; _struct_ref.pdbx_align_begin 49 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5DAD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14145 _struct_ref_seq.db_align_beg 49 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 182 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 49 _struct_ref_seq.pdbx_auth_seq_align_end 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5DAD GLY A 1 ? UNP Q14145 ? ? 'expression tag' 43 1 1 5DAD SER A 2 ? UNP Q14145 ? ? 'expression tag' 44 2 1 5DAD HIS A 3 ? UNP Q14145 ? ? 'expression tag' 45 3 1 5DAD MET A 4 ? UNP Q14145 ? ? 'expression tag' 46 4 1 5DAD ALA A 5 ? UNP Q14145 ? ? 'expression tag' 47 5 1 5DAD SER A 6 ? UNP Q14145 ? ? 'expression tag' 48 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TX6 non-polymer . '(6aS,7S,10aS)-8-hydroxy-4-methoxy-2,7,10a-trimethyl-5,6,6a,7,10,10a-hexahydrobenzo[h]quinazoline-9-carbonitrile' ? 'C17 H21 N3 O2' 299.368 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DAD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.37 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Potassium Thiocyanate, 30% w/v PEG MME 2000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details Pixel _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-11-28 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5DAD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.605 _reflns.d_resolution_low 135.171 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4678 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.400 _reflns.pdbx_Rmerge_I_obs 0.043 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 32.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 44180 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.605 2.614 ? 5.5 411 ? ? 39 ? 100.000 ? ? ? ? 0.462 ? ? ? ? ? ? ? ? 10.500 ? ? ? ? ? ? 0 1 1 ? ? 12.091 135.171 ? ? 415 ? ? 61 ? 100.000 ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 6.800 ? ? ? ? ? ? 0 2 1 ? ? # _refine.aniso_B[1][1] 1.3500 _refine.aniso_B[1][2] 0.6800 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.3500 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -2.0300 _refine.B_iso_max 102.910 _refine.B_iso_mean 63.4380 _refine.B_iso_min 41.990 _refine.correlation_coeff_Fo_to_Fc 0.9570 _refine.correlation_coeff_Fo_to_Fc_free 0.9360 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DAD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6100 _refine.ls_d_res_low 45.0600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4431 _refine.ls_number_reflns_R_free 214 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9100 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2056 _refine.ls_R_factor_R_free 0.2448 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2036 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2442 _refine.ls_wR_factor_R_work 0.1975 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5DAF _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.7810 _refine.pdbx_overall_ESU_R_Free 0.3060 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 12.8360 _refine.overall_SU_ML 0.2560 _refine.overall_SU_R_Cruickshank_DPI 0.7813 _refine.overall_SU_R_free 0.3063 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.7795 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.6100 _refine_hist.d_res_low 45.0600 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 