data_5DAF # _entry.id 5DAF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5DAF pdb_00005daf 10.2210/pdb5daf/pdb WWPDB D_1000212921 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-08-10 2 'Structure model' 1 1 2016-09-14 3 'Structure model' 1 2 2017-11-22 4 'Structure model' 1 3 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' pdbx_struct_oper_list 3 3 'Structure model' software 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 3 'Structure model' '_software.classification' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DAF _pdbx_database_status.recvd_initial_deposition_date 2015-08-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5DAD _pdbx_database_related.db_name PDB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Huerta, C.' 1 'Jiang, X.' 2 'Trevino, I.' 3 'Bender, C.F.' 4 'Swinger, K.K.' 5 'Stoll, V.S.' 6 'Ferguson, D.A.' 7 'Thomas, P.J.' 8 'Probst, B.' 9 'Dulubova, I.' 10 'Visnick, M.' 11 'Wigley, W.C.' 12 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_id_ASTM BBACAQ _citation.journal_id_CSD 0113 _citation.journal_id_ISSN 0006-3002 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 1860 _citation.language ? _citation.page_first 2537 _citation.page_last 2552 _citation.title 'Characterization of novel small-molecule NRF2 activators: Structural and biochemical validation of stereospecific KEAP1 binding.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbagen.2016.07.026 _citation.pdbx_database_id_PubMed 27474998 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huerta, C.' 1 ? primary 'Jiang, X.' 2 ? primary 'Trevino, I.' 3 ? primary 'Bender, C.F.' 4 ? primary 'Ferguson, D.A.' 5 ? primary 'Probst, B.' 6 ? primary 'Swinger, K.K.' 7 ? primary 'Stoll, V.S.' 8 ? primary 'Thomas, P.J.' 9 ? primary 'Dulubova, I.' 10 ? primary 'Visnick, M.' 11 ? primary 'Wigley, W.C.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Kelch-like ECH-associated protein 1' 15594.950 1 ? ? 'UNP residues 49-182' ? 2 non-polymer syn '(5aS,6S,9aS)-7-hydroxy-2,6,9a-trimethyl-3-(pyridin-3-yl)-4,5,5a,6,9,9a-hexahydro-2H-benzo[g]indazole-8-carbonitrile' 334.415 1 ? ? ? ? 3 water nat water 18.015 22 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytosolic inhibitor of Nrf2,INrf2,Kelch-like protein 19' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMASNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEV VSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMASNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEV VSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(5aS,6S,9aS)-7-hydroxy-2,6,9a-trimethyl-3-(pyridin-3-yl)-4,5,5a,6,9,9a-hexahydro-2H-benzo[g]indazole-8-carbonitrile' 58E 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 SER n 1 7 ASN n 1 8 ARG n 1 9 THR n 1 10 PHE n 1 11 SER n 1 12 TYR n 1 13 THR n 1 14 LEU n 1 15 GLU n 1 16 ASP n 1 17 HIS n 1 18 THR n 1 19 LYS n 1 20 GLN n 1 21 ALA n 1 22 PHE n 1 23 GLY n 1 24 ILE n 1 25 MET n 1 26 ASN n 1 27 GLU n 1 28 LEU n 1 29 ARG n 1 30 LEU n 1 31 SER n 1 32 GLN n 1 33 GLN n 1 34 LEU n 1 35 CYS n 1 36 ASP n 1 37 VAL n 1 38 THR n 1 39 LEU n 1 40 GLN n 1 41 VAL n 1 42 LYS n 1 43 TYR n 1 44 GLN n 1 45 ASP n 1 46 ALA n 1 47 PRO n 1 48 ALA n 1 49 ALA n 1 50 GLN n 1 51 PHE n 1 52 MET n 1 53 ALA n 1 54 HIS n 1 55 LYS n 1 56 VAL n 1 57 VAL n 1 58 LEU n 1 59 ALA n 1 60 SER n 1 61 SER n 1 62 SER n 1 63 PRO n 1 64 VAL n 1 65 PHE n 1 66 LYS n 1 67 ALA n 1 68 MET n 1 69 PHE n 1 70 THR n 1 71 ASN n 1 72 GLY n 1 73 LEU n 1 74 ARG n 1 75 GLU n 1 76 GLN n 1 77 GLY n 1 78 MET n 1 79 GLU n 1 80 VAL n 1 81 VAL n 1 82 SER n 1 83 ILE n 1 84 GLU n 1 85 GLY n 1 86 ILE n 1 87 HIS n 1 88 PRO n 1 89 LYS n 1 90 VAL n 1 91 MET n 1 92 GLU n 1 93 ARG n 1 94 LEU n 1 95 ILE n 1 96 GLU n 1 97 PHE n 1 98 ALA n 1 99 TYR n 1 100 THR n 1 101 ALA n 1 102 SER n 1 103 ILE n 1 104 SER n 1 105 MET n 1 106 GLY n 1 107 GLU n 1 108 LYS n 1 109 CYS n 1 110 VAL n 1 111 LEU n 1 112 HIS n 1 113 VAL n 1 114 MET n 1 115 ASN n 1 116 GLY n 1 117 ALA n 1 118 VAL n 1 119 MET n 1 120 TYR n 1 121 GLN n 1 122 ILE n 1 123 ASP n 1 124 SER n 1 125 VAL n 1 126 VAL n 1 127 ARG n 1 128 ALA n 1 129 CYS n 1 130 SER n 1 131 ASP n 1 132 PHE n 1 133 LEU n 1 134 VAL n 1 135 GLN n 1 136 GLN n 1 137 LEU n 1 138 ASP n 1 139 PRO n 1 140 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 140 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KEAP1, INRF2, KIAA0132, KLHL19' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-CodonPlus(DE3)-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 58E non-polymer . '(5aS,6S,9aS)-7-hydroxy-2,6,9a-trimethyl-3-(pyridin-3-yl)-4,5,5a,6,9,9a-hexahydro-2H-benzo[g]indazole-8-carbonitrile' ? 