data_5DIT # _entry.id 5DIT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5DIT WWPDB D_1000213271 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DIT _pdbx_database_status.recvd_initial_deposition_date 2015-09-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Feng, X.' 1 'Sippel, C.' 2 'Bracher, A.' 3 'Hausch, F.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 58 _citation.language ? _citation.page_first 7796 _citation.page_last 7806 _citation.title 'Structure-Affinity Relationship Analysis of Selective FKBP51 Ligands.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.5b00785 _citation.pdbx_database_id_PubMed 26419422 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Feng, X.' 1 primary 'Sippel, C.' 2 primary 'Bracher, A.' 3 primary 'Hausch, F.' 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5DIT _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.371 _cell.length_a_esd ? _cell.length_b 50.220 _cell.length_b_esd ? _cell.length_c 61.811 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DIT _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidyl-prolyl cis-trans isomerase FKBP5' 14026.077 1 5.2.1.8 'additional N-terminal sequence GAP, cloning artefact, mutation A19T' 'Fk1 domain, UNP residues 16-140' ? 2 non-polymer syn ;(1R)-3-(3,4-dimethoxyphenyl)-1-{3-[2-(morpholin-4-yl)ethoxy]phenyl}propyl (2S)-1-[(2S,3R)-2-cyclohexyl-3-hydroxybutanoyl]piperidine-2-carboxylate ; 680.871 1 ? ? ? ? 3 water nat water 18.015 55 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;PPIase FKBP5,51 kDa FK506-binding protein,FKBP-51,54 kDa progesterone receptor-associated immunophilin,Androgen-regulated protein 6,FF1 antigen,FK506-binding protein 5,FKBP-5,FKBP54,p54,HSP90-binding immunophilin,Rotamase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDI GVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE ; _entity_poly.pdbx_seq_one_letter_code_can ;GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDI GVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 PRO n 1 4 ALA n 1 5 THR n 1 6 VAL n 1 7 THR n 1 8 GLU n 1 9 GLN n 1 10 GLY n 1 11 GLU n 1 12 ASP n 1 13 ILE n 1 14 THR n 1 15 SER n 1 16 LYS n 1 17 LYS n 1 18 ASP n 1 19 ARG n 1 20 GLY n 1 21 VAL n 1 22 LEU n 1 23 LYS n 1 24 ILE n 1 25 VAL n 1 26 LYS n 1 27 ARG n 1 28 VAL n 1 29 GLY n 1 30 ASN n 1 31 GLY n 1 32 GLU n 1 33 GLU n 1 34 THR n 1 35 PRO n 1 36 MET n 1 37 ILE n 1 38 GLY n 1 39 ASP n 1 40 LYS n 1 41 VAL n 1 42 TYR n 1 43 VAL n 1 44 HIS n 1 45 TYR n 1 46 LYS n 1 47 GLY n 1 48 LYS n 1 49 LEU n 1 50 SER n 1 51 ASN n 1 52 GLY n 1 53 LYS n 1 54 LYS n 1 55 PHE n 1 56 ASP n 1 57 SER n 1 58 SER n 1 59 HIS n 1 60 ASP n 1 61 ARG n 1 62 ASN n 1 63 GLU n 1 64 PRO n 1 65 PHE n 1 66 VAL n 1 67 PHE n 1 68 SER n 1 69 LEU n 1 70 GLY n 1 71 LYS n 1 72 GLY n 1 73 GLN n 1 74 VAL n 1 75 ILE n 1 76 LYS n 1 77 ALA n 1 78 TRP n 1 79 ASP n 1 80 ILE n 1 81 GLY n 1 82 VAL n 1 83 ALA n 1 84 THR n 1 85 MET n 1 86 LYS n 1 87 LYS n 1 88 GLY n 1 89 GLU n 1 90 ILE n 1 91 CYS n 1 92 HIS n 1 93 LEU n 1 94 LEU n 1 95 CYS n 1 96 LYS n 1 97 PRO n 1 98 GLU n 1 99 TYR n 1 100 ALA n 1 101 TYR n 1 102 GLY n 1 103 SER n 1 104 ALA n 1 105 GLY n 1 106 SER n 1 107 LEU n 1 108 PRO n 1 109 LYS n 1 110 ILE n 