990 _refine_hist.pdbx_number_residues_total 123 _refine_hist.pdbx_B_iso_mean_ligand 79.77 _refine_hist.pdbx_B_iso_mean_solvent 54.97 _refine_hist.pdbx_number_atoms_protein 959 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 0.020 1000 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.958 1.982 1355 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 4.075 5.000 121 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 31.676 24.878 41 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.999 15.000 176 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 8.327 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.070 0.200 159 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 726 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.6050 _refine_ls_shell.d_res_low 2.6730 _refine_ls_shell.number_reflns_all 305 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 9 _refine_ls_shell.number_reflns_R_work 296 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2260 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2600 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5DAD _struct.title 'Crystal Structure of Human KEAP1 BTB Domain in Complex with Small Molecule TX64014' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DAD _struct_keywords.text 'KEAP1, Trascription Regulation, BTB domain, Cysteine Modification, C1-(R)-Cys151 adduct, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 16 ? SER A 31 ? ASP A 58 SER A 73 1 ? 16 HELX_P HELX_P2 AA2 HIS A 54 ? SER A 60 ? HIS A 96 SER A 102 1 ? 7 HELX_P HELX_P3 AA3 SER A 62 ? THR A 70 ? SER A 104 THR A 112 1 ? 9 HELX_P HELX_P4 AA4 HIS A 87 ? ALA A 101 ? HIS A 129 ALA A 143 1 ? 15 HELX_P HELX_P5 AA5 GLY A 106 ? LYS A 108 ? GLY A 148 LYS A 150 5 ? 3 HELX_P HELX_P6 AA6 CYS A 109 ? TYR A 120 ? CYS A 151 TYR A 162 1 ? 12 HELX_P HELX_P7 AA7 ILE A 122 ? GLN A 136 ? ILE A 164 GLN A 178 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 109 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id TX6 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 151 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id TX6 _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.753 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 49 ? ALA A 53 ? ALA A 91 ALA A 95 AA1 2 VAL A 37 ? LYS A 42 ? VAL A 79 LYS A 84 AA1 3 GLU A 79 ? GLU A 84 ? GLU A 121 GLU A 126 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 51 ? O PHE A 93 N LEU A 39 ? N LEU A 81 AA1 2 3 N GLN A 40 ? N GLN A 82 O VAL A 81 ? O VAL A 123 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id TX6 _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'binding site for residue TX6 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 TYR A 43 ? TYR A 85 . ? 1_555 ? 2 AC1 8 HIS A 87 ? HIS A 129 . ? 1_555 ? 3 AC1 8 VAL A 90 ? VAL A 132 . ? 1_555 ? 4 AC1 8 MET A 105 ? MET A 147 . ? 1_555 ? 5 AC1 8 GLY A 106 ? GLY A 148 . ? 1_555 ? 6 AC1 8 LYS A 108 ? LYS A 150 . ? 1_555 ? 7 AC1 8 CYS A 109 ? CYS A 151 . ? 1_555 ? 8 AC1 8 HIS A 112 ? HIS A 154 . ? 