'C20 H22 N4 O' 334.415 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 43 ? ? ? A . n A 1 2 SER 2 44 ? ? ? A . n A 1 3 HIS 3 45 ? ? ? A . n A 1 4 MET 4 46 ? ? ? A . n A 1 5 ALA 5 47 ? ? ? A . n A 1 6 SER 6 48 ? ? ? A . n A 1 7 ASN 7 49 ? ? ? A . n A 1 8 ARG 8 50 50 ARG ARG A . n A 1 9 THR 9 51 51 THR THR A . n A 1 10 PHE 10 52 52 PHE PHE A . n A 1 11 SER 11 53 53 SER SER A . n A 1 12 TYR 12 54 54 TYR TYR A . n A 1 13 THR 13 55 55 THR THR A . n A 1 14 LEU 14 56 56 LEU LEU A . n A 1 15 GLU 15 57 57 GLU GLU A . n A 1 16 ASP 16 58 58 ASP ASP A . n A 1 17 HIS 17 59 59 HIS HIS A . n A 1 18 THR 18 60 60 THR THR A . n A 1 19 LYS 19 61 61 LYS LYS A . n A 1 20 GLN 20 62 62 GLN GLN A . n A 1 21 ALA 21 63 63 ALA ALA A . n A 1 22 PHE 22 64 64 PHE PHE A . n A 1 23 GLY 23 65 65 GLY GLY A . n A 1 24 ILE 24 66 66 ILE ILE A . n A 1 25 MET 25 67 67 MET MET A . n A 1 26 ASN 26 68 68 ASN ASN A . n A 1 27 GLU 27 69 69 GLU GLU A . n A 1 28 LEU 28 70 70 LEU LEU A . n A 1 29 ARG 29 71 71 ARG ARG A . n A 1 30 LEU 30 72 72 LEU LEU A . n A 1 31 SER 31 73 73 SER SER A . n A 1 32 GLN 32 74 74 GLN GLN A . n A 1 33 GLN 33 75 75 GLN GLN A . n A 1 34 LEU 34 76 76 LEU LEU A . n A 1 35 CYS 35 77 77 CYS CYS A . n A 1 36 ASP 36 78 78 ASP ASP A . n A 1 37 VAL 37 79 79 VAL VAL A . n A 1 38 THR 38 80 80 THR THR A . n A 1 39 LEU 39 81 81 LEU LEU A . n A 1 40 GLN 40 82 82 GLN GLN A . n A 1 41 VAL 41 83 83 VAL VAL A . n A 1 42 LYS 42 84 84 LYS LYS A . n A 1 43 TYR 43 85 85 TYR TYR A . n A 1 44 GLN 44 86 86 GLN GLN A . n A 1 45 ASP 45 87 87 ASP ASP A . n A 1 46 ALA 46 88 88 ALA ALA A . n A 1 47 PRO 47 89 89 PRO PRO A . n A 1 48 ALA 48 90 90 ALA ALA A . n A 1 49 ALA 49 91 91 ALA ALA A . n A 1 50 GLN 50 92 92 GLN GLN A . n A 1 51 PHE 51 93 93 PHE PHE A . n A 1 52 MET 52 94 94 MET MET A . n A 1 53 ALA 53 95 95 ALA ALA A . n A 1 54 HIS 54 96 96 HIS HIS A . n A 1 55 LYS 55 97 97 LYS LYS A . n A 1 56 VAL 56 98 98 VAL VAL A . n A 1 57 VAL 57 99 99 VAL VAL A . n A 1 58 LEU 58 100 100 LEU LEU A . n A 1 59 ALA 59 101 101 ALA ALA A . n A 1 60 SER 60 102 102 SER SER A . n A 1 61 SER 61 103 103 SER SER A . n A 1 62 SER 62 104 104 SER SER A . n A 1 63 PRO 63 105 105 PRO PRO A . n A 1 64 VAL 64 106 106 VAL VAL A . n A 1 65 PHE 65 107 107 PHE PHE A . n A 1 66 LYS 66 108 108 LYS LYS A . n A 1 67 ALA 67 109 109 ALA ALA A . n A 1 68 MET 68 110 110 MET MET A . n A 1 69 PHE 69 111 111 PHE PHE A . n A 1 70 THR 70 112 112 THR THR A . n A 1 71 ASN 71 113 ? ? ? A . n A 1 72 GLY 72 114 ? ? ? A . n A 1 73 LEU 73 115 ? ? ? A . n A 1 74 ARG 74 116 ? ? ? A . n A 1 75 GLU 75 117 ? ? ? A . n A 1 76 GLN 76 118 ? ? ? A . n A 1 77 GLY 77 119 ? ? ? A . n A 1 78 MET 78 120 120 MET MET A . n A 1 79 GLU 79 121 121 GLU GLU A . n A 1 80 VAL 80 122 122 VAL VAL A . n A 1 81 VAL 81 123 123 VAL VAL A . n A 1 82 SER 82 124 124 SER SER A . n A 1 83 ILE 83 125 125 ILE ILE A . n A 1 84 GLU 84 126 126 GLU GLU A . n A 1 85 GLY 85 127 127 GLY GLY A . n A 1 86 ILE 86 128 128 ILE ILE A . n A 1 87 HIS 87 129 129 HIS HIS A . n A 1 88 PRO 88 130 130 PRO PRO A . n A 1 89 LYS 89 131 131 LYS LYS A . n A 1 90 VAL 90 132 132 VAL VAL A . n A 1 91 MET 91 133 133 MET MET A . n A 1 92 GLU 92 134 134 GLU GLU A . n A 1 93 ARG 93 135 135 ARG ARG A . n A 1 94 LEU 94 136 136 LEU LEU A . n A 1 95 ILE 95 137 137 ILE ILE A . n A 1 96 GLU 96 138 138 GLU GLU A . n A 1 97 PHE 97 139 139 PHE PHE A . n A 1 98 ALA 98 140 140 ALA ALA A . n A 1 99 TYR 99 141 141 TYR TYR A . n A 1 100 THR 100 142 142 THR THR A . n A 1 101 ALA 101 143 143 ALA ALA A . n A 1 102 SER 102 144 144 SER SER A . n A 1 103 ILE 103 145 145 ILE ILE A . n A 1 104 SER 104 146 146 SER SER A . n A 1 105 MET 105 147 147 MET MET A . n A 1 106 GLY 106 148 148 GLY GLY A . n A 1 107 GLU 107 149 149 GLU GLU A . n A 1 108 LYS 108 150 150 LYS LYS A . n A 1 109 CYS 109 151 151 CYS CYS A . n A 1 110 VAL 110 152 152 VAL VAL A . n A 1 111 LEU 111 153 153 LEU LEU A . n A 1 112 HIS 112 154 154 HIS HIS A . n A 1 113 VAL 113 155 155 VAL VAL A . n A 1 114 MET 114 156 156 MET MET A . n A 1 115 ASN 115 157 157 ASN ASN A . n A 1 116 GLY 116 158 158 GLY GLY A . n A 1 117 ALA 117 