data_5DFX # _entry.id 5DFX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5DFX WWPDB D_1000209636 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DFX _pdbx_database_status.recvd_initial_deposition_date 2015-08-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, X.-L.' 1 'Zhao, K.-H.' 2 'Gaertner, W.' 3 'Hoeppner, A.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural elements regulating the photochromicity in a cyanobacteriochrome' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1910208117 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, X.-L.' 1 ? primary 'Hoeppner, A.' 2 ? primary 'Wiebeler, C.' 3 ? primary 'Zhao, K.-H.' 4 ? primary 'Schapiro, I.' 5 ? primary 'Gaertner, W.' 6 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5DFX _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.120 _cell.length_a_esd ? _cell.length_b 63.120 _cell.length_b_esd ? _cell.length_c 118.830 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DFX _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histidine kinase' 24856.637 1 2.7.13.3 ? 'residues 441-597' ? 2 non-polymer syn PHYCOCYANOBILIN 588.694 1 ? ? ? ? 3 water nat water 18.015 168 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSLQNIFRATSDEVRHLLSCDRVLVYRFNPDW SGEFIHESVAQMWEPLKDLQNNFPLWQDTYLQENEGGRYRNHESLAVGDVETAGFTDCHLDNLRRFEIRAFLTVPVFVGE QLWGLLGAYQNGAPRHWQAREIHLLHQIANQLGVAVYQAQLLARFQELEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSLQNIFRATSDEVRHLLSCDRVLVYRFNPDW SGEFIHESVAQMWEPLKDLQNNFPLWQDTYLQENEGGRYRNHESLAVGDVETAGFTDCHLDNLRRFEIRAFLTVPVFVGE QLWGLLGAYQNGAPRHWQAREIHLLHQIANQLGVAVYQAQLLARFQELEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 LEU n 1 12 VAL n 1 13 PRO n 1 14 ARG n 1 15 GLY n 1 16 SER n 1 17 GLY n 1 18 MET n 1 19 LYS n 1 20 GLU n 1 21 THR n 1 22 ALA n 1 23 ALA n 1 24 ALA n 1 25 LYS n 1 26 PHE n 1 27 GLU n 1 28 ARG n 1 29 GLN n 1 30 HIS n 1 31 MET n 1 32 ASP n 1 33 SER n 1 34 PRO n 1 35 ASP n 1 36 LEU n 1 37 GLY n 1 38 THR n 1 39 ASP n 1 40 ASP n 1 41 ASP n 1 42 ASP n 1 43 LYS n 1 44 ALA n 1 45 MET n 1 46 ALA n 1 47 ASP n 1 48 ILE n 1 49 GLY n 1 50 SER n 1 51 LEU n 1 52 GLN n 1 53 ASN n 1 54 ILE n 1 55 PHE n 1 56 ARG n 1 57 ALA n 1 58 THR n 1 59 SER n 1 60 ASP n 1 61 GLU n 1 62 VAL n 1 63 ARG n 1 64 HIS n 1 65 LEU n 1 66 LEU n 1 67 SER n 1 68 CYS n 1 69 ASP n 1 70 ARG n 1 71 VAL n 1 72 LEU n 1 73 VAL n 1 74 TYR n 1 75 ARG n 1 76 PHE n 1 77 ASN n 1 78 PRO n 1 79 ASP n 1 80 TRP n 1 81 SER n 1 82 GLY n 1 83 GLU n 1 84 PHE n 1 85 ILE n 1 86 HIS n 1 87 GLU n 1 88 SER n 1 89 VAL n 1 90 ALA n 1 91 GLN n 1 92 MET n 1 93 TRP n 1 94 GLU n 1 95 PRO n 1 96 LEU n 1 97 LYS n 1 98 ASP n 1 99 LEU n 1 100 GLN n 1 101 ASN n 1 102 ASN n 1 103 PHE n 1 104 PRO n 1 105 LEU n 1 106 TRP n 1 107 GLN n 1 108 ASP n 1 109 THR n 1 110 TYR n 1 111 LEU n 1 112 GLN n 1 113 GLU n 1 114 ASN n 1 115 GLU n 1 116 GLY n 1 117 GLY n 1 118 ARG n 1 119 TYR n 1 120 ARG n 1 121 ASN n 1 122 HIS n 1 123 GLU n 1 124 SER n 1 125 LEU n 1 126 ALA n 1 127 VAL n 1 128 GLY n 1 129 ASP n 1 130 VAL n 1 131 GLU n 1 132 THR n 1 133 ALA n 1 134 GLY n 1 135 PHE n 1 136 THR n 1 137 ASP n 1 138 CYS n 1 139 HIS n 1 140 LEU n 1 141 ASP n 1 142 ASN n 1 143 LEU n 1 144 ARG n 1 145 ARG n 1 146 PHE n 1 147 GLU n 1 148 ILE n 1 149 ARG n 1 150 ALA n 1 151 PHE n 1 152 LEU n 1 153 THR n 1 154 VAL n 1 155 PRO n 1 156 VAL n 1 157 PHE n 1 158 VAL n 1 159 GLY n 1 160 GLU n 1 161 GLN n 1 162 LEU n 1 163 TRP n 1 164 GLY n 1 165 LEU n 1 166 LEU n 1 167 GLY n 1 168 ALA n 1 169 TYR n 1 170 GLN n 1 171 ASN n 1 172 GLY n 1 173 ALA n 1 174 PRO n 1 175 ARG n 1 176 HIS n 1 177 TRP n 1 178 GLN n 1 179 ALA n 1 180 ARG n 1 181 GLU n 1 182 ILE n 1 183 HIS n 1 184 LEU n 1 185 LEU n 1 186 HIS n 1 187 GLN n 1 188 ILE n 1 189 ALA n 1 190 ASN n 1 191 GLN n 1 192 LEU n 1 193 GLY n 1 194 VAL n 1 195 ALA n 1 196 VAL n 1 197 TYR n 1 198 GLN n 1 199 ALA n 1 200 GLN n 1 201 LEU n 1 202 LEU n 1 203 ALA n 1 204 ARG n 1 205 PHE n 1 206 GLN n 1 207 GLU n 1 208 LEU n 1 209 GLU n 1 210 HIS n 1 211 HIS n 1 212 HIS n 1 213 HIS n 1 214 HIS n 1 215 