1_555 ? # _atom_sites.entry_id 5DAD _atom_sites.fract_transf_matrix[1][1] 0.023137 _atom_sites.fract_transf_matrix[1][2] 0.013358 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026717 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007398 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 43 ? ? ? A . n A 1 2 SER 2 44 ? ? ? A . n A 1 3 HIS 3 45 ? ? ? A . n A 1 4 MET 4 46 ? ? ? A . n A 1 5 ALA 5 47 ? ? ? A . n A 1 6 SER 6 48 ? ? ? A . n A 1 7 ASN 7 49 ? ? ? A . n A 1 8 ARG 8 50 50 ARG ARG A . n A 1 9 THR 9 51 51 THR THR A . n A 1 10 PHE 10 52 52 PHE PHE A . n A 1 11 SER 11 53 53 SER SER A . n A 1 12 TYR 12 54 54 TYR TYR A . n A 1 13 THR 13 55 55 THR THR A . n A 1 14 LEU 14 56 56 LEU LEU A . n A 1 15 GLU 15 57 57 GLU GLU A . n A 1 16 ASP 16 58 58 ASP ASP A . n A 1 17 HIS 17 59 59 HIS HIS A . n A 1 18 THR 18 60 60 THR THR A . n A 1 19 LYS 19 61 61 LYS LYS A . n A 1 20 GLN 20 62 62 GLN GLN A . n A 1 21 ALA 21 63 63 ALA ALA A . n A 1 22 PHE 22 64 64 PHE PHE A . n A 1 23 GLY 23 65 65 GLY GLY A . n A 1 24 ILE 24 66 66 ILE ILE A . n A 1 25 MET 25 67 67 MET MET A . n A 1 26 ASN 26 68 68 ASN ASN A . n A 1 27 GLU 27 69 69 GLU GLU A . n A 1 28 LEU 28 70 70 LEU LEU A . n A 1 29 ARG 29 71 71 ARG ARG A . n A 1 30 LEU 30 72 72 LEU LEU A . n A 1 31 SER 31 73 73 SER SER A . n A 1 32 GLN 32 74 74 GLN GLN A . n A 1 33 GLN 33 75 75 GLN GLN A . n A 1 34 LEU 34 76 76 LEU LEU A . n A 1 35 CYS 35 77 77 CYS CYS A . n A 1 36 ASP 36 78 78 ASP ASP A . n A 1 37 VAL 37 79 79 VAL VAL A . n A 1 38 THR 38 80 80 THR THR A . n A 1 39 LEU 39 81 81 LEU LEU A . n A 1 40 GLN 40 82 82 GLN GLN A . n A 1 41 VAL 41 83 83 VAL VAL A . n A 1 42 LYS 42 84 84 LYS LYS A . n A 1 43 TYR 43 85 85 TYR TYR A . n A 1 44 GLN 44 86 86 GLN GLN A . n A 1 45 ASP 45 87 87 ASP ASP A . n A 1 46 ALA 46 88 88 ALA ALA A . n A 1 47 PRO 47 89 89 PRO PRO A . n A 1 48 ALA 48 90 90 ALA ALA A . n A 1 49 ALA 49 91 91 ALA ALA A . n A 1 50 GLN 50 92 92 GLN GLN A . n A 1 51 PHE 51 93 93 PHE PHE A . n A 1 52 MET 52 94 94 MET MET A . n A 1 53 ALA 53 95 95 ALA ALA A . n A 1 54 HIS 54 96 96 HIS HIS A . n A 1 55 LYS 55 97 97 LYS LYS A . n A 1 56 VAL 56 98 98 VAL VAL A . n A 1 57 VAL 57 99 99 VAL VAL A . n A 1 58 LEU 58 100 100 LEU LEU A . n A 1 59 ALA 59 101 101 ALA ALA A . n A 1 60 SER 60 102 102 SER SER A . n A 1 61 SER 61 103 103 SER SER A . n A 1 62 SER 62 104 104 SER SER A . n A 1 63 PRO 63 105 105 PRO PRO A . n A 1 64 VAL 64 106 106 VAL VAL A . n A 1 65 PHE 65 107 107 PHE PHE A . n A 1 66 LYS 66 108 108 LYS LYS A . n A 1 67 ALA 67 109 109 ALA ALA A . n A 1 68 MET 68 110 110 MET MET A . n A 1 69 PHE 69 111 111 PHE PHE A . n A 1 70 THR 70 112 112 THR THR A . n A 1 71 ASN 71 113 ? ? ? A . n A 1 72 GLY 72 114 ? ? ? A . n A 1 73 LEU 73 115 ? ? ? A . n A 1 74 ARG 74 116 ? ? ? A . n A 1 75 GLU 75 117 ? ? ? A . n A 1 76 GLN 76 118 ? ? ? A . n A 1 77 GLY 77 119 ? ? ? A . n A 1 78 MET 78 120 120 MET MET A . n A 1 79 GLU 79 121 121 GLU GLU A . n A 1 80 VAL 80 122 122 VAL VAL A . n A 1 81 VAL 81 123 123 VAL VAL A . n A 1 82 SER 82 124 124 SER SER A . n A 1 83 ILE 83 125 125 ILE ILE A . n A 1 84 GLU 84 126 126 GLU GLU A . n A 1 85 GLY 85 127 127 GLY GLY A . n A 1 86 ILE 86 128 128 ILE ILE A . n A 1 87 HIS 87 129 129 HIS HIS A . n A 1 88 PRO 88 130 130 PRO PRO A . n A 1 89 LYS 89 131 131 LYS LYS A . n A 1 90 VAL 90 132 132 VAL VAL A . n A 1 91 MET 91 133 133 MET MET A . n A 1 92 GLU 92 134 134 GLU GLU A . n A 1 93 ARG 93 135 135 ARG ARG A . n A 1 94 LEU 94 136 136 LEU LEU A . n A 1 95 ILE 95 137 137 ILE ILE A . n A 1 96 GLU 96 138 138 GLU GLU A . n A 1 97 PHE 97 139 139 PHE PHE A . n A 1 98 ALA 98 140 140 ALA ALA A . n A 1 99 TYR 99 141 141 TYR TYR A . n A 1 100 THR 100 142 142 