159 159 ALA ALA A . n A 1 118 VAL 118 160 160 VAL VAL A . n A 1 119 MET 119 161 161 MET MET A . n A 1 120 TYR 120 162 162 TYR TYR A . n A 1 121 GLN 121 163 163 GLN GLN A . n A 1 122 ILE 122 164 164 ILE ILE A . n A 1 123 ASP 123 165 165 ASP ASP A . n A 1 124 SER 124 166 166 SER SER A . n A 1 125 VAL 125 167 167 VAL VAL A . n A 1 126 VAL 126 168 168 VAL VAL A . n A 1 127 ARG 127 169 169 ARG ARG A . n A 1 128 ALA 128 170 170 ALA ALA A . n A 1 129 CYS 129 171 171 CYS CYS A . n A 1 130 SER 130 172 172 SER SER A . n A 1 131 ASP 131 173 173 ASP ASP A . n A 1 132 PHE 132 174 174 PHE PHE A . n A 1 133 LEU 133 175 175 LEU LEU A . n A 1 134 VAL 134 176 176 VAL VAL A . n A 1 135 GLN 135 177 177 GLN GLN A . n A 1 136 GLN 136 178 ? ? ? A . n A 1 137 LEU 137 179 ? ? ? A . n A 1 138 ASP 138 180 ? ? ? A . n A 1 139 PRO 139 181 ? ? ? A . n A 1 140 SER 140 182 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 58E 1 201 1 58E TX6 A . C 3 HOH 1 301 11 HOH HOH A . C 3 HOH 2 302 18 HOH HOH A . C 3 HOH 3 303 8 HOH HOH A . C 3 HOH 4 304 4 HOH HOH A . C 3 HOH 5 305 5 HOH HOH A . C 3 HOH 6 306 17 HOH HOH A . C 3 HOH 7 307 7 HOH HOH A . C 3 HOH 8 308 13 HOH HOH A . C 3 HOH 9 309 22 HOH HOH A . C 3 HOH 10 310 12 HOH HOH A . C 3 HOH 11 311 21 HOH HOH A . C 3 HOH 12 312 3 HOH HOH A . C 3 HOH 13 313 16 HOH HOH A . C 3 HOH 14 314 2 HOH HOH A . C 3 HOH 15 315 15 HOH HOH A . C 3 HOH 16 316 14 HOH HOH A . C 3 HOH 17 317 20 HOH HOH A . C 3 HOH 18 318 19 HOH HOH A . C 3 HOH 19 319 6 HOH HOH A . C 3 HOH 20 320 10 HOH HOH A . C 3 HOH 21 321 1 HOH HOH A . C 3 HOH 22 322 9 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 50 ? CG ? A ARG 8 CG 2 1 Y 1 A ARG 50 ? CD ? A ARG 8 CD 3 1 Y 1 A ARG 50 ? NE ? A ARG 8 NE 4 1 Y 1 A ARG 50 ? CZ ? A ARG 8 CZ 5 1 Y 1 A ARG 50 ? NH1 ? A ARG 8 NH1 6 1 Y 1 A ARG 50 ? NH2 ? A ARG 8 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.16 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.6.0117 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'autoPROC, XDS (VERSION December 6, 2010)' 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.3.0 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5DAF _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.449 _cell.length_a_esd ? _cell.length_b 42.449 _cell.length_b_esd ? _cell.length_c 134.044 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DAF _symmetry.cell_setting ? _symmetry.Int_Tables_number 151 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 1 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DAF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M CHES, pH 9.5, 30% w/v PEG 3000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details Pixel _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-08-21 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5DAF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.369 _reflns.d_resolution_low 134.044 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5900 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.400 _reflns.pdbx_Rmerge_I_obs 0.039 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 31.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 55344 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.369 2.377 ? 6.0 495 ? ? 50 ? 100.000 ? ? ? ? 0.349 ? ? ? ? ? ? ? ? 9.900 ? ? ? ? ? ? 0 1 1 ? ? 10.994 134.044 ? ? 514 ? ? 75 ? 100.000 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 6.900 ? ? ? ? ? ? 0 2 1 ? ? # _refine.aniso_B[1][1] 1.1800 _refine.aniso_B[1][2] 0.5900 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.1800 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -1.7700 _refine.B_iso_max 126.800 _refine.B_iso_mean 63.1260 _refine.B_iso_min 35.680 _refine.correlation_coeff_Fo_to_Fc 0.9640 _refine.correlation_coeff_Fo_to_Fc_free 0.9500 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DAF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3700 _refine.ls_d_res_low 44.6800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5591 _refine.ls_number_reflns_R_free 266 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8800 _refine.ls_percent_reflns_R_free 4.5000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2035 _refine.ls_R_factor_R_free 0.2330 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2021 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2487 _refine.ls_wR_factor_R_work 0.2119 