data_5DKO # _entry.id 5DKO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5DKO pdb_00005dko 10.2210/pdb5dko/pdb WWPDB D_1000213345 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DKO _pdbx_database_status.recvd_initial_deposition_date 2015-09-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wroblewski, C.' 1 'Kimber, M.S.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Bacteriol. _citation.journal_id_ASTM JOBAAY _citation.journal_id_CSD 0767 _citation.journal_id_ISSN 1098-5530 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 198 _citation.language ? _citation.page_first 1683 _citation.page_last 1693 _citation.title 'Structure and Mutational Analyses of Escherichia coli ZapD Reveal Charged Residues Involved in FtsZ Filament Bundling.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/JB.00969-15 _citation.pdbx_database_id_PubMed 27021560 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Roach, E.J.' 1 ? primary 'Wroblewski, C.' 2 ? primary 'Seidel, L.' 3 ? primary 'Berezuk, A.M.' 4 ? primary 'Brewer, D.' 5 ? primary 'Kimber, M.S.' 6 ? primary 'Khursigara, C.M.' 7 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5DKO _cell.details ? _cell.formula_units_Z ? _cell.length_a 108.900 _cell.length_a_esd ? _cell.length_b 108.900 _cell.length_b_esd ? _cell.length_c 106.970 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DKO _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cell division protein ZapD' 30001.416 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Z ring-associated protein D' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSIEGRSMQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFRNVSELLDVFERGEVRTELLKE LDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLISAPRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLP QAQRDSQVETWIASLNPLTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRFAIRF MPLDTENGQVPERLDFELACC ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSIEGRSMQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFRNVSELLDVFERGEVRTELLKE LDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLISAPRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLP QAQRDSQVETWIASLNPLTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRFAIRF MPLDTENGQVPERLDFELACC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 ILE n 1 11 GLU n 1 12 GLY n 1 13 ARG n 1 14 SER n 1 15 MET n 1 16 GLN n 1 17 THR n 1 18 GLN n 1 19 VAL n 1 20 LEU n 1 21 PHE n 1 22 GLU n 1 23 HIS n 1 24 PRO n 1 25 LEU n 1 26 ASN n 1 27 GLU n 1 28 LYS n 1 29 MET n 1 30 ARG n 1 31 THR n 1 32 TRP n 1 33 LEU n 1 34 ARG n 1 35 ILE n 1 36 GLU n 1 37 PHE n 1 38 LEU n 1 39 ILE n 1 40 GLN n 1 41 GLN n 1 42 LEU n 1 43 THR n 1 44 VAL n 1 45 ASN n 1 46 LEU n 1 47 PRO n 1 48 ILE n 1 49 VAL n 1 50 ASP n 1 51 HIS n 1 52 ALA n 1 53 GLY n 1 54 ALA n 1 55 LEU n 1 56 HIS n 1 57 PHE n 1 58 PHE n 1 59 ARG n 1 60 ASN n 1 61 VAL n 1 62 SER n 1 63 GLU n 1 64 LEU n 1 65 LEU n 1 66 ASP n 1 67 VAL n 1 68 PHE n 1 69 GLU n 1 70 ARG n 1 71 GLY n 1 72 GLU n 1 73 VAL n 1 74 ARG n 1 75 THR n 1 76 GLU n 1 77 LEU n 1 78 LEU n 1 79 LYS n 1 80 GLU n 1 81 LEU n 1 82 ASP n 1 83 ARG n 1 84 GLN n 1 85 GLN n 1 86 ARG n 1 87 LYS n 1 88 LEU n 1 89 GLN n 1 90 THR n 1 91 TRP n 1 92 ILE n 1 93 GLY n 1 94 VAL n 1 95 PRO n 1 96 GLY n 1 97 VAL n 1 98 ASP n 1 99 GLN n 1 100 SER n 1 101 ARG n 1 102 ILE n 1 103 GLU n 1 104 ALA n 1 105 LEU n 1 106 ILE n 1 107 GLN n 1 108 GLN n 1 109 LEU n 1 110 LYS n 1 111 ALA n 1 