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 215 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene slr1393 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Synechocystis sp. (strain PCC 6803 / Kazusa)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1111708 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P73184_SYNY3 _struct_ref.pdbx_db_accession P73184 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LQNIFRATSDEVRHLLSCDRVLVYRFNPDWSGEFIHESVAQMWEPLKDLQNNFPLWQDTYLQENEGGRYRNHESLAVGDV ETAGFTDCHLDNLRRFEIRAFLTVPVFVGEQLWGLLGAYQNGAPRHWQAREIHLLHQIANQLGVAVYQAQLLARFQE ; _struct_ref.pdbx_align_begin 441 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5DFX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 51 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 207 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P73184 _struct_ref_seq.db_align_beg 441 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 597 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 441 _struct_ref_seq.pdbx_auth_seq_align_end 597 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5DFX MET A 1 ? UNP P73184 ? ? 'initiating methionine' 391 1 1 5DFX HIS A 2 ? UNP P73184 ? ? 'expression tag' 392 2 1 5DFX HIS A 3 ? UNP P73184 ? ? 'expression tag' 393 3 1 5DFX HIS A 4 ? UNP P73184 ? ? 'expression tag' 394 4 1 5DFX HIS A 5 ? UNP P73184 ? ? 'expression tag' 395 5 1 5DFX HIS A 6 ? UNP P73184 ? ? 'expression tag' 396 6 1 5DFX HIS A 7 ? UNP P73184 ? ? 'expression tag' 397 7 1 5DFX SER A 8 ? UNP P73184 ? ? 'expression tag' 398 8 1 5DFX SER A 9 ? UNP P73184 ? ? 'expression tag' 399 9 1 5DFX GLY A 10 ? UNP P73184 ? ? 'expression tag' 400 10 1 5DFX LEU A 11 ? UNP P73184 ? ? 'expression tag' 401 11 1 5DFX VAL A 12 ? UNP P73184 ? ? 'expression tag' 402 12 1 5DFX PRO A 13 ? UNP P73184 ? ? 'expression tag' 403 13 1 5DFX ARG A 14 ? UNP P73184 ? ? 'expression tag' 404 14 1 5DFX GLY A 15 ? UNP P73184 ? ? 'expression tag' 405 15 1 5DFX SER A 16 ? UNP P73184 ? ? 'expression tag' 406 16 1 5DFX GLY A 17 ? UNP P73184 ? ? 'expression tag' 407 17 1 5DFX MET A 18 ? UNP P73184 ? ? 'expression tag' 408 18 1 5DFX LYS A 19 ? UNP P73184 ? ? 'expression tag' 409 19 1 5DFX GLU A 20 ? UNP P73184 ? ? 'expression tag' 410 20 1 5DFX THR A 21 ? UNP P73184 ? ? 'expression tag' 411 21 1 5DFX ALA A 22 ? UNP P73184 ? ? 'expression tag' 412 22 1 5DFX ALA A 23 ? UNP P73184 ? ? 'expression tag' 413 23 1 5DFX ALA A 24 ? UNP P73184 ? ? 'expression tag' 414 24 1 5DFX LYS A 25 ? UNP P73184 ? ? 'expression tag' 415 25 1 5DFX PHE A 26 ? UNP P73184 ? ? 'expression tag' 416 26 1 5DFX GLU A 27 ? UNP P73184 ? ? 'expression tag' 417 27 1 5DFX ARG A 28 ? UNP P73184 ? ? 'expression tag' 418 28 1 5DFX GLN A 29 ? UNP P73184 ? ? 'expression tag' 419 29 1 5DFX HIS A 30 ? UNP P73184 ? ? 'expression tag' 420 30 1 5DFX MET A 31 ? UNP P73184 ? ? 'expression tag' 421 31 1 5DFX ASP A 32 ? UNP P73184 ? ? 'expression tag' 422 32 1 5DFX SER A 33 ? UNP P73184 ? ? 'expression tag' 423 33 1 5DFX PRO A 34 ? UNP P73184 ? ? 'expression tag' 424 34 1 5DFX ASP A 35 ? UNP P73184 ? ? 'expression tag' 425 35 1 5DFX LEU A 36 ? UNP P73184 ? ? 'expression tag' 426 36 1 5DFX GLY A 37 ? UNP P73184 ? ? 'expression tag' 427 37 1 5DFX THR A 38 ? UNP P73184 ? ? 'expression tag' 428 38 1 5DFX ASP A 39 ? UNP P73184 ? ? 'expression tag' 429 39 1 5DFX ASP A 40 ? UNP P73184 ? ? 'expression tag' 430 40 1 5DFX ASP A 41 ? UNP P73184 ? ? 'expression tag' 431 41 1 5DFX ASP A 42 ? UNP P73184 ? ? 'expression tag' 432 42 1 5DFX LYS A 43 ? UNP P73184 ? ? 'expression tag' 433 43 1 5DFX ALA A 44 ? UNP P73184 ? ? 'expression tag' 434 44 1 5DFX MET A 45 ? UNP P73184 ? ? 'expression tag' 435 45 1 5DFX ALA A 46 ? UNP P73184 ? ? 'expression tag' 436 46 1 5DFX ASP A 47 ? UNP P73184 ? ? 'expression tag' 437 47 1 5DFX ILE A 48 ? UNP P73184 ? ? 'expression tag' 438 48 1 5DFX GLY A 49 ? UNP P73184 ? ? 'expression tag' 439 49 1 5DFX SER A 50 ? UNP P73184 ? ? 'expression tag' 440 50 1 5DFX LEU A 208 ? UNP P73184 ? ? 'expression tag' 598 51 1 5DFX GLU A 209 ? UNP P73184 ? ? 