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3780 _refine.pdbx_overall_ESU_R_Free 0.2360 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 9.5580 _refine.overall_SU_ML 0.2040 _refine.overall_SU_R_Cruickshank_DPI 0.3782 _refine.overall_SU_R_free 0.2359 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.7701 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.3700 _refine_hist.d_res_low 44.6800 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 22 _refine_hist.number_atoms_total 989 _refine_hist.pdbx_number_residues_total 121 _refine_hist.pdbx_B_iso_mean_ligand 79.75 _refine_hist.pdbx_B_iso_mean_solvent 65.73 _refine_hist.pdbx_number_atoms_protein 942 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.020 987 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.297 1.985 1338 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 5.310 5.000 119 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.719 24.750 40 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.618 15.000 172 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 13.613 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.073 0.200 156 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 724 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.3690 _refine_ls_shell.d_res_low 2.4300 _refine_ls_shell.number_reflns_all 387 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 21 _refine_ls_shell.number_reflns_R_work 366 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.4160 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3310 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5DAF _struct.title 'Crystal Structure of Human KEAP1 BTB Domain in Complex with Small Molecule TX64063' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DAF _struct_keywords.text 'KEAP1, Trascription Regulation, BTB domain, Cysteine Modification, C1-(R)-Cys151 adduct, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KEAP1_HUMAN _struct_ref.pdbx_db_accession Q14145 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGI HPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPS ; _struct_ref.pdbx_align_begin 49 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5DAF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14145 _struct_ref_seq.db_align_beg 49 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 182 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 49 _struct_ref_seq.pdbx_auth_seq_align_end 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5DAF GLY A 1 ? UNP Q14145 ? ? 'expression tag' 43 1 1 5DAF SER A 2 ? UNP Q14145 ? ? 'expression tag' 44 2 1 5DAF HIS A 3 ? UNP Q14145 ? ? 'expression tag' 45 3 1 5DAF MET A 4 ? UNP Q14145 ? ? 'expression tag' 46 4 1 5DAF ALA A 5 ? UNP Q14145 ? ? 'expression tag' 47 5 1 5DAF SER A 6 ? UNP Q14145 ? ? 'expression tag' 48 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3920 ? 1 MORE -35 ? 1 'SSA (A^2)' 11840 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 -x+y,y,-z+1/3 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 44.6813333333 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 16 ? SER A 31 ? ASP A 58 SER A 73 1 ? 16 HELX_P HELX_P2 AA2 HIS A 54 ? SER A 60 ? HIS A 96 SER A 102 1 ? 7 HELX_P HELX_P3 AA3 SER A 62 ? THR A 70 ? SER A 104 THR A 112 1 ? 9 HELX_P HELX_P4 AA4 HIS A 87 ? ALA A 101 ? HIS A 129 ALA A 143 1 ? 15 HELX_P HELX_P5 AA5 CYS A 109 ? TYR A 120 ? CYS A 151 TYR A 162 1 ? 12 HELX_P HELX_P6 AA6 ILE A 122 ? VAL A 134 ? ILE A 164 VAL A 176 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 109 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id 58E _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 151 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 58E _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.778 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id 58E _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 109 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id 58E _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 151 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C1 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id 58E _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 46 ? ALA A 53 ? ALA A 88 ALA A 95 AA1 2 VAL A 37 ? TYR A 43 ? VAL A 79 TYR A 85 AA1 3 GLU A 79 ? ILE A 83 ? GLU A 121 ILE A 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 51 ? O PHE A 93 N LEU A 39 ? N LEU A 81 AA1 2 3 N GLN A 40 ? N GLN A 82 O ILE A 83 ? O ILE A 125 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 58E _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'binding site for residue 58E A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 TYR A 43 ? TYR A 85 . ? 