112 ALA n 1 113 GLY n 1 114 SER n 1 115 VAL n 1 116 LEU n 1 117 ILE n 1 118 SER n 1 119 ALA n 1 120 PRO n 1 121 ARG n 1 122 ILE n 1 123 GLY n 1 124 GLN n 1 125 PHE n 1 126 LEU n 1 127 ARG n 1 128 GLU n 1 129 ASP n 1 130 ARG n 1 131 LEU n 1 132 ILE n 1 133 ALA n 1 134 LEU n 1 135 VAL n 1 136 ARG n 1 137 GLN n 1 138 ARG n 1 139 LEU n 1 140 SER n 1 141 ILE n 1 142 PRO n 1 143 GLY n 1 144 GLY n 1 145 CYS n 1 146 CYS n 1 147 SER n 1 148 PHE n 1 149 ASP n 1 150 LEU n 1 151 PRO n 1 152 THR n 1 153 LEU n 1 154 HIS n 1 155 ILE n 1 156 TRP n 1 157 LEU n 1 158 HIS n 1 159 LEU n 1 160 PRO n 1 161 GLN n 1 162 ALA n 1 163 GLN n 1 164 ARG n 1 165 ASP n 1 166 SER n 1 167 GLN n 1 168 VAL n 1 169 GLU n 1 170 THR n 1 171 TRP n 1 172 ILE n 1 173 ALA n 1 174 SER n 1 175 LEU n 1 176 ASN n 1 177 PRO n 1 178 LEU n 1 179 THR n 1 180 GLN n 1 181 ALA n 1 182 LEU n 1 183 THR n 1 184 MET n 1 185 VAL n 1 186 LEU n 1 187 ASP n 1 188 LEU n 1 189 ILE n 1 190 ARG n 1 191 GLN n 1 192 SER n 1 193 ALA n 1 194 PRO n 1 195 PHE n 1 196 ARG n 1 197 LYS n 1 198 GLN n 1 199 THR n 1 200 SER n 1 201 LEU n 1 202 ASN n 1 203 GLY n 1 204 PHE n 1 205 TYR n 1 206 GLN n 1 207 ASP n 1 208 ASN n 1 209 GLY n 1 210 GLY n 1 211 ASP n 1 212 ALA n 1 213 ASP n 1 214 LEU n 1 215 LEU n 1 216 ARG n 1 217 LEU n 1 218 ASN n 1 219 LEU n 1 220 SER n 1 221 LEU n 1 222 ASP n 1 223 SER n 1 224 GLN n 1 225 LEU n 1 226 TYR n 1 227 PRO n 1 228 GLN n 1 229 ILE n 1 230 SER n 1 231 GLY n 1 232 HIS n 1 233 LYS n 1 234 SER n 1 235 ARG n 1 236 PHE n 1 237 ALA n 1 238 ILE n 1 239 ARG n 1 240 PHE n 1 241 MET n 1 242 PRO n 1 243 LEU n 1 244 ASP n 1 245 THR n 1 246 GLU n 1 247 ASN n 1 248 GLY n 1 249 GLN n 1 250 VAL n 1 251 PRO n 1 252 GLU n 1 253 ARG n 1 254 LEU n 1 255 ASP n 1 256 PHE n 1 257 GLU n 1 258 LEU n 1 259 ALA n 1 260 CYS n 1 261 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 261 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'zapD, yacF, b0102, JW0099' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain '(DE3) pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBAD24 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZAPD_ECOLI _struct_ref.pdbx_db_accession P36680 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFRNVSELLDVFERGEVRTELLKELDRQQRKLQTWIGV PGVDQSRIEALIQQLKAAGSVLISAPRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDSQVETWIAS LNPLTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRFAIRFMPLDTENGQVPERL DFELACC ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5DKO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 15 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 261 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P36680 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 247 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 247 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5DKO MET A 1 ? UNP P36680 ? ? 'expression tag' -13 1 1 5DKO HIS A 2 ? UNP P36680 ? ? 'expression tag' -12 2 1 5DKO HIS A 3 ? UNP P36680 ? ? 'expression tag' -11 3 1 5DKO HIS A 4 ? UNP P36680 ? ? 'expression tag' -10 4 1 5DKO HIS A 5 ? UNP P36680 ? ? 'expression tag' -9 5 1 5DKO HIS A 6 ? UNP P36680 ? ? 'expression tag' -8 6 1 5DKO HIS A 7 ? UNP P36680 ? ? 'expression tag' -7 7 1 5DKO SER A 8 ? UNP P36680 ? ? 'expression tag' -6 8 1 5DKO SER A 9 ? UNP P36680 ? ? 'expression tag' -5 9 1 5DKO ILE A 10 ? UNP P36680 ? ? 'expression tag' -4 10 1 5DKO GLU A 11 ? UNP P36680 ? ? 'expression tag' -3 11 1 5DKO GLY A 12 ? UNP P36680 ? ? 