THR THR A . n A 1 101 ALA 101 143 143 ALA ALA A . n A 1 102 SER 102 144 144 SER SER A . n A 1 103 ILE 103 145 145 ILE ILE A . n A 1 104 SER 104 146 146 SER SER A . n A 1 105 MET 105 147 147 MET MET A . n A 1 106 GLY 106 148 148 GLY GLY A . n A 1 107 GLU 107 149 149 GLU GLU A . n A 1 108 LYS 108 150 150 LYS LYS A . n A 1 109 CYS 109 151 151 CYS CYS A . n A 1 110 VAL 110 152 152 VAL VAL A . n A 1 111 LEU 111 153 153 LEU LEU A . n A 1 112 HIS 112 154 154 HIS HIS A . n A 1 113 VAL 113 155 155 VAL VAL A . n A 1 114 MET 114 156 156 MET MET A . n A 1 115 ASN 115 157 157 ASN ASN A . n A 1 116 GLY 116 158 158 GLY GLY A . n A 1 117 ALA 117 159 159 ALA ALA A . n A 1 118 VAL 118 160 160 VAL VAL A . n A 1 119 MET 119 161 161 MET MET A . n A 1 120 TYR 120 162 162 TYR TYR A . n A 1 121 GLN 121 163 163 GLN GLN A . n A 1 122 ILE 122 164 164 ILE ILE A . n A 1 123 ASP 123 165 165 ASP ASP A . n A 1 124 SER 124 166 166 SER SER A . n A 1 125 VAL 125 167 167 VAL VAL A . n A 1 126 VAL 126 168 168 VAL VAL A . n A 1 127 ARG 127 169 169 ARG ARG A . n A 1 128 ALA 128 170 170 ALA ALA A . n A 1 129 CYS 129 171 171 CYS CYS A . n A 1 130 SER 130 172 172 SER SER A . n A 1 131 ASP 131 173 173 ASP ASP A . n A 1 132 PHE 132 174 174 PHE PHE A . n A 1 133 LEU 133 175 175 LEU LEU A . n A 1 134 VAL 134 176 176 VAL VAL A . n A 1 135 GLN 135 177 177 GLN GLN A . n A 1 136 GLN 136 178 178 GLN GLN A . n A 1 137 LEU 137 179 179 LEU LEU A . n A 1 138 ASP 138 180 ? ? ? A . n A 1 139 PRO 139 181 ? ? ? A . n A 1 140 SER 140 182 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TX6 1 201 1 TX6 TX6 A . C 3 HOH 1 301 7 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 9 HOH HOH A . C 3 HOH 4 304 4 HOH HOH A . C 3 HOH 5 305 1 HOH HOH A . C 3 HOH 6 306 3 HOH HOH A . C 3 HOH 7 307 5 HOH HOH A . C 3 HOH 8 308 8 HOH HOH A . C 3 HOH 9 309 6 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3960 ? 1 MORE -36 ? 1 'SSA (A^2)' 12140 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 -x+y,y,-z+1/3 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 45.0570000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 303 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-08-10 2 'Structure model' 1 1 2016-09-14 3 'Structure model' 1 2 2017-11-22 4 'Structure model' 1 3 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' pdbx_struct_oper_list 3 3 'Structure model' software 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 3 'Structure model' '_software.classification' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.16 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.6.0117 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'autoPROC, XDS (VERSION December 6, 2010)' 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.3.0 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 58 ? ? -97.40 31.59 2 1 ASP A 87 ? ? 65.73 -60.39 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 309 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.55 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 50 ? CG ? A ARG 8 CG 2 1 Y 1 A ARG 50 ? CD ? A ARG 8 CD 3 1 Y 1 A ARG 50 ? NE ? A ARG 8 NE 4 1 Y 1 A ARG 50 ? CZ ? A ARG 8 CZ 5 1 Y 1 A ARG 50 ? NH1 ? A ARG 8 NH1 6 1 Y 1 A ARG 50 ? NH2 ? A ARG 8 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 43 ? A GLY 1 2 1 Y 1 A SER 44 ? A SER 2 3 1 Y 1 A HIS 45 ? A HIS 3 4 1 Y 1 A MET 46 ? A MET 4 5 1 Y 1 A ALA 47 ? A ALA 5 6 1 Y 1 A SER 48 ? A SER 6 7 1 Y 1 A ASN 49 ? A ASN 7 8 1 Y 1 A ASN 113 ? A ASN 71 9 1 Y 1 A GLY 114 ? A GLY 72 10 1 Y 1 A LEU 115 ? A LEU 73 11 1 Y 1 A ARG 116 ? A ARG 74 12 1 Y 1 A GLU 117 ? A GLU 75 13 1 Y 1 A GLN 118 ? A GLN 76 14 1 Y 1 A GLY 119 ? A GLY 77 15 1 Y 1 A ASP 180 ? A ASP 138 16 1 Y 1 A PRO 181 ? A PRO 139 17 1 Y 1 A SER 182 ? A SER 140 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TX6 N16 N N N 321 TX6 C15 C N N 322 TX6 C2 C N N 323 TX6 C1 C N N 324 TX6 C10 C N S 325 TX6 C19 C N N 326 TX6 C9 C Y N 327 TX6 N11 N Y N 328 TX6 C12 C Y N 329 TX6 C20 C N N 330 TX6 N13 N Y N 331 TX6 C14 C Y N 332 TX6 O21 O N N 333 TX6 C22 C N N 334 TX6 C8 C Y N 335 TX6 C7 C N N 336 TX6 C6 C N N 337 TX6 C5 C N S 338 TX6 C4 C N S 339 TX6 C18 C N N 340 TX6 C3 C N N 341 TX6 O17 O N N 342 TX6 H2 H N N 343 TX6 H3 H N N 344 TX6 H4 H N N 345 TX6 H5 H N N 346 TX6 H6 H N N 347 TX6 H7 H N N 348 TX6 H8 H N N 349 TX6 H9 H N N 350 TX6 H10 H N N 351 TX6 H11 H N N 352 TX6 H12 H N N 353 TX6 H13 H N N 354 TX6 H14 H N N 355 TX6 H15 H N N 356 TX6 H16 H N N 357 TX6 H17 H N N 358 TX6 H18 H N N 359 TX6 H19 H N N 360 TX6 H20 H N N 361 TX6 H21 H N N 362 TX6 H23 H N N 363 TYR N N N N 364 TYR CA C N S 365 TYR C C N N 366 TYR O O N N 367 TYR CB C N N 368 TYR CG C Y N 369 TYR CD1 C Y N 370 TYR CD2 C Y N 371 TYR CE1 C Y N 372 TYR CE2 C Y N 373 TYR CZ C Y N 374 TYR OH O N N 375 TYR OXT O N N 376 TYR H H N N 377 TYR H2 H N N 378 TYR HA H N N 379 TYR HB2 H N N 380 TYR HB3 H N N 381 TYR HD1 H N N 382 TYR HD2 H N N 383 TYR HE1 H N N 384 TYR HE2 H N N 385 TYR HH H N N 386 TYR HXT H N N 387 VAL N N N N 388 VAL CA C N S 389 VAL C C N N 390 VAL O O N N 391 VAL CB C N N 392 VAL CG1 C N N 393 VAL CG2 C N N 394 VAL OXT O N N 395 VAL H H N N 396 VAL H2 H N N 397 VAL HA H N N 398 VAL HB H N N 399 VAL HG11 H N N 400 VAL HG12 H N N 401 VAL HG13 H N N 402 VAL HG21 H N N 403 VAL HG22 H N N 404 VAL HG23 H N N 405 VAL HXT H N N 406 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TX6 C22 O21 sing N N 306 TX6 O21 C14 sing N N 307 TX6 N13 C14 doub Y N 308 TX6 N13 C12 sing Y N 309 TX6 C20 C12 sing N N 310 TX6 C14 C8 sing Y N 311 TX6 C12 N11 doub Y N 312 TX6 C8 C7 sing N N 313 TX6 C8 C9 doub Y N 314 TX6 N11 C9 sing Y N 315 TX6 C7 C6 sing N N 316 TX6 C9 C10 sing N N 317 TX6 C1 C10 sing N N 318 TX6 C1 C2 sing N N 319 TX6 C10 C5 sing N N 320 TX6 C10 C19 sing N N 321 TX6 C6 C5 sing N N 322 TX6 C5 C4 sing N N 323 TX6 C2 C15 sing N N 324 TX6 C2 C3 doub N N 325 TX6 C15 N16 trip N N 326 TX6 C4 C18 sing N N 327 TX6 C4 C3 sing N N 328 TX6 C3 O17 sing N N 329 TX6 C1 H2 sing N N 330 TX6 C1 H3 sing N N 331 TX6 C19 H4 sing N N 332 TX6 C19 H5 sing N N 333 TX6 C19 H6 sing N N 334 TX6 C20 H7 sing N N 335 TX6 C20 H8 sing N N 336 TX6 C20 H9 sing N N 337 TX6 C22 H10 sing N N 338 TX6 C22 H11 sing N N 339 TX6 C22 H12 sing N N 340 TX6 C7 H13 sing N N 341 TX6 C7 H14 sing N N 342 TX6 C6 H15 sing N N 343 TX6 C6 H16 sing N N 344 TX6 C5 H17 sing N N 345 TX6 C4 H18 sing N N 346 TX6 C18 H19 sing N N 347 TX6 C18 H20 sing N N 348 TX6 C18 H21 sing N N 349 TX6 O17 H23 sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(6aS,7S,10aS)-8-hydroxy-4-methoxy-2,7,10a-trimethyl-5,6,6a,7,10,10a-hexahydrobenzo[h]quinazoline-9-carbonitrile' TX6 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5DAF _pdbx_initial_refinement_model.details ? #