1_555 ? 2 AC1 9 HIS A 87 ? HIS A 129 . ? 1_555 ? 3 AC1 9 LYS A 89 ? LYS A 131 . ? 1_555 ? 4 AC1 9 VAL A 90 ? VAL A 132 . ? 1_555 ? 5 AC1 9 MET A 105 ? MET A 147 . ? 1_555 ? 6 AC1 9 GLY A 106 ? GLY A 148 . ? 1_555 ? 7 AC1 9 LYS A 108 ? LYS A 150 . ? 1_555 ? 8 AC1 9 CYS A 109 ? CYS A 151 . ? 1_555 ? 9 AC1 9 HIS A 112 ? HIS A 154 . ? 1_555 ? # _pdbx_entry_details.entry_id 5DAF _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 86 ? ? 47.33 78.62 2 1 ASP A 87 ? ? 76.61 -27.77 3 1 GLU A 149 ? ? 68.95 -53.59 4 1 LYS A 150 ? ? -69.62 11.09 5 1 VAL A 176 ? ? -66.81 87.54 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 322 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 7.70 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 43 ? A GLY 1 2 1 Y 1 A SER 44 ? A SER 2 3 1 Y 1 A HIS 45 ? A HIS 3 4 1 Y 1 A MET 46 ? A MET 4 5 1 Y 1 A ALA 47 ? A ALA 5 6 1 Y 1 A SER 48 ? A SER 6 7 1 Y 1 A ASN 49 ? A ASN 7 8 1 Y 1 A ASN 113 ? A ASN 71 9 1 Y 1 A GLY 114 ? A GLY 72 10 1 Y 1 A LEU 115 ? A LEU 73 11 1 Y 1 A ARG 116 ? A ARG 74 12 1 Y 1 A GLU 117 ? A GLU 75 13 1 Y 1 A GLN 118 ? A GLN 76 14 1 Y 1 A GLY 119 ? A GLY 77 15 1 Y 1 A GLN 178 ? A GLN 136 16 1 Y 1 A LEU 179 ? A LEU 137 17 1 Y 1 A ASP 180 ? A ASP 138 18 1 Y 1 A PRO 181 ? A PRO 139 19 1 Y 1 A SER 182 ? A SER 140 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 58E O16 O N N 1 58E C3 C N N 2 58E C4 C N S 3 58E C17 C N N 4 58E C5 C N S 5 58E C6 C N N 6 58E C7 C N N 7 58E C8 C Y N 8 58E C13 C Y N 9 58E C20 C Y N 10 58E C25 C Y N 11 58E C24 C Y N 12 58E C23 C Y N 13 58E N22 N Y N 14 58E C21 C Y N 15 58E N12 N Y N 16 58E C19 C N N 17 58E N11 N Y N 18 58E C9 C Y N 19 58E C10 C N S 20 58E C18 C N N 21 58E C1 C N N 22 58E C2 C N N 23 58E C14 C N N 24 58E N15 N N N 25 58E H1 H N N 26 58E H2 H N N 27 58E H3 H N N 28 58E H4 H N N 29 58E H5 H N N 30 58E H6 H N N 31 58E H7 H N N 32 58E H8 H N N 33 58E H9 H N N 34 58E H10 H N N 35 58E H11 H N N 36 58E H12 H N N 37 58E H13 H N N 38 58E H14 H N N 39 58E H15 H N N 40 58E H16 H N N 41 58E H17 H N N 42 58E H18 H N N 43 58E H19 H N N 44 58E H20 H N N 45 58E H21 H N N 46 58E H22 H N N 47 ALA N N N N 48 ALA CA C N S 49 ALA C C N N 50 ALA O O N N 51 ALA CB C N N 52 ALA OXT O N N 53 ALA H H N N 54 ALA H2 H N N 55 ALA HA H N N 56 ALA HB1 H N N 57 ALA HB2 H N N 58 ALA HB3 H N N 59 ALA HXT H N N 60 ARG N N N N 61 ARG CA C N S 62 ARG C C N N 63 ARG O O N N 64 ARG CB C N N 65 ARG CG C N N 66 ARG CD C N N 67 ARG NE N N N 68 ARG CZ C N N 69 ARG NH1 N N N 70 ARG NH2 N N N 71 ARG OXT O N N 72 ARG H H N N 73 ARG H2 H N N 74 ARG HA H N N 75 ARG HB2 H N N 76 ARG HB3 H N N 77 ARG HG2 H N N 78 ARG HG3 H N N 79 ARG HD2 H N N 80 ARG HD3 H N N 81 ARG HE H N N 82 ARG HH11 H N N 83 ARG HH12 H N N 84 ARG HH21 H N N 85 ARG HH22 H N N 86 ARG HXT H N N 87 ASN N N N N 88 ASN CA C N S 89 ASN C C N N 90 ASN O O N N 91 ASN CB C N N 92 ASN CG C N N 93 ASN OD1 O N N 94 ASN ND2 N N N 95 ASN OXT O N N 96 ASN H H N N 97 ASN H2 H N N 98 ASN HA H N N 99 ASN HB2 H N N 100 ASN HB3 H N N 101 ASN HD21 H N N 102 ASN HD22 H N N 103 ASN HXT H N N 104 ASP N N N N 105 ASP CA C N S 106 ASP C C N N 107 ASP O O N N 108 ASP CB C N N 109 ASP CG C N N 110 ASP OD1 O N N 111 ASP OD2 O N N 112 ASP OXT O N N 113 ASP H H N N 114 ASP H2 H N N 115 ASP HA H N N 116 ASP HB2 H N N 117 ASP HB3 H N N 118 ASP HD2 H N N 119 ASP HXT H N N 120 CYS N N N N 121 CYS CA C N R 122 CYS C C N N 123 CYS O O N N 124 CYS CB C N N 125 CYS SG S N N 126 CYS OXT O N N 127 CYS H H N N 128 CYS H2 H N N 129 CYS HA H N N 130 CYS HB2 H N N 131 CYS HB3 H N N 132 CYS HG H N N 133 CYS HXT H N N 134 GLN N N N N 135 GLN CA C N S 136 GLN C C N N 137 GLN O O N N 138 GLN CB C N N 139 GLN CG C N N 140 GLN CD C N N 141 GLN OE1 O N N 142 GLN NE2 N N N 143 GLN OXT O N N 144 GLN H H N N 145 GLN H2 H N N 146 GLN HA H N N 147 GLN HB2 H N N 148 GLN HB3 H N N 149 GLN HG2 H N N 150 GLN HG3 H N N 151 GLN HE21 H N N 152 GLN HE22 H N N 153 GLN HXT H N N 154 GLU N N N N 155 GLU CA C N S 156 GLU C C N N 157 GLU O O N N 158 GLU CB C N N 159 GLU CG C N N 160 GLU CD C N N 161 GLU OE1 O N N 162 GLU OE2 O N N 163 GLU OXT O N N 164 