'expression tag' 599 52 1 5DFX HIS A 210 ? UNP P73184 ? ? 'expression tag' 600 53 1 5DFX HIS A 211 ? UNP P73184 ? ? 'expression tag' 601 54 1 5DFX HIS A 212 ? UNP P73184 ? ? 'expression tag' 602 55 1 5DFX HIS A 213 ? UNP P73184 ? ? 'expression tag' 603 56 1 5DFX HIS A 214 ? UNP P73184 ? ? 'expression tag' 604 57 1 5DFX HIS A 215 ? UNP P73184 ? ? 'expression tag' 605 58 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYC non-polymer . PHYCOCYANOBILIN ? 'C33 H40 N4 O6' 588.694 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DFX _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.38 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 285 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.02 M Tris pH 7.0, 0.1 M sodium chloride, 7.7 % (w/v) PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-05-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97916 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97916 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5DFX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.80 _reflns.d_resolution_low 19.96 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22947 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.63 _reflns.pdbx_Rmerge_I_obs 0.056 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.19 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.91 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.42 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.301 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.52 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.00 _refine.B_iso_max ? _refine.B_iso_mean 27.946 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.967 _refine.correlation_coeff_Fo_to_Fc_free 0.948 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DFX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 19.96 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21860 _refine.ls_number_reflns_R_free 1039 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.48 _refine.ls_percent_reflns_R_free 4.5 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.16585 _refine.ls_R_factor_R_free 0.19902 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.16431 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.095 _refine.pdbx_overall_ESU_R_Free 0.097 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.063 _refine.overall_SU_ML 0.064 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1299 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.number_atoms_solvent 168 _refine_hist.number_atoms_total 1510 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 19.96 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.022 0.019 1426 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 1309 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.428 1.953 1947 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.032 3.001 2978 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.711 5.000 168 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.319 23.659 82 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.336 15.000 218 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.042 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.144 0.200 198 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.014 0.020 1678 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.017 0.020 389 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 3.050 2.463 651 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.037 2.456 650 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.163 3.668 814 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.170 3.674 815 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.907 2.886 775 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.905 2.886 776 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.776 4.183 1129 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.580 21.958 1811 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 7.578 21.959 1812 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.800 _refine_ls_shell.d_res_low 1.846 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 70 _refine_ls_shell.number_reflns_R_work 1560 _refine_ls_shell.percent_reflns_obs 98.25 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.282 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.229 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5DFX _struct.title 'Structure of the parental state of GAF3 from Slr1393 of Synechocystis sp. PCC6803 (in vivo assembled protein/chromophore)' _struct.pdbx_descriptor 'Histidine kinase (E.C.2.7.13.3)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DFX _struct_keywords.text ;cyanobacteriochrome, phycocyanobilin chromophore, photochromicity, bilin-binding GAF domain, phytochrome-related protein, transferase ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 49 ? SER A 67 ? GLY A 439 SER A 457 1 ? 19 HELX_P HELX_P2 AA2 ASP A 108 ? ASN A 114 ? ASP A 498 ASN A 504 1 ? 7 HELX_P HELX_P3 AA3 GLY A 116 ? HIS A 122 ? GLY A 506 HIS A 512 5 ? 7 HELX_P HELX_P4 AA4 ASP A 129 ? ALA A 133 ? ASP A 519 ALA A 523 5 ? 5 HELX_P HELX_P5 AA5 THR A 136 ? PHE A 146 ? THR A 526 PHE A 536 1 ? 11 HELX_P HELX_P6 AA6 GLN A 178 ? ARG A 204 ? GLN A 568 ARG A 594 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 138 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id CYC _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id CAC _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 528 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYC _struct_conn.ptnr2_auth_seq_id 701 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.631 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 82 ? VAL A 89 ? GLY A 472 VAL A 479 AA1 2 ARG A 70 ? PHE A 76 ? ARG A 460 PHE A 466 AA1 3 GLN A 161 ? GLN A 170 ? GLN A 551 GLN A 560 AA1 4 ALA A 150 ? VAL A 158 ? ALA A 540 VAL A 548 AA1 5 LEU A 125 ? VAL A 127 ? LEU A 515 VAL A 517 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 83 ? O GLU A 473 N ARG A 75 ? N ARG A 465 AA1 2 3 N ARG A 70 ? N ARG A 460 O TYR A 169 ? O TYR A 559 AA1 3 4 O GLY A 164 ? O GLY A 554 N VAL A 156 ? N VAL A 546 AA1 4 5 O PHE A 151 ? O PHE A 541 N VAL A 127 ? N VAL A 517 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CYC _struct_site.pdbx_auth_seq_id 701 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 20 _struct_site.details 'binding site for residue CYC A 701' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 20 TYR A 74 ? TYR A 464 . ? 1_555 ? 2 AC1 20 PHE A 84 ? PHE A 474 . ? 1_555 ? 3 AC1 20 TRP A 106 ? TRP A 496 . ? 1_555 ? 4 AC1 20 GLN A 107 ? GLN A 497 . ? 1_555 ? 5 AC1 20 ASP A 108 ? ASP A 498 . ? 1_555 ? 6 AC1 20 THR A 109 ? THR A 499 . ? 1_555 ? 7 AC1 20 TYR A 110 ? TYR A 500 . ? 1_555 ? 8 AC1 20 ARG A 118 ? ARG A 508 . ? 1_555 ? 9 AC1 20 TYR A 119 ? TYR A 509 . ? 1_555 ? 10 AC1 20 LEU A 125 ? LEU A 515 . ? 1_555 ? 11 AC1 20 PHE A 135 ? PHE A 525 . ? 1_555 ? 12 AC1 20 THR A 136 ? THR A 526 . ? 1_555 ? 13 AC1 20 CYS A 138 ? CYS A 528 . ? 1_555 ? 14 AC1 20 HIS A 139 ? HIS A 529 . ? 1_555 ? 15 AC1 20 ASN A 142 ? ASN A 532 . ? 1_555 ? 16 AC1 20 THR A 153 ? THR A 543 . ? 1_555 ? 17 AC1 20 TYR A 169 ? TYR A 559 . ? 1_555 ? 18 AC1 20 HOH C . ? HOH A 805 . ? 1_555 ? 19 AC1 20 HOH C . ? HOH A 820 . ? 1_555 ? 20 AC1 20 HOH C . ? HOH A 842 . ? 1_555 ? # _atom_sites.entry_id 5DFX _atom_sites.fract_transf_matrix[1][1] 0.015843 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015843 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008415 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 391 ? ? ? A . n A 1 2 HIS 2 392 ? ? ? A . n A 1 3 HIS 3 393 ? ? ? A . n A 1 4 HIS 4 394 ? ? ? A . n A 1 5 HIS 5 395 ? ? ? A . n A 1 6 HIS 6 396 ? ? ? A . n A 1 7 HIS 7 397 ? ? ? A . n A 1 8 SER 8 398 ? ? ? A . n A 1 9 SER 9 399 ? ? ? A . n A 1 10 GLY 10 400 ? ? ? A . n A 1 11 LEU 11 401 ? ? ? A . n A 1 12 VAL 12 402 ? ? ? A . n A 1 13 PRO 13 403 ? ? ? A . n A 1 14 ARG 14 404 ? ? ? A . n A 1 15 GLY 15 405 ? ? ? A . n A 1 16 SER 16 406 ? ? ? A . n A 1 17 GLY 17 407 ? ? ? A . n A 1 18 MET 18 408 ? ? ? A . n A 1 19 LYS 