1 111 PRO n 1 112 SER n 1 113 ASN n 1 114 ALA n 1 115 THR n 1 116 LEU n 1 117 PHE n 1 118 PHE n 1 119 GLU n 1 120 ILE n 1 121 GLU n 1 122 LEU n 1 123 LEU n 1 124 ASP n 1 125 PHE n 1 126 LYS n 1 127 GLY n 1 128 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 128 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FKBP5, AIG6, FKBP51' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'codon+ RIL' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pProEx-HtB _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FKBP5_HUMAN _struct_ref.pdbx_db_accession Q13451 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVA TMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE ; _struct_ref.pdbx_align_begin 16 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5DIT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13451 _struct_ref_seq.db_align_beg 16 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 140 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 140 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5DIT GLY A 1 ? UNP Q13451 ? ? 'expression tag' 13 1 1 5DIT ALA A 2 ? UNP Q13451 ? ? 'expression tag' 14 2 1 5DIT PRO A 3 ? UNP Q13451 ? ? 'expression tag' 15 3 1 5DIT THR A 7 ? UNP Q13451 ALA 19 'engineered mutation' 19 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 5B8 non-polymer . ;(1R)-3-(3,4-dimethoxyphenyl)-1-{3-[2-(morpholin-4-yl)ethoxy]phenyl}propyl (2S)-1-[(2S,3R)-2-cyclohexyl-3-hydroxybutanoyl]piperidine-2-carboxylate ; ? 'C39 H56 N2 O8' 680.871 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DIT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '22 % PEG-3350, 0.2 M NH4-acetate and 0.1 M HEPES-NaOH pH 7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-07-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9790 1.0 2 0.97895 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97895 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5DIT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.250 _reflns.d_resolution_low 43.370 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6805 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.200 _reflns.pdbx_Rmerge_I_obs 0.101 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.048 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 35482 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.250 2.320 ? 2.400 3134 ? ? 596 ? 95.900 ? ? ? ? 0.677 ? ? ? ? ? ? ? ? 5.300 ? ? ? ? ? 0.323 0 1 1 0.811 ? 8.990 43.370 ? 23.400 540 ? ? 133 ? 98.400 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 4.100 ? ? ? ? ? 0.033 0 2 1 0.995 ? # _refine.aniso_B[1][1] 3.5100 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -2.3300 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -1.1800 _refine.B_iso_max 81.210 _refine.B_iso_mean 39.5840 _refine.B_iso_min 21.750 _refine.correlation_coeff_Fo_to_Fc 0.9480 _refine.correlation_coeff_Fo_to_Fc_free 0.9110 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DIT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2500 _refine.ls_d_res_low 30.0000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6454 _refine.ls_number_reflns_R_free 319 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.4700 _refine.ls_percent_reflns_R_free 