GLU H H N N 165 GLU H2 H N N 166 GLU HA H N N 167 GLU HB2 H N N 168 GLU HB3 H N N 169 GLU HG2 H N N 170 GLU HG3 H N N 171 GLU HE2 H N N 172 GLU HXT H N N 173 GLY N N N N 174 GLY CA C N N 175 GLY C C N N 176 GLY O O N N 177 GLY OXT O N N 178 GLY H H N N 179 GLY H2 H N N 180 GLY HA2 H N N 181 GLY HA3 H N N 182 GLY HXT H N N 183 HIS N N N N 184 HIS CA C N S 185 HIS C C N N 186 HIS O O N N 187 HIS CB C N N 188 HIS CG C Y N 189 HIS ND1 N Y N 190 HIS CD2 C Y N 191 HIS CE1 C Y N 192 HIS NE2 N Y N 193 HIS OXT O N N 194 HIS H H N N 195 HIS H2 H N N 196 HIS HA H N N 197 HIS HB2 H N N 198 HIS HB3 H N N 199 HIS HD1 H N N 200 HIS HD2 H N N 201 HIS HE1 H N N 202 HIS HE2 H N N 203 HIS HXT H N N 204 HOH O O N N 205 HOH H1 H N N 206 HOH H2 H N N 207 ILE N N N N 208 ILE CA C N S 209 ILE C C N N 210 ILE O O N N 211 ILE CB C N S 212 ILE CG1 C N N 213 ILE CG2 C N N 214 ILE CD1 C N N 215 ILE OXT O N N 216 ILE H H N N 217 ILE H2 H N N 218 ILE HA H N N 219 ILE HB H N N 220 ILE HG12 H N N 221 ILE HG13 H N N 222 ILE HG21 H N N 223 ILE HG22 H N N 224 ILE HG23 H N N 225 ILE HD11 H N N 226 ILE HD12 H N N 227 ILE HD13 H N N 228 ILE HXT H N N 229 LEU N N N N 230 LEU CA C N S 231 LEU C C N N 232 LEU O O N N 233 LEU CB C N N 234 LEU CG C N N 235 LEU CD1 C N N 236 LEU CD2 C N N 237 LEU OXT O N N 238 LEU H H N N 239 LEU H2 H N N 240 LEU HA H N N 241 LEU HB2 H N N 242 LEU HB3 H N N 243 LEU HG H N N 244 LEU HD11 H N N 245 LEU HD12 H N N 246 LEU HD13 H N N 247 LEU HD21 H N N 248 LEU HD22 H N N 249 LEU HD23 H N N 250 LEU HXT H N N 251 LYS N N N N 252 LYS CA C N S 253 LYS C C N N 254 LYS O O N N 255 LYS CB C N N 256 LYS CG C N N 257 LYS CD C N N 258 LYS CE C N N 259 LYS NZ N N N 260 LYS OXT O N N 261 LYS H H N N 262 LYS H2 H N N 263 LYS HA H N N 264 LYS HB2 H N N 265 LYS HB3 H N N 266 LYS HG2 H N N 267 LYS HG3 H N N 268 LYS HD2 H N N 269 LYS HD3 H N N 270 LYS HE2 H N N 271 LYS HE3 H N N 272 LYS HZ1 H N N 273 LYS HZ2 H N N 274 LYS HZ3 H N N 275 LYS HXT H N N 276 MET N N N N 277 MET CA C N S 278 MET C C N N 279 MET O O N N 280 MET CB C N N 281 MET CG C N N 282 MET SD S N N 283 MET CE C N N 284 MET OXT O N N 285 MET H H N N 286 MET H2 H N N 287 MET HA H N N 288 MET HB2 H N N 289 MET HB3 H N N 290 MET HG2 H N N 291 MET HG3 H N N 292 MET HE1 H N N 293 MET HE2 H N N 294 MET HE3 H N N 295 MET HXT H N N 296 PHE N N N N 297 PHE CA C N S 298 PHE C C N N 299 PHE O O N N 300 PHE CB C N N 301 PHE CG C Y N 302 PHE CD1 C Y N 303 PHE CD2 C Y N 304 PHE CE1 C Y N 305 PHE CE2 C Y N 306 PHE CZ C Y N 307 PHE OXT O N N 308 PHE H H N N 309 PHE H2 H N N 310 PHE HA H N N 311 PHE HB2 H N N 312 PHE HB3 H N N 313 PHE HD1 H N N 314 PHE HD2 H N N 315 PHE HE1 H N N 316 PHE HE2 H N N 317 PHE HZ H N N 318 PHE HXT H N N 319 PRO N N N N 320 PRO CA C N S 321 PRO C C N N 322 PRO O O N N 323 PRO CB C N N 324 PRO CG C N N 325 PRO CD C N N 326 PRO OXT O N N 327 PRO H H N N 328 PRO HA H N N 329 PRO HB2 H N N 330 PRO HB3 H N N 331 PRO HG2 H N N 332 PRO HG3 H N N 333 PRO HD2 H N N 334 PRO HD3 H N N 335 PRO HXT H N N 336 SER N N N N 337 SER CA C N S 338 SER C C N N 339 SER O O N N 340 SER CB C N N 341 SER OG O N N 342 SER OXT O N N 343 SER H H N N 344 SER H2 H N N 345 SER HA H N N 346 SER HB2 H N N 347 SER HB3 H N N 348 SER HG H N N 349 SER HXT H N N 350 THR N N N N 351 THR CA C N S 352 THR C C N N 353 THR O O N N 354 THR CB C N R 355 THR OG1 O N N 356 THR CG2 C N N 357 THR OXT O N N 358 THR H H N N 359 THR H2 H N N 360 THR HA H N N 361 THR HB H N N 362 THR HG1 H N N 363 THR HG21 H N N 364 THR HG22 H N N 365 THR HG23 H N N 366 THR HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 58E C23 N22 doub Y N 1 58E C23 C24 sing Y N 2 58E N22 C21 sing Y N 3 58E C24 C25 doub Y N 4 58E C21 C20 doub Y N 5 58E C25 C20 sing Y N 6 58E C20 C13 sing N N 7 58E C19 N12 sing N N 8 58E C13 N12 sing Y N 9 58E C13 C8 doub Y N 10 58E N12 N11 sing Y N 11 58E C8 C7 sing N N 12 58E C8 C9 sing Y N 13 58E N11 C9 doub Y N 14 58E C7 C6 sing N N 15 58E C9 C10 sing N N 16 58E C1 C10 sing N N 17 58E C1 C2 sing N N 18 58E C10 C5 sing N N 19 58E C10 C18 sing N N 20 58E C6 C5 sing N N 21 58E C5 C4 sing N N 22 58E C2 C14 sing N N 23 58E C2 C3 doub N N 24 58E C14 N15 trip N N 25 58E C17 C4 sing N N 26 58E C4 C3 sing N N 27 58E C3 O16 sing N N 28 58E O16 H1 sing N N 29 58E C4 H2 sing N N 30 58E C17 H3 sing N N 31 58E C17 H4 sing N N 32 58E C17 H5 sing N N 33 58E C5 H6 sing N N 34 58E C6 H7 sing N