'expression tag' -2 12 1 5DKO ARG A 13 ? UNP P36680 ? ? 'expression tag' -1 13 1 5DKO SER A 14 ? UNP P36680 ? ? 'expression tag' 0 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DKO _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.05 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.69 _exptl_crystal.description 'hexagonal prisms' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '15 mg/ml ZapD with 1.2 M ammonium sulfate, 100 mM HEPES, pH 7.5, 10 % PEG 600' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-12-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Accel/Bruker double crystal monochromator' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97888 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97888 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 08ID-1 _diffrn_source.pdbx_synchrotron_site CLSI # _reflns.B_iso_Wilson_estimate 54.8 _reflns.entry_id 5DKO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 26464 _reflns.number_obs 26464 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.078 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.46 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 96.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.76 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 43.69 _refine.aniso_B[1][2] 0 _refine.aniso_B[1][3] 0 _refine.aniso_B[2][2] 43.69 _refine.aniso_B[2][3] 0 _refine.aniso_B[3][3] 100.27 _refine.B_iso_max ? _refine.B_iso_mean 74.3 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DKO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.400 _refine.ls_d_res_low 48.525 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 26453 _refine.ls_number_reflns_R_free 2628 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.22 _refine.ls_percent_reflns_R_free 9.93 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2511 _refine.ls_R_factor_R_free 0.2881 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2468 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 2OEZ' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 38.62 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.33 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1976 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 2001 _refine_hist.d_res_high 2.400 _refine_hist.d_res_low 48.525 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2031 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.665 ? 2744 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.094 ? 763 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.025 ? 310 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 358 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.40 2.4438 . . 140 1264 96.00 . . . 0.4061 . 0.3514 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4438 2.4908 . . 135 1256 94.00 . . . 0.3718 . 0.3278 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4908 2.5416 . . 143 1262 96.00 . . . 0.4352 . 0.3451 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5416 2.5969 . . 137 1208 93.00 . . . 0.3745 . 0.3306 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5969 2.6573 . . 137 1246 94.00 . . . 0.4460 . 0.3591 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6573 2.7237 . . 134 1231 93.00 . . . 0.3928 . 0.3389 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7237 2.7974 . . 130 1197 92.00 . . . 0.4327 . 0.3683 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7974 2.8797 . . 132 1237 93.00 . . . 