4.7000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2142 _refine.ls_R_factor_R_free 0.2841 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2111 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2870 _refine.ls_wR_factor_R_work 0.2028 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.3490 _refine.pdbx_overall_ESU_R_Free 0.2670 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.8450 _refine.overall_SU_ML 0.2080 _refine.overall_SU_R_Cruickshank_DPI 0.3487 _refine.overall_SU_R_free 0.2673 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.7795 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.2500 _refine_hist.d_res_low 30.0000 _refine_hist.pdbx_number_atoms_ligand 49 _refine_hist.number_atoms_solvent 55 _refine_hist.number_atoms_total 1090 _refine_hist.pdbx_number_residues_total 128 _refine_hist.pdbx_B_iso_mean_ligand 42.14 _refine_hist.pdbx_B_iso_mean_solvent 41.11 _refine_hist.pdbx_number_atoms_protein 986 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.020 1059 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1037 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.437 2.026 1422 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.052 3.022 2416 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.547 5.000 127 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 30.357 25.000 40 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.955 15.000 187 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.488 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.077 0.200 150 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.021 1147 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 216 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.2490 _refine_ls_shell.d_res_low 2.3070 _refine_ls_shell.number_reflns_all 483 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 31 _refine_ls_shell.number_reflns_R_work 452 _refine_ls_shell.percent_reflns_obs 96.6000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3290 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3130 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5DIT _struct.title ;The Fk1 domain of FKBP51 in complex with the new synthetic ligand (1R)-3-(3,4-dimethoxyphenyl)-1-f3-[2-(morpholin-4-yl)ethoxy]phenylgpropyl(2S)-1-[(2S,3R)-2-cyclohexyl-3-hydroxybutanoyl]piperidine-2-carboxylate ; _struct.pdbx_descriptor 'Peptidyl-prolyl cis-trans isomerase FKBP5 (E.C.5.2.1.8)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DIT _struct_keywords.text 'Fk-506 binding domain, Hsp90 cochaperone, immunophiline, peptidyl-prolyl isomerase, ligand selectivity, isomerase' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? GLY A 10 ? GLY A 13 GLY A 22 1 ? 10 HELX_P HELX_P2 AA2 HIS A 59 ? ASN A 62 ? HIS A 71 ASN A 74 5 ? 4 HELX_P HELX_P3 AA3 ILE A 75 ? ALA A 83 ? ILE A 87 ALA A 95 1 ? 