N 35 58E C6 H8 sing N N 36 58E C7 H9 sing N N 37 58E C7 H10 sing N N 38 58E C25 H11 sing N N 39 58E C24 H12 sing N N 40 58E C23 H13 sing N N 41 58E C21 H14 sing N N 42 58E C19 H15 sing N N 43 58E C19 H16 sing N N 44 58E C19 H17 sing N N 45 58E C18 H18 sing N N 46 58E C18 H19 sing N N 47 58E C18 H20 sing N N 48 58E C1 H21 sing N N 49 58E C1 H22 sing N N 50 ALA N CA sing N N 51 ALA N H sing N N 52 ALA N H2 sing N N 53 ALA CA C sing N N 54 ALA CA CB sing N N 55 ALA CA HA sing N N 56 ALA C O doub N N 57 ALA C OXT sing N N 58 ALA CB HB1 sing N N 59 ALA CB HB2 sing N N 60 ALA CB HB3 sing N N 61 ALA OXT HXT sing N N 62 ARG N CA sing N N 63 ARG N H sing N N 64 ARG N H2 sing N N 65 ARG CA C sing N N 66 ARG CA CB sing N N 67 ARG CA HA sing N N 68 ARG C O doub N N 69 ARG C OXT sing N N 70 ARG CB CG sing N N 71 ARG CB HB2 sing N N 72 ARG CB HB3 sing N N 73 ARG CG CD sing N N 74 ARG CG HG2 sing N N 75 ARG CG HG3 sing N N 76 ARG CD NE sing N N 77 ARG CD HD2 sing N N 78 ARG CD HD3 sing N N 79 ARG NE CZ sing N N 80 ARG NE HE sing N N 81 ARG CZ NH1 sing N N 82 ARG CZ NH2 doub N N 83 ARG NH1 HH11 sing N N 84 ARG NH1 HH12 sing N N 85 ARG NH2 HH21 sing N N 86 ARG NH2 HH22 sing N N 87 ARG OXT HXT sing N N 88 ASN N CA sing N N 89 ASN N H sing N N 90 ASN N H2 sing N N 91 ASN CA C sing N N 92 ASN CA CB sing N N 93 ASN CA HA sing N N 94 ASN C O doub N N 95 ASN C OXT sing N N 96 ASN CB CG sing N N 97 ASN CB HB2 sing N N 98 ASN CB HB3 sing N N 99 ASN CG OD1 doub N N 100 ASN CG ND2 sing N N 101 ASN ND2 HD21 sing N N 102 ASN ND2 HD22 sing N N 103 ASN OXT HXT sing N N 104 ASP N CA sing N N 105 ASP N H sing N N 106 ASP N H2 sing N N 107 ASP CA C sing N N 108 ASP CA CB sing N N 109 ASP CA HA sing N N 110 ASP C O doub N N 111 ASP C OXT sing N N 112 ASP CB CG sing N N 113 ASP CB HB2 sing N N 114 ASP CB HB3 sing N N 115 ASP CG OD1 doub N N 116 ASP CG OD2 sing N N 117 ASP OD2 HD2 sing N N 118 ASP OXT HXT sing N N 119 CYS N CA sing N N 120 CYS N H sing N N 121 CYS N H2 sing N N 122 CYS CA C sing N N 123 CYS CA CB sing N N 124 CYS CA HA sing N N 125 CYS C O doub N N 126 CYS C OXT sing N N 127 CYS CB SG sing N N 128 CYS CB HB2 sing N N 129 CYS CB HB3 sing N N 130 CYS SG HG sing N N 131 CYS OXT HXT sing N N 132 GLN N CA sing N N 133 GLN N H sing N N 134 GLN N H2 sing N N 135 GLN CA C sing N N 136 GLN CA CB sing N N 137 GLN CA HA sing N N 138 GLN C O doub N N 139 GLN C OXT sing N N 140 GLN CB CG sing N N 141 GLN CB HB2 sing N N 142 GLN CB HB3 sing N N 143 GLN CG CD sing N N 144 GLN CG HG2 sing N N 145 GLN CG HG3 sing N N 146 GLN CD OE1 doub N N 147 GLN CD NE2 sing N N 148 GLN NE2 HE21 sing N N 149 GLN NE2 HE22 sing N N 150 GLN OXT HXT sing N N 151 GLU N CA sing N N 152 GLU N H sing N N 153 GLU N H2 sing N N 154 GLU CA C sing N N 155 GLU CA CB sing N N 156 GLU CA HA sing N N 157 GLU C O doub N N 158 GLU C OXT sing N N 159 GLU CB CG sing N N 160 GLU CB HB2 sing N N 161 GLU CB HB3 sing N N 162 GLU CG CD sing N N 163 GLU CG HG2 sing N N 164 GLU CG HG3 sing N N 165 GLU CD OE1 doub N N 166 GLU CD OE2 sing N N 167 GLU OE2 HE2 sing N N 168 GLU OXT HXT sing N N 169 GLY N CA sing N N 170 GLY N H sing N N 171 GLY N H2 sing N N 172 GLY CA C sing N N 173 GLY CA HA2 sing N N 174 GLY CA HA3 sing N N 175 GLY C O doub N N 176 GLY C OXT sing N N 177 GLY OXT HXT sing N N 178 HIS N CA sing N N 179 HIS N H sing N N 180 HIS N H2 sing N N 181 HIS CA C sing N N 182 HIS CA CB sing N N 183 HIS CA HA sing N N 184 HIS C O doub N N 185 HIS C OXT sing N N 186 HIS CB CG sing N N 187 HIS CB HB2 sing N N 188 HIS CB HB3 sing N N 189 HIS CG ND1 sing Y N 190 HIS CG CD2 doub Y N 191 HIS ND1 CE1 doub Y N 192 HIS ND1 HD1 sing N N 193 HIS CD2 NE2 sing Y N 194 HIS CD2 HD2 sing N N 195 HIS CE1 NE2 sing Y N 196 HIS CE1 HE1 sing N N 197 HIS NE2 HE2 sing N N 198 HIS OXT HXT sing N N 199 HOH O H1 sing N N 200 HOH O H2 sing N N 201 ILE N CA sing N N 202 ILE N H sing N N 203 ILE N H2 sing N N 204 ILE CA C sing N N 205 ILE CA CB sing N N 206 ILE CA HA sing N N 207 ILE C O doub N N 208 ILE C OXT sing N N 209 ILE CB CG1 sing N N 210 ILE CB CG2 sing N N 211 ILE CB HB sing N N 212 ILE CG1 CD1 sing N N 213 ILE CG1 HG12 sing N N 214 ILE CG1 HG13 sing N N 215 ILE CG2 HG21 sing N N 216 ILE CG2 HG22 sing N N 217 ILE CG2 HG23 sing N N 218 ILE CD1 HD11 sing N N 219 ILE CD1 HD12 sing N N 220 ILE CD1 HD13 sing N N 221 ILE OXT HXT sing N N 222 LEU N CA sing N N 223 LEU N H sing