19 409 ? ? ? A . n A 1 20 GLU 20 410 ? ? ? A . n A 1 21 THR 21 411 ? ? ? A . n A 1 22 ALA 22 412 ? ? ? A . n A 1 23 ALA 23 413 ? ? ? A . n A 1 24 ALA 24 414 ? ? ? A . n A 1 25 LYS 25 415 ? ? ? A . n A 1 26 PHE 26 416 ? ? ? A . n A 1 27 GLU 27 417 ? ? ? A . n A 1 28 ARG 28 418 ? ? ? A . n A 1 29 GLN 29 419 ? ? ? A . n A 1 30 HIS 30 420 ? ? ? A . n A 1 31 MET 31 421 ? ? ? A . n A 1 32 ASP 32 422 ? ? ? A . n A 1 33 SER 33 423 ? ? ? A . n A 1 34 PRO 34 424 ? ? ? A . n A 1 35 ASP 35 425 ? ? ? A . n A 1 36 LEU 36 426 ? ? ? A . n A 1 37 GLY 37 427 ? ? ? A . n A 1 38 THR 38 428 ? ? ? A . n A 1 39 ASP 39 429 ? ? ? A . n A 1 40 ASP 40 430 ? ? ? A . n A 1 41 ASP 41 431 ? ? ? A . n A 1 42 ASP 42 432 ? ? ? A . n A 1 43 LYS 43 433 ? ? ? A . n A 1 44 ALA 44 434 ? ? ? A . n A 1 45 MET 45 435 ? ? ? A . n A 1 46 ALA 46 436 ? ? ? A . n A 1 47 ASP 47 437 ? ? ? A . n A 1 48 ILE 48 438 ? ? ? A . n A 1 49 GLY 49 439 439 GLY GLY A . n A 1 50 SER 50 440 440 SER SER A . n A 1 51 LEU 51 441 441 LEU LEU A . n A 1 52 GLN 52 442 442 GLN GLN A . n A 1 53 ASN 53 443 443 ASN ASN A . n A 1 54 ILE 54 444 444 ILE ILE A . n A 1 55 PHE 55 445 445 PHE PHE A . n A 1 56 ARG 56 446 446 ARG ARG A . n A 1 57 ALA 57 447 447 ALA ALA A . n A 1 58 THR 58 448 448 THR THR A . n A 1 59 SER 59 449 449 SER SER A . n A 1 60 ASP 60 450 450 ASP ASP A . n A 1 61 GLU 61 451 451 GLU GLU A . n A 1 62 VAL 62 452 452 VAL VAL A . n A 1 63 ARG 63 453 453 ARG ARG A . n A 1 64 HIS 64 454 454 HIS HIS A . n A 1 65 LEU 65 455 455 LEU LEU A . n A 1 66 LEU 66 456 456 LEU LEU A . n A 1 67 SER 67 457 457 SER SER A . n A 1 68 CYS 68 458 458 CYS CYS A . n A 1 69 ASP 69 459 459 ASP ASP A . n A 1 70 ARG 70 460 460 ARG ARG A . n A 1 71 VAL 71 461 461 VAL VAL A . n A 1 72 LEU 72 462 462 LEU LEU A . n A 1 73 VAL 73 463 463 VAL VAL A . n A 1 74 TYR 74 464 464 TYR TYR A . n A 1 75 ARG 75 465 465 ARG ARG A . n A 1 76 PHE 76 466 466 PHE PHE A . n A 1 77 ASN 77 467 467 ASN ASN A . n A 1 78 PRO 78 468 468 PRO PRO A . n A 1 79 ASP 79 469 469 ASP ASP A . n A 1 80 TRP 80 470 470 TRP TRP A . n A 1 81 SER 81 471 471 SER SER A . n A 1 82 GLY 82 472 472 GLY GLY A . n A 1 83 GLU 83 473 473 GLU GLU A . n A 1 84 PHE 84 474 474 PHE PHE A . n A 1 85 ILE 85 475 475 ILE ILE A . n A 1 86 HIS 86 476 476 HIS HIS A . n A 1 87 GLU 87 477 477 GLU GLU A . n A 1 88 SER 88 478 478 SER SER A . n A 1 89 VAL 89 479 479 VAL VAL A . n A 1 90 ALA 90 480 480 ALA ALA A . n A 1 91 GLN 91 481 481 GLN GLN A . n A 1 92 MET 92 482 482 MET MET A . n A 1 93 TRP 93 483 483 TRP TRP A . n A 1 94 GLU 94 484 484 GLU GLU A . n A 1 95 PRO 95 485 485 PRO PRO A . n A 1 96 LEU 96 486 486 LEU LEU A . n A 1 97 LYS 97 487 487 LYS LYS A . n A 1 98 ASP 98 488 488 ASP ASP A . n A 1 99 LEU 99 489 489 LEU LEU A . n A 1 100 GLN 100 490 490 GLN GLN A . n A 1 101 ASN 101 491 491 ASN ASN A . n A 1 102 ASN 102 492 492 ASN ASN A . n A 1 103 PHE 103 493 493 PHE PHE A . n A 1 104 PRO 104 494 494 PRO PRO A . n A 1 105 LEU 105 495 495 LEU LEU A . n A 1 106 TRP 106 496 496 TRP TRP A . n A 1 107 GLN 107 497 497 GLN GLN A . n A 1 108 ASP 108 498 498 ASP ASP A . n A 1 109 THR 109 499 499 THR THR A . n A 1 110 TYR 110 500 500 TYR TYR A . n A 1 111 LEU 111 501 501 LEU LEU A . n A 1 112 GLN 112 502 502 GLN GLN A . n A 1 113 GLU 113 503 503 GLU GLU A . n A 1 114 ASN 114 504 504 ASN ASN A . n A 1 115 GLU 115 505 505 GLU GLU A . n A 1 116 GLY 116 506 506 GLY GLY A . n A 1 117 GLY 117 507 507 GLY GLY A . n A 1 118 ARG 118 508 508 ARG ARG A . n A 1 119 TYR 119 509 509 TYR TYR A . n A 1 120 ARG 120 510 510 ARG ARG A . n A 1 121 ASN 121 511 511 ASN ASN A . n A 1 122 HIS 122 512 512 HIS HIS A . n A 1 123 GLU 123 513 513 GLU GLU A . n A 1 124 SER 124 514 514 SER SER A . n A 1 125 LEU 125 515 515 LEU LEU A . n A 1 126 ALA 126 516 516 ALA ALA A . n A 1 127 VAL 127 517 517 VAL VAL A . n A 1 128 GLY 128 518 518 GLY GLY A . n A 1 129 ASP 129 519 519 ASP ASP A . n A 1 130 VAL 130 520 520 VAL VAL A . n A 1 131 GLU 131 521 521 GLU GLU A . n A 1 132 THR 132 522 522 THR THR A . n A 1 133 ALA 133 523 523 ALA ALA A . n A 1 134 