9 HELX_P HELX_P4 AA4 PRO A 97 ? ALA A 100 ? PRO A 109 ALA A 112 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 107 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 119 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 108 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 120 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.60 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 11 ? ASP A 12 ? GLU A 23 ASP A 24 AA1 2 VAL A 21 ? ARG A 27 ? VAL A 33 ARG A 39 AA1 3 ILE A 90 ? CYS A 95 ? ILE A 102 CYS A 107 AA1 4 LEU A 116 ? LYS A 126 ? LEU A 128 LYS A 138 AA1 5 LYS A 40 ? LEU A 49 ? LYS A 52 LEU A 61 AA1 6 ASP A 56 ? SER A 57 ? ASP A 68 SER A 69 AA2 1 GLU A 11 ? ASP A 12 ? GLU A 23 ASP A 24 AA2 2 VAL A 21 ? ARG A 27 ? VAL A 33 ARG A 39 AA2 3 ILE A 90 ? CYS A 95 ? ILE A 102 CYS A 107 AA2 4 LEU A 116 ? LYS A 126 ? LEU A 128 LYS A 138 AA2 5 LYS A 40 ? LEU A 49 ? LYS A 52 LEU A 61 AA2 6 PHE A 65 ? SER A 68 ? PHE A 77 SER A 80 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 11 ? N GLU A 23 O LYS A 23 ? O LYS A 35 AA1 2 3 N ILE A 24 ? N ILE A 36 O HIS A 92 ? O HIS A 104 AA1 3 4 N CYS A 95 ? N CYS A 107 O LEU A 116 ? O LEU A 128 AA1 4 5 O GLU A 119 ? O GLU A 131 N LYS A 46 ? N LYS A 58 AA1 5 6 N GLY A 47 ? N GLY A 59 O ASP A 56 ? O ASP A 68 AA2 1 2 N GLU A 11 ? N GLU A 23 O LYS A 23 ? O LYS A 35 AA2 2 3 N ILE A 24 ? N ILE A 36 O HIS A 92 ? O HIS A 104 AA2 3 4 N CYS A 95 ? N CYS A 107 O LEU A 116 ? O LEU A 128 AA2 4 5 O GLU A 119 ? O GLU A 131 N LYS A 46 ? N LYS A 58 AA2 5 6 N VAL A 41 ? N VAL A 53 O PHE A 67 ? O PHE A 79 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 5B8 _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 17 _struct_site.details 'binding site for residue 5B8 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 17 GLU A 8 ? GLU A 20 . ? 2_454 ? 2 AC1 17 GLN A 9 ? GLN A 21 . ? 2_454 ? 3 AC1 17 TYR A 45 ? TYR A 57 . ? 1_555 ? 4 AC1 17 GLY A 47 ? GLY A 59 . ? 1_555 ? 5 AC1 17 LYS A 48 ? LYS A 60 . ? 1_555 ? 6 AC1 17 VAL A 66 ? VAL A 78 . ? 1_555 ? 7 AC1 17 PHE A 67 ? PHE A 79 . ? 1_555 ? 8 AC1 17 GLY A 72 ? GLY A 84 . ? 1_555 ? 9 AC1 17 GLN A 73 ? GLN A 85 . ? 1_555 ? 10 AC1 17 VAL A 74 ? VAL A 86 . ? 1_555 ? 11 AC1 17 ILE A 75 ? ILE A 87 . ? 1_555 ? 12 AC1 17 TRP A 78 ? TRP A 90 . ? 1_555 ? 13 AC1 17 ALA A 100 ? ALA A 112 . ? 1_555 ? 14 AC1 17 TYR A 101 ? TYR A 113 . ? 1_555 ? 15 AC1 17 LYS A 109 ? LYS A 121 . ? 1_555 ? 16 AC1 17 ILE A 110 ? ILE A 122 . ? 1_555 ? 17 AC1 17 PHE A 118 ? PHE A 130 . ? 1_555 ? # _atom_sites.entry_id 5DIT _atom_sites.fract_transf_matrix[1][1] 0.023057 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019912 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016178 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 13 13 GLY GLY A . n A 1 2 ALA 2 14 14 ALA ALA A . n A 1 3 PRO 3 15 15 PRO PRO A . n A 1 4 ALA 4 16 16 ALA ALA A . n A 1 5 THR 5 17 17 THR THR A . n A 1 6 VAL 6 18 18 VAL VAL A . n A 1 7 THR 7 19 19 THR THR A . n A 1 8 GLU 8 20 20 GLU GLU A . n A 1 9 GLN 9 21 21 GLN GLN A . n A 1 10 GLY 10 22 22 GLY GLY A . n A 1 11 GLU 11 23 23 GLU GLU A . n A 1 12 ASP 12 24 24 ASP ASP A . n A 1 13 ILE 13 25 25 ILE ILE A . n A 1 14 THR 14 26 26 THR THR A . n A 1 15 SER 15 27 27 SER SER A . n A 1 16 LYS 16 28 28 LYS LYS A . n A 1 17 LYS 17 29 29 LYS LYS A . n A 1 18 ASP 18 30 30 ASP ASP A . n A 1 19 ARG 19 31 31 ARG ARG A . n A 1 20 GLY 20 32 32 GLY GLY A . n A 1 21 VAL 21 33 33 VAL VAL A . n A 1 22 LEU 22 34 34 LEU LEU A . n A 1 23 LYS 23 35 35 LYS LYS A . n A 1 24 ILE 24 36 36 ILE ILE A . n A 1 25 VAL 25 37 37 VAL VAL A . n A 1 26 