N N 224 LEU N H2 sing N N 225 LEU CA C sing N N 226 LEU CA CB sing N N 227 LEU CA HA sing N N 228 LEU C O doub N N 229 LEU C OXT sing N N 230 LEU CB CG sing N N 231 LEU CB HB2 sing N N 232 LEU CB HB3 sing N N 233 LEU CG CD1 sing N N 234 LEU CG CD2 sing N N 235 LEU CG HG sing N N 236 LEU CD1 HD11 sing N N 237 LEU CD1 HD12 sing N N 238 LEU CD1 HD13 sing N N 239 LEU CD2 HD21 sing N N 240 LEU CD2 HD22 sing N N 241 LEU CD2 HD23 sing N N 242 LEU OXT HXT sing N N 243 LYS N CA sing N N 244 LYS N H sing N N 245 LYS N H2 sing N N 246 LYS CA C sing N N 247 LYS CA CB sing N N 248 LYS CA HA sing N N 249 LYS C O doub N N 250 LYS C OXT sing N N 251 LYS CB CG sing N N 252 LYS CB HB2 sing N N 253 LYS CB HB3 sing N N 254 LYS CG CD sing N N 255 LYS CG HG2 sing N N 256 LYS CG HG3 sing N N 257 LYS CD CE sing N N 258 LYS CD HD2 sing N N 259 LYS CD HD3 sing N N 260 LYS CE NZ sing N N 261 LYS CE HE2 sing N N 262 LYS CE HE3 sing N N 263 LYS NZ HZ1 sing N N 264 LYS NZ HZ2 sing N N 265 LYS NZ HZ3 sing N N 266 LYS OXT HXT sing N N 267 MET N CA sing N N 268 MET N H sing N N 269 MET N H2 sing N N 270 MET CA C sing N N 271 MET CA CB sing N N 272 MET CA HA sing N N 273 MET C O doub N N 274 MET C OXT sing N N 275 MET CB CG sing N N 276 MET CB HB2 sing N N 277 MET CB HB3 sing N N 278 MET CG SD sing N N 279 MET CG HG2 sing N N 280 MET CG HG3 sing N N 281 MET SD CE sing N N 282 MET CE HE1 sing N N 283 MET CE HE2 sing N N 284 MET CE HE3 sing N N 285 MET OXT HXT sing N N 286 PHE N CA sing N N 287 PHE N H sing N N 288 PHE N H2 sing N N 289 PHE CA C sing N N 290 PHE CA CB sing N N 291 PHE CA HA sing N N 292 PHE C O doub N N 293 PHE C OXT sing N N 294 PHE CB CG sing N N 295 PHE CB HB2 sing N N 296 PHE CB HB3 sing N N 297 PHE CG CD1 doub Y N 298 PHE CG CD2 sing Y N 299 PHE CD1 CE1 sing Y N 300 PHE CD1 HD1 sing N N 301 PHE CD2 CE2 doub Y N 302 PHE CD2 HD2 sing N N 303 PHE CE1 CZ doub Y N 304 PHE CE1 HE1 sing N N 305 PHE CE2 CZ sing Y N 306 PHE CE2 HE2 sing N N 307 PHE CZ HZ sing N N 308 PHE OXT HXT sing N N 309 PRO N CA sing N N 310 PRO N CD sing N N 311 PRO N H sing N N 312 PRO CA C sing N N 313 PRO CA CB sing N N 314 PRO CA HA sing N N 315 PRO C O doub N N 316 PRO C OXT sing N N 317 PRO CB CG sing N N 318 PRO CB HB2 sing N N 319 PRO CB HB3 sing N N 320 PRO CG CD sing N N 321 PRO CG HG2 sing N N 322 PRO CG HG3 sing N N 323 PRO CD HD2 sing N N 324 PRO CD HD3 sing N N 325 PRO OXT HXT sing N N 326 SER N CA sing N N 327 SER N H sing N N 328 SER N H2 sing N N 329 SER CA C sing N N 330 SER CA CB sing N N 331 SER CA HA sing N N 332 SER C O doub N N 333 SER C OXT sing N N 334 SER CB OG sing N N 335 SER CB HB2 sing N N 336 SER CB HB3 sing N N 337 SER OG HG sing N N 338 SER OXT HXT sing N N 339 THR N CA sing N N 340 THR N H sing N N 341 THR N H2 sing N N 342 THR CA C sing N N 343 THR CA CB sing N N 344 THR CA HA sing N N 345 THR C O doub N N 346 THR C OXT sing N N 347 THR CB OG1 sing N N 348 THR CB CG2 sing N N 349 THR CB HB sing N N 350 THR OG1 HG1 sing N N 351 THR CG2 HG21 sing N N 352 THR CG2 HG22 sing N N 353 THR CG2 HG23 sing N N 354 THR OXT HXT sing N N 355 TYR N CA sing N N 356 TYR N H sing N N 357 TYR N H2 sing N N 358 TYR CA C sing N N 359 TYR CA CB sing N N 360 TYR CA HA sing N N 361 TYR C O doub N N 362 TYR C OXT sing N N 363 TYR CB CG sing N N 364 TYR CB HB2 sing N N 365 TYR CB HB3 sing N N 366 TYR CG CD1 doub Y N 367 TYR CG CD2 sing Y N 368 TYR CD1 CE1 sing Y N 369 TYR CD1 HD1 sing N N 370 TYR CD2 CE2 doub Y N 371 TYR CD2 HD2 sing N N 372 TYR CE1 CZ doub Y N 373 TYR CE1 HE1 sing N N 374 TYR CE2 CZ sing Y N 375 TYR CE2 HE2 sing N N 376 TYR CZ OH sing N N 377 TYR OH HH sing N N 378 TYR OXT HXT sing N N 379 VAL N CA sing N N 380 VAL N H sing N N 381 VAL N H2 sing N N 382 VAL CA C sing N N 383 VAL CA CB sing N N 384 VAL CA HA sing N N 385 VAL C O doub N N 386 VAL C OXT sing N N 387 VAL CB CG1 sing N N 388 VAL CB CG2 sing N N 389 VAL CB HB sing N N 390 VAL CG1 HG11 sing N N 391 VAL CG1 HG12 sing N N 392 VAL CG1 HG13 sing N N 393 VAL CG2 HG21 sing N N 394 VAL CG2 HG22 sing N N 395 VAL CG2 HG23 sing N N 396 VAL OXT HXT sing N N 397 # _atom_sites.entry_id 5DAF _atom_sites.fract_transf_matrix[1][1] 0.023558 _atom_sites.fract_transf_matrix[1][2] 0.013601 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027202 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007460 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_