0.4203 . 0.3448 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8797 2.9726 . . 133 1215 93.00 . . . 0.3649 . 0.3412 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9726 3.0788 . . 135 1231 94.00 . . . 0.3864 . 0.3285 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0788 3.2021 . . 139 1259 94.00 . . . 0.2958 . 0.3374 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2021 3.3478 . . 135 1220 94.00 . . . 0.4119 . 0.3111 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3478 3.5242 . . 137 1240 95.00 . . . 0.3067 . 0.2678 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5242 3.7450 . . 137 1265 95.00 . . . 0.2866 . 0.2520 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7450 4.0340 . . 144 1262 96.00 . . . 0.2019 . 0.2276 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0340 4.4397 . . 144 1280 98.00 . . . 0.2703 . 0.2060 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4397 5.0815 . . 145 1307 99.00 . . . 0.2598 . 0.1765 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.0815 6.3999 . . 146 1326 100.00 . . . 0.2386 . 0.2196 . . . . . . . . . . 'X-RAY DIFFRACTION' 6.3999 48.5351 . . 145 1319 100.00 . . . 0.2047 . 0.1750 . . . . . . . . . . # _struct.entry_id 5DKO _struct.title 'The structure of Escherichia coli ZapD' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DKO _struct_keywords.text 'cell division, FtsZ ring, REPLICATION' _struct_keywords.pdbx_keywords REPLICATION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 26 ? THR A 43 ? ASN A 12 THR A 29 1 ? 18 HELX_P HELX_P2 AA2 ASP A 50 ? ARG A 70 ? ASP A 36 ARG A 56 1 ? 21 HELX_P HELX_P3 AA3 GLU A 72 ? TRP A 91 ? GLU A 58 TRP A 77 1 ? 20 HELX_P HELX_P4 AA4 ASP A 98 ? ALA A 119 ? ASP A 84 ALA A 105 1 ? 22 HELX_P HELX_P5 AA5 GLY A 123 ? ASP A 129 ? GLY A 109 ASP A 115 1 ? 7 HELX_P HELX_P6 AA6 ASP A 129 ? LEU A 139 ? ASP A 115 LEU A 125 1 ? 11 HELX_P HELX_P7 AA7 LEU A 150 ? LEU A 157 ? LEU A 136 LEU A 143 1 ? 8 HELX_P HELX_P8 AA8 PRO A 160 ? SER A 174 ? PRO A 146 SER A 160 1 ? 15 HELX_P HELX_P9 AA9 LEU A 175 ? ARG A 190 ? LEU A 161 ARG A 176 1 ? 16 HELX_P HELX_P10 AB1 SER A 220 ? SER A 223 ? SER A 206 SER A 209 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 46 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 32 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 47 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 33 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.76 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 20 ? PRO A 24 ? LEU A 6 PRO A 10 AA1 2 LEU A 214 ? ASN A 218 ? LEU A 200 ASN A 204 AA1 3 LEU A 254 ? CYS A 260 ? LEU A 240 CYS A 246 AA1 4 ARG A 196 ? SER A 200 ? ARG A 182 SER A 186 AA2 1 PHE A 204 ? ASN A 208 ? PHE A 190 ASN A 194 AA2 2 ARG A 235 ? PRO A 242 ? ARG A 221 PRO A 228 AA2 3 LEU A 225 ? HIS A 232 ? LEU A 211 HIS A 218 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 21 ? N PHE A 7 O LEU A 217 ? O LEU A 203 AA1 2 3 N ARG A 216 ? N ARG A 202 O ALA A 259 ? O ALA A 245 AA1 3 4 O PHE A 256 ? O PHE A 242 N GLN A 198 ? N GLN A 184 AA2 1 2 N TYR A 205 ? N TYR A 191 O ILE A 238 ? O ILE A 224 AA2 2 3 O ALA A 237 ? O ALA A 223 N SER A 230 ? N SER A 216 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 301 ? 2 'binding site for residue SO4 A 301' AC2 Software A SO4 302 ? 3 'binding site for residue SO4 A 302' AC3 Software A SO4 303 ? 4 'binding site for residue SO4 A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ARG A 127 ? ARG A 113 . ? 