LYS 26 38 38 LYS LYS A . n A 1 27 ARG 27 39 39 ARG ARG A . n A 1 28 VAL 28 40 40 VAL VAL A . n A 1 29 GLY 29 41 41 GLY GLY A . n A 1 30 ASN 30 42 42 ASN ASN A . n A 1 31 GLY 31 43 43 GLY GLY A . n A 1 32 GLU 32 44 44 GLU GLU A . n A 1 33 GLU 33 45 45 GLU GLU A . n A 1 34 THR 34 46 46 THR THR A . n A 1 35 PRO 35 47 47 PRO PRO A . n A 1 36 MET 36 48 48 MET MET A . n A 1 37 ILE 37 49 49 ILE ILE A . n A 1 38 GLY 38 50 50 GLY GLY A . n A 1 39 ASP 39 51 51 ASP ASP A . n A 1 40 LYS 40 52 52 LYS LYS A . n A 1 41 VAL 41 53 53 VAL VAL A . n A 1 42 TYR 42 54 54 TYR TYR A . n A 1 43 VAL 43 55 55 VAL VAL A . n A 1 44 HIS 44 56 56 HIS HIS A . n A 1 45 TYR 45 57 57 TYR TYR A . n A 1 46 LYS 46 58 58 LYS LYS A . n A 1 47 GLY 47 59 59 GLY GLY A . n A 1 48 LYS 48 60 60 LYS LYS A . n A 1 49 LEU 49 61 61 LEU LEU A . n A 1 50 SER 50 62 62 SER SER A . n A 1 51 ASN 51 63 63 ASN ASN A . n A 1 52 GLY 52 64 64 GLY GLY A . n A 1 53 LYS 53 65 65 LYS LYS A . n A 1 54 LYS 54 66 66 LYS LYS A . n A 1 55 PHE 55 67 67 PHE PHE A . n A 1 56 ASP 56 68 68 ASP ASP A . n A 1 57 SER 57 69 69 SER SER A . n A 1 58 SER 58 70 70 SER SER A . n A 1 59 HIS 59 71 71 HIS HIS A . n A 1 60 ASP 60 72 72 ASP ASP A . n A 1 61 ARG 61 73 73 ARG ARG A . n A 1 62 ASN 62 74 74 ASN ASN A . n A 1 63 GLU 63 75 75 GLU GLU A . n A 1 64 PRO 64 76 76 PRO PRO A . n A 1 65 PHE 65 77 77 PHE PHE A . n A 1 66 VAL 66 78 78 VAL VAL A . n A 1 67 PHE 67 79 79 PHE PHE A . n A 1 68 SER 68 80 80 SER SER A . n A 1 69 LEU 69 81 81 LEU LEU A . n A 1 70 GLY 70 82 82 GLY GLY A . n A 1 71 LYS 71 83 83 LYS LYS A . n A 1 72 GLY 72 84 84 GLY GLY A . n A 1 73 GLN 73 85 85 GLN GLN A . n A 1 74 VAL 74 86 86 VAL VAL A . n A 1 75 ILE 75 87 87 ILE ILE A . n A 1 76 LYS 76 88 88 LYS LYS A . n A 1 77 ALA 77 89 89 ALA ALA A . n A 1 78 TRP 78 90 90 TRP TRP A . n A 1 79 ASP 79 91 91 ASP ASP A . n A 1 80 ILE 80 92 92 ILE ILE A . n A 1 81 GLY 81 93 93 GLY GLY A . n A 1 82 VAL 82 94 94 VAL VAL A . n A 1 83 ALA 83 95 95 ALA ALA A . n A 1 84 THR 84 96 96 THR THR A . n A 1 85 MET 85 97 97 MET MET A . n A 1 86 LYS 86 98 98 LYS LYS A . n A 1 87 LYS 87 99 99 LYS LYS A . n A 1 88 GLY 88 100 100 GLY GLY A . n A 1 89 GLU 89 101 101 GLU GLU A . n A 1 90 ILE 90 102 102 ILE ILE A . n A 1 91 CYS 91 103 103 CYS CYS A . n A 1 92 HIS 92 104 104 HIS HIS A . n A 1 93 LEU 93 105 105 LEU LEU A . n A 1 94 LEU 94 106 106 LEU LEU A . n A 1 95 CYS 95 107 107 CYS CYS A . n A 1 96 LYS 96 108 108 LYS LYS A . n A 1 97 PRO 97 109 109 PRO PRO A . n A 1 98 GLU 98 110 110 GLU GLU A . n A 1 99 TYR 99 111 111 TYR TYR A . n A 1 100 ALA 100 112 112 ALA ALA A . n A 1 101 TYR 101 113 113 TYR TYR A . n A 1 102 GLY 102 114 114 GLY GLY A . n A 1 103 SER 103 115 115 SER SER A . n A 1 104 ALA 104 116 116 ALA ALA A . n A 1 105 GLY 105 117 117 GLY GLY A . n A 1 106 SER 106 118 118 SER SER A . n A 1 107 LEU 107 119 119 LEU LEU A . n A 1 108 PRO 108 120 120 PRO PRO A . n A 1 109 LYS 109 121 121 LYS LYS A . n A 1 110 ILE 110 122 122 ILE ILE A . n A 1 111 PRO 111 123 123 PRO PRO A . n A 1 112 SER 112 124 124 SER SER A . n A 1 113 ASN 113 125 125 ASN ASN A . n A 1 114 ALA 114 126 126 ALA ALA A . n A 1 115 THR 115 127 127 THR THR A . n A 1 116 LEU 116 128 128 LEU LEU A . n A 1 117 PHE 117 129 129 