GLY 134 524 524 GLY GLY A . n A 1 135 PHE 135 525 525 PHE PHE A . n A 1 136 THR 136 526 526 THR THR A . n A 1 137 ASP 137 527 527 ASP ASP A . n A 1 138 CYS 138 528 528 CYS CYS A . n A 1 139 HIS 139 529 529 HIS HIS A . n A 1 140 LEU 140 530 530 LEU LEU A . n A 1 141 ASP 141 531 531 ASP ASP A . n A 1 142 ASN 142 532 532 ASN ASN A . n A 1 143 LEU 143 533 533 LEU LEU A . n A 1 144 ARG 144 534 534 ARG ARG A . n A 1 145 ARG 145 535 535 ARG ARG A . n A 1 146 PHE 146 536 536 PHE PHE A . n A 1 147 GLU 147 537 537 GLU GLU A . n A 1 148 ILE 148 538 538 ILE ILE A . n A 1 149 ARG 149 539 539 ARG ARG A . n A 1 150 ALA 150 540 540 ALA ALA A . n A 1 151 PHE 151 541 541 PHE PHE A . n A 1 152 LEU 152 542 542 LEU LEU A . n A 1 153 THR 153 543 543 THR THR A . n A 1 154 VAL 154 544 544 VAL VAL A . n A 1 155 PRO 155 545 545 PRO PRO A . n A 1 156 VAL 156 546 546 VAL VAL A . n A 1 157 PHE 157 547 547 PHE PHE A . n A 1 158 VAL 158 548 548 VAL VAL A . n A 1 159 GLY 159 549 549 GLY GLY A . n A 1 160 GLU 160 550 550 GLU GLU A . n A 1 161 GLN 161 551 551 GLN GLN A . n A 1 162 LEU 162 552 552 LEU LEU A . n A 1 163 TRP 163 553 553 TRP TRP A . n A 1 164 GLY 164 554 554 GLY GLY A . n A 1 165 LEU 165 555 555 LEU LEU A . n A 1 166 LEU 166 556 556 LEU LEU A . n A 1 167 GLY 167 557 557 GLY GLY A . n A 1 168 ALA 168 558 558 ALA ALA A . n A 1 169 TYR 169 559 559 TYR TYR A . n A 1 170 GLN 170 560 560 GLN GLN A . n A 1 171 ASN 171 561 561 ASN ASN A . n A 1 172 GLY 172 562 562 GLY GLY A . n A 1 173 ALA 173 563 563 ALA ALA A . n A 1 174 PRO 174 564 564 PRO PRO A . n A 1 175 ARG 175 565 565 ARG ARG A . n A 1 176 HIS 176 566 566 HIS HIS A . n A 1 177 TRP 177 567 567 TRP TRP A . n A 1 178 GLN 178 568 568 GLN GLN A . n A 1 179 ALA 179 569 569 ALA ALA A . n A 1 180 ARG 180 570 570 ARG ARG A . n A 1 181 GLU 181 571 571 GLU GLU A . n A 1 182 ILE 182 572 572 ILE ILE A . n A 1 183 HIS 183 573 573 HIS HIS A . n A 1 184 LEU 184 574 574 LEU LEU A . n A 1 185 LEU 185 575 575 LEU LEU A . n A 1 186 HIS 186 576 576 HIS HIS A . n A 1 187 GLN 187 577 577 GLN GLN A . n A 1 188 ILE 188 578 578 ILE ILE A . n A 1 189 ALA 189 579 579 ALA ALA A . n A 1 190 ASN 190 580 580 ASN ASN A . n A 1 191 GLN 191 581 581 GLN GLN A . n A 1 192 LEU 192 582 582 LEU LEU A . n A 1 193 GLY 193 583 583 GLY GLY A . n A 1 194 VAL 194 584 584 VAL VAL A . n A 1 195 ALA 195 585 585 ALA ALA A . n A 1 196 VAL 196 586 586 VAL VAL A . n A 1 197 TYR 197 587 587 TYR TYR A . n A 1 198 GLN 198 588 588 GLN GLN A . n A 1 199 ALA 199 589 589 ALA ALA A . n A 1 200 GLN 200 590 590 GLN GLN A . n A 1 201 LEU 201 591 591 LEU LEU A . n A 1 202 LEU 202 592 592 LEU LEU A . n A 1 203 ALA 203 593 593 ALA ALA A . n A 1 204 ARG 204 594 594 ARG ARG A . n A 1 205 PHE 205 595 595 PHE PHE A . n A 1 206 GLN 206 596 596 GLN GLN A . n A 1 207 GLU 207 597 ? ? ? A . n A 1 208 LEU 208 598 ? ? ? A . n A 1 209 GLU 209 599 ? ? ? A . n A 1 210 HIS 210 600 ? ? ? A . n A 1 211 HIS 211 601 ? ? ? A . n A 1 212 HIS 212 602 ? ? ? A . n A 1 213 HIS 213 603 ? ? ? A . n A 1 214 HIS 214 604 ? ? ? A . n A 1 215 HIS 215 605 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CYC 1 701 1 CYC CYC A . C 3 HOH 1 801 57 HOH HOH A . C 3 HOH 2 802 34 HOH HOH A . C 3 HOH 3 803 170 HOH HOH A . C 3 HOH 4 804 234 HOH HOH A . C 3 HOH 5 805 131 HOH HOH A . C 3 HOH 6 806 85 HOH HOH A . C 3 HOH 7 807 133 HOH HOH A . C 3 HOH 8 808 61 HOH HOH A . C 3 HOH 9 809 153 HOH HOH A . C 3 HOH 10 810 177 HOH HOH A . C 3 HOH 11 811 262 HOH HOH A . C 3 HOH 12 812 53 HOH HOH A . C 3 HOH 13 813 164 HOH HOH A . C 3 HOH 14 814 33 HOH HOH A . C 3 HOH 15 815 152 HOH HOH A . C 3 HOH 16 816 59 HOH HOH A . C 3 HOH 17 817 2 HOH HOH A . C 3 HOH 18 818 204 HOH HOH A . C 3 HOH 19 819 45 HOH HOH A . C 3 HOH 20 820 120 HOH HOH A . C 3 HOH 21 821 109 HOH HOH A . C 3 HOH 22 822 224 HOH HOH A . C 3 HOH 23 823 16 HOH HOH A . C 3 HOH 24 824 78 HOH HOH A . C 3 HOH 25 825 96 HOH HOH A . C 3 HOH 26 826 121 HOH HOH A . C 3 HOH 27 827 19 HOH HOH A . C 3 HOH 28 828 4 HOH HOH A . C 3 HOH 29 829 37 HOH HOH A . C 3 HOH 30 830 137 HOH HOH A . C 