1_555 ? 2 AC1 2 ARG A 136 ? ARG A 122 . ? 1_555 ? 3 AC2 3 ARG A 34 ? ARG A 20 . ? 11_555 ? 4 AC2 3 ARG A 138 ? ARG A 124 . ? 1_555 ? 5 AC2 3 ILE A 141 ? ILE A 127 . ? 1_555 ? 6 AC3 4 ASN A 208 ? ASN A 194 . ? 4_545 ? 7 AC3 4 ASN A 208 ? ASN A 194 . ? 1_555 ? 8 AC3 4 ARG A 235 ? ARG A 221 . ? 1_555 ? 9 AC3 4 ARG A 235 ? ARG A 221 . ? 4_545 ? # _atom_sites.entry_id 5DKO _atom_sites.fract_transf_matrix[1][1] 0.009183 _atom_sites.fract_transf_matrix[1][2] 0.005302 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010603 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009348 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -13 ? ? ? A . n A 1 2 HIS 2 -12 ? ? ? A . n A 1 3 HIS 3 -11 ? ? ? A . n A 1 4 HIS 4 -10 ? ? ? A . n A 1 5 HIS 5 -9 ? ? ? A . n A 1 6 HIS 6 -8 ? ? ? A . n A 1 7 HIS 7 -7 ? ? ? A . n A 1 8 SER 8 -6 ? ? ? A . n A 1 9 SER 9 -5 ? ? ? A . n A 1 10 ILE 10 -4 ? ? ? A . n A 1 11 GLU 11 -3 ? ? ? A . n A 1 12 GLY 12 -2 ? ? ? A . n A 1 13 ARG 13 -1 ? ? ? A . n A 1 14 SER 14 0 ? ? ? A . n A 1 15 MET 15 1 ? ? ? A . n A 1 16 GLN 16 2 ? ? ? A . n A 1 17 THR 17 3 3 THR THR A . n A 1 18 GLN 18 4 4 GLN GLN A . n A 1 19 VAL 19 5 5 VAL VAL A . n A 1 20 LEU 20 6 6 LEU LEU A . n A 1 21 PHE 21 7 7 PHE PHE A . n A 1 22 GLU 22 8 8 GLU GLU A . n A 1 23 HIS 23 9 9 HIS HIS A . n A 1 24 PRO 24 10 10 PRO PRO A . n A 1 25 LEU 25 11 11 LEU LEU A . n A 1 26 ASN 26 12 12 ASN ASN A . n A 1 27 GLU 27 13 13 GLU GLU A . n A 1 28 LYS 28 14 14 LYS LYS A . n A 1 29 MET 29 15 15 MET MET A . n A 1 30 ARG 30 16 16 ARG ARG A . n A 1 31 THR 31 17 17 THR THR A . n A 1 32 TRP 32 18 18 TRP TRP A . n A 1 33 LEU 33 19 19 LEU LEU A . n A 1 34 ARG 34 20 20 ARG ARG A . n A 1 35 ILE 35 21 21 ILE ILE A . n A 1 36 GLU 36 22 22 GLU GLU A . n A 1 37 PHE 37 23 23 PHE PHE A . n A 1 38 LEU 38 24 24 LEU LEU A . n A 1 39 ILE 39 25 25 ILE ILE A . n A 1 40 GLN 40 26 26 GLN GLN A . n A 1 41 GLN 41 27 27 GLN GLN A . n A 1 42 LEU 42 28 28 LEU LEU A . n A 1 43 THR 43 29 29 THR THR A . n A 1 44 VAL 44 30 30 VAL VAL A . n A 1 45 ASN 45 31 31 ASN ASN A . n A 1 46 LEU 46 32 32 LEU LEU A . n A 1 47 PRO 47 33 33 PRO PRO A . n A 1 48 ILE 48 34 34 ILE ILE A . n A 1 49 VAL 49 35 35 VAL VAL A . n A 1 50 ASP 50 36 36 ASP ASP A . n A 1 51 HIS 51 37 37 HIS HIS A . n A 1 52 ALA 52 38 38 ALA ALA A . n A 1 53 GLY 53 39 39 GLY GLY A . n A 1 54 ALA 54 40 40 ALA ALA A . n A 1 55 LEU 55 41 41 LEU LEU A . n A 1 56 HIS 56 42 42 HIS HIS A . n A 1 57 PHE 57 43 43 PHE PHE A . n A 1 58 PHE 58 44 44 PHE PHE A . n A 1 59 ARG 59 45 45 ARG ARG A . n A 1 60 ASN 60 46 46 ASN ASN A . n A 1 61 VAL 61 47 47 VAL VAL A . n A 1 62 SER 62 48 48 SER SER A . n A 1 63 GLU 63 49 49 GLU GLU A . n A 1 64 LEU 64 50 50 LEU LEU A . n A 1 65 LEU 65 51 51 LEU LEU A . n A 1 66 ASP 66 52 52 ASP ASP A . n A 1 67 VAL 67 53 53 VAL VAL A . n A 1 68 PHE 68 54 54 PHE PHE A . n A 1 69 GLU 69 55 55 GLU GLU A . n A 1 70 ARG 70 56 56 ARG ARG A . n A 1 71 GLY 71 57 57 GLY GLY A . n A 1 72 GLU 72 58 58 GLU GLU A . n A 1 73 VAL 73 59 59 VAL VAL A . n A 1 74 ARG 74 60 60 ARG ARG A . n A 1 75 THR 75 61 61 THR THR A . n A 1 76 GLU 76 62 62 GLU GLU A . n A 1 77 LEU 77 63 63 LEU LEU A . n A 1 78 LEU 78 64 64 LEU LEU A . n A 1 79 LYS 79 65 65 LYS LYS A . n A 1 80 GLU 80 66 66 GLU GLU A . n A 1 81 LEU 81 67 67 LEU LEU A . n A 1 82 ASP 82 68 68 ASP ASP A . n A 1 83 ARG 83 69 69 ARG ARG A . n A 1 84 GLN 84 70 70 GLN GLN A . n A 1 85 GLN 85 71 71 GLN GLN A . n A 1 86 ARG 86 72 72 