PHE PHE A . n A 1 118 PHE 118 130 130 PHE PHE A . n A 1 119 GLU 119 131 131 GLU GLU A . n A 1 120 ILE 120 132 132 ILE ILE A . n A 1 121 GLU 121 133 133 GLU GLU A . n A 1 122 LEU 122 134 134 LEU LEU A . n A 1 123 LEU 123 135 135 LEU LEU A . n A 1 124 ASP 124 136 136 ASP ASP A . n A 1 125 PHE 125 137 137 PHE PHE A . n A 1 126 LYS 126 138 138 LYS LYS A . n A 1 127 GLY 127 139 139 GLY GLY A . n A 1 128 GLU 128 140 140 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 5B8 1 201 1 5B8 DRG A . C 3 HOH 1 301 14 HOH HOH A . C 3 HOH 2 302 9 HOH HOH A . C 3 HOH 3 303 1 HOH HOH A . C 3 HOH 4 304 29 HOH HOH A . C 3 HOH 5 305 20 HOH HOH A . C 3 HOH 6 306 33 HOH HOH A . C 3 HOH 7 307 5 HOH HOH A . C 3 HOH 8 308 23 HOH HOH A . C 3 HOH 9 309 35 HOH HOH A . C 3 HOH 10 310 52 HOH HOH A . C 3 HOH 11 311 7 HOH HOH A . C 3 HOH 12 312 17 HOH HOH A . C 3 HOH 13 313 4 HOH HOH A . C 3 HOH 14 314 2 HOH HOH A . C 3 HOH 15 315 55 HOH HOH A . C 3 HOH 16 316 39 HOH HOH A . C 3 HOH 17 317 37 HOH HOH A . C 3 HOH 18 318 15 HOH HOH A . C 3 HOH 19 319 21 HOH HOH A . C 3 HOH 20 320 11 HOH HOH A . C 3 HOH 21 321 24 HOH HOH A . C 3 HOH 22 322 50 HOH HOH A . C 3 HOH 23 323 6 HOH HOH A . C 3 HOH 24 324 31 HOH HOH A . C 3 HOH 25 325 44 HOH HOH A . C 3 HOH 26 326 54 HOH HOH A . C 3 HOH 27 327 25 HOH HOH A . C 3 HOH 28 328 16 HOH HOH A . C 3 HOH 29 329 19 HOH HOH A . C 3 HOH 30 330 46 HOH HOH A . C 3 HOH 31 331 13 HOH HOH A . C 3 HOH 32 332 30 HOH HOH A . C 3 HOH 33 333 48 HOH HOH A . C 3 HOH 34 334 38 HOH HOH A . C 3 HOH 35 335 49 HOH HOH A . C 3 HOH 36 336 28 HOH HOH A . C 3 HOH 37 337 3 HOH HOH A . C 3 HOH 38 338 27 HOH HOH A . C 3 HOH 39 339 36 HOH HOH A . C 3 HOH 40 340 18 HOH HOH A . C 3 HOH 41 341 8 HOH HOH A . C 3 HOH 42 342 45 HOH HOH A . C 3 HOH 43 343 40 HOH HOH A . C 3 HOH 44 344 34 HOH HOH A . C 3 HOH 45 345 42 HOH HOH A . C 3 HOH 46 346 51 HOH HOH A . C 3 HOH 47 347 47 HOH HOH A . C 3 HOH 48 348 26 HOH HOH A . C 3 HOH 49 349 32 HOH HOH A . C 3 HOH 50 350 41 HOH HOH A . C 3 HOH 51 351 53 HOH HOH A . C 3 HOH 52 352 22 HOH HOH A . C 3 HOH 53 353 10 HOH HOH A . C 3 HOH 54 354 12 HOH HOH A . C 3 HOH 55 355 43 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6910 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-10-14 2 'Structure model' 1 1 2015-10-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.1.27 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0029 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'January 10, 2014' 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OG1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 THR _pdbx_validate_symm_contact.auth_seq_id_1 17 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OXT _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 140 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_544 _pdbx_validate_symm_contact.dist 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 72 ? ? -69.80 1.55 2 1 ASN A 74 ? ? 39.33 52.44 3 1 ALA A 112 ? ? -139.55 -107.75 4 1 SER A 118 ? ? -153.73 82.43 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(1R)-3-(3,4-dimethoxyphenyl)-1-{3-[2-(morpholin-4-yl)ethoxy]phenyl}propyl (2S)-1-[(2S,3R)-2-cyclohexyl-3-hydroxybutanoyl]piperidine-2-carboxylate ; 5B8 3 water HOH #