3 HOH 31 831 76 HOH HOH A . C 3 HOH 32 832 64 HOH HOH A . C 3 HOH 33 833 124 HOH HOH A . C 3 HOH 34 834 54 HOH HOH A . C 3 HOH 35 835 25 HOH HOH A . C 3 HOH 36 836 5 HOH HOH A . C 3 HOH 37 837 112 HOH HOH A . C 3 HOH 38 838 24 HOH HOH A . C 3 HOH 39 839 181 HOH HOH A . C 3 HOH 40 840 191 HOH HOH A . C 3 HOH 41 841 196 HOH HOH A . C 3 HOH 42 842 187 HOH HOH A . C 3 HOH 43 843 231 HOH HOH A . C 3 HOH 44 844 42 HOH HOH A . C 3 HOH 45 845 100 HOH HOH A . C 3 HOH 46 846 11 HOH HOH A . C 3 HOH 47 847 6 HOH HOH A . C 3 HOH 48 848 108 HOH HOH A . C 3 HOH 49 849 86 HOH HOH A . C 3 HOH 50 850 206 HOH HOH A . C 3 HOH 51 851 154 HOH HOH A . C 3 HOH 52 852 119 HOH HOH A . C 3 HOH 53 853 3 HOH HOH A . C 3 HOH 54 854 128 HOH HOH A . C 3 HOH 55 855 43 HOH HOH A . C 3 HOH 56 856 46 HOH HOH A . C 3 HOH 57 857 66 HOH HOH A . C 3 HOH 58 858 186 HOH HOH A . C 3 HOH 59 859 252 HOH HOH A . C 3 HOH 60 860 56 HOH HOH A . C 3 HOH 61 861 51 HOH HOH A . C 3 HOH 62 862 117 HOH HOH A . C 3 HOH 63 863 159 HOH HOH A . C 3 HOH 64 864 1 HOH HOH A . C 3 HOH 65 865 36 HOH HOH A . C 3 HOH 66 866 79 HOH HOH A . C 3 HOH 67 867 118 HOH HOH A . C 3 HOH 68 868 69 HOH HOH A . C 3 HOH 69 869 28 HOH HOH A . C 3 HOH 70 870 67 HOH HOH A . C 3 HOH 71 871 22 HOH HOH A . C 3 HOH 72 872 74 HOH HOH A . C 3 HOH 73 873 98 HOH HOH A . C 3 HOH 74 874 23 HOH HOH A . C 3 HOH 75 875 90 HOH HOH A . C 3 HOH 76 876 143 HOH HOH A . C 3 HOH 77 877 144 HOH HOH A . C 3 HOH 78 878 70 HOH HOH A . C 3 HOH 79 879 227 HOH HOH A . C 3 HOH 80 880 87 HOH HOH A . C 3 HOH 81 881 27 HOH HOH A . C 3 HOH 82 882 83 HOH HOH A . C 3 HOH 83 883 94 HOH HOH A . C 3 HOH 84 884 49 HOH HOH A . C 3 HOH 85 885 32 HOH HOH A . C 3 HOH 86 886 44 HOH HOH A . C 3 HOH 87 887 102 HOH HOH A . C 3 HOH 88 888 75 HOH HOH A . C 3 HOH 89 889 188 HOH HOH A . C 3 HOH 90 890 251 HOH HOH A . C 3 HOH 91 891 47 HOH HOH A . C 3 HOH 92 892 136 HOH HOH A . C 3 HOH 93 893 63 HOH HOH A . C 3 HOH 94 894 214 HOH HOH A . C 3 HOH 95 895 35 HOH HOH A . C 3 HOH 96 896 31 HOH HOH A . C 3 HOH 97 897 237 HOH HOH A . C 3 HOH 98 898 55 HOH HOH A . C 3 HOH 99 899 26 HOH HOH A . C 3 HOH 100 900 97 HOH HOH A . C 3 HOH 101 901 68 HOH HOH A . C 3 HOH 102 902 15 HOH HOH A . C 3 HOH 103 903 17 HOH HOH A . C 3 HOH 104 904 73 HOH HOH A . C 3 HOH 105 905 208 HOH HOH A . C 3 HOH 106 906 241 HOH HOH A . C 3 HOH 107 907 110 HOH HOH A . C 3 HOH 108 908 249 HOH HOH A . C 3 HOH 109 909 40 HOH HOH A . C 3 HOH 110 910 71 HOH HOH A . C 3 HOH 111 911 161 HOH HOH A . C 3 HOH 112 912 107 HOH HOH A . C 3 HOH 113 913 60 HOH HOH A . C 3 HOH 114 914 180 HOH HOH A . C 3 HOH 115 915 123 HOH HOH A . C 3 HOH 116 916 21 HOH HOH A . C 3 HOH 117 917 261 HOH HOH A . C 3 HOH 118 918 215 HOH HOH A . C 3 HOH 119 919 230 HOH HOH A . C 3 HOH 120 920 198 HOH HOH A . C 3 HOH 121 921 183 HOH HOH A . C 3 HOH 122 922 41 HOH HOH A . C 3 HOH 123 923 58 HOH HOH A . C 3 HOH 124 924 13 HOH HOH A . C 3 HOH 125 925 130 HOH HOH A . C 3 HOH 126 926 103 HOH HOH A . C 3 HOH 127 927 138 HOH HOH A . C 3 HOH 128 928 207 HOH HOH A . C 3 HOH 129 929 104 HOH HOH A . C 3 HOH 130 930 89 HOH HOH A . C 3 HOH 131 931 114 HOH HOH A . C 3 HOH 132 932 184 HOH HOH A . C 3 HOH 133 933 205 HOH HOH A . C 3 HOH 134 934 140 HOH HOH A . C 3 HOH 135 935 163 HOH HOH A . C 3 HOH 136 936 141 HOH HOH A . C 3 HOH 137 937 115 HOH HOH A . C 3 HOH 138 938 151 HOH HOH A . C 3 HOH 139 939 240 HOH HOH A . C 3 HOH 140 940 135 HOH HOH A . C 3 HOH 141 941 132 HOH HOH A . C 3 HOH 142 942 84 HOH HOH A . C 3 HOH 143 943 20 HOH HOH A . C 3 HOH 144 944 30 HOH HOH A . C 3 HOH 145 945 216 HOH HOH A . C 3 HOH 146 946 189 HOH HOH A . C 3 HOH 147 947 95 HOH HOH A . C 3 HOH 148 948 91 HOH HOH A . C 3 HOH 149 949 246 HOH HOH A . C 3 HOH 150 950 80 HOH HOH A . C 3 HOH 151 951 190 HOH HOH A . C 3 HOH 152 952 222 HOH HOH A . C 3 HOH 153 953 160 HOH HOH A . C 3 HOH 154 954 148 HOH HOH A . C 3 HOH 155 955 126 HOH HOH A . C 3 HOH 156 956 93 HOH HOH A . C 3 HOH 157 957 218 HOH HOH A . C 3 HOH 158 958 248 HOH HOH A . C 3 HOH 159 959 158 HOH HOH A . C 3 HOH 160 960 165 HOH HOH A . C 3 HOH 161 961 199 HOH HOH A . C 3 HOH 162 962 134 HOH HOH A . C 3 HOH 163 963 236 HOH HOH A . C 3 HOH 164 964 145 HOH HOH A . C 3 HOH 165 965 171 HOH HOH A . C 3 HOH 166 966 197 HOH HOH A . C 3 HOH 167 967 185 HOH HOH A . C 3 HOH 168 968 201 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3820 ? 1 MORE -46 ? 1 'SSA (A^2)' 16030 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 118.8300000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 950 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-09-14 2 'Structure model' 1 1 2020-01-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0071 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 SER _pdbx_validate_symm_contact.auth_seq_id_1 457 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NH2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 594 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 A _pdbx_validate_symm_contact.site_symmetry_2 6_455 _pdbx_validate_symm_contact.dist 2.01 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 451 ? B OE1 A GLU 451 ? B 1.343 1.252 0.091 0.011 N 2 1 CD A GLU 484 ? ? OE1 A GLU 484 ? ? 1.169 1.252 -0.083 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 450 ? ? CG A ASP 450 ? ? OD1 A ASP 450 ? ? 125.01 118.30 6.71 0.90 N 2 1 CB A ASP 469 ? ? CG A ASP 469 ? ? OD1 A ASP 469 ? ? 124.35 118.30 6.05 0.90 N 3 1 NE A ARG 535 ? ? CZ A ARG 535 ? ? NH1 A ARG 535 ? ? 123.51 120.30 3.21 0.50 N 4 1 C A ALA 593 ? ? N A ARG 594 ? ? CA A ARG 594 ? A 104.20 121.70 -17.50 2.50 Y 5 1 CA A ARG 594 ? A C A ARG 594 ? ? O A ARG 594 ? ? 136.13 120.10 16.03 2.10 N 6 1 CA A ARG 594 ? A C A ARG 594 ? ? N A PHE 595 ? ? 103.53 117.20 -13.67 2.20 Y # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 TRP _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 470 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 SER _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 471 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 148.88 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id ARG _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 594 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id B _pdbx_validate_main_chain_plane.improper_torsion_angle 14.13 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 391 ? A MET 1 2 1 Y 1 A HIS 392 ? A HIS 2 3 1 Y 1 A HIS 393 ? A HIS 3 4 1 Y 1 A HIS 394 ? A HIS 4 5 1 Y 1 A HIS 395 ? A HIS 5 6 1 Y 1 A HIS 396 ? A HIS 6 7 1 Y 1 A HIS 397 ? A HIS 7 8 1 Y 1 A SER 398 ? A SER 8 9 1 Y 1 A SER 399 ? A SER 9 10 1 Y 1 A GLY 400 ? A GLY 10 11 1 Y 1 A LEU 401 ? A LEU 11 12 1 Y 1 A VAL 402 ? A VAL 12 13 1 Y 1 A PRO 403 ? A PRO 13 14 1 Y 1 A ARG 404 ? A ARG 14 15 1 Y 1 A GLY 405 ? A GLY 15 16 1 Y 1 A SER 406 ? A SER 16 17 1 Y 1 A GLY 407 ? A GLY 17 18 1 Y 1 A MET 408 ? A MET 18 19 1 Y 1 A LYS 409 ? A LYS 19 20 1 Y 1 A GLU 410 ? A GLU 20 21 1 Y 1 A THR 411 ? A THR 21 22 1 Y 1 A ALA 412 ? A ALA 22 23 1 Y 1 A ALA 413 ? A ALA 23 24 1 Y 1 A ALA 414 ? A ALA 24 25 1 Y 1 A LYS 415 ? A LYS 25 26 1 Y 1 A PHE 416 ? A PHE 26 27 1 Y 1 A GLU 417 ? A GLU 27 28 1 Y 1 A ARG 418 ? A ARG 28 29 1 Y 1 A GLN 419 ? A GLN 29 30 1 Y 1 A HIS 420 ? A HIS 30 31 1 Y 1 A MET 421 ? A MET 31 32 1 Y 1 A ASP 422 ? A ASP 32 33 1 Y 1 A SER 423 ? A SER 33 34 1 Y 1 A PRO 424 ? A PRO 34 35 1 Y 1 A ASP 425 ? A ASP 35 36 1 Y 1 A LEU 426 ? A LEU 36 37 1 Y 1 A GLY 427 ? A GLY 37 38 1 Y 1 A THR 428 ? A THR 38 39 1 Y 1 A ASP 429 ? A ASP 39 40 1 Y 1 A ASP 430 ? A ASP 40 41 1 Y 1 A ASP 431 ? A ASP 41 42 1 Y 1 A ASP 432 ? A ASP 42 43 1 Y 1 A LYS 433 ? A LYS 43 44 1 Y 1 A ALA 434 ? A ALA 44 45 1 Y 1 A MET 435 ? A MET 45 46 1 Y 1 A ALA 436 ? A ALA 46 47 1 Y 1 A ASP 437 ? A ASP 47 48 1 Y 1 A ILE 438 ? A ILE 48 49 1 Y 1 A GLU 597 ? A GLU 207 50 1 Y 1 A LEU 598 ? A LEU 208 51 1 Y 1 A GLU 599 ? A GLU 209 52 1 Y 1 A HIS 600 ? A HIS 210 53 1 Y 1 A HIS 601 ? A HIS 211 54 1 Y 1 A HIS 602 ? A HIS 212 55 1 Y 1 A HIS 603 ? A HIS 213 56 1 Y 1 A HIS 604 ? A HIS 214 57 1 Y 1 A HIS 605 ? A HIS 215 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 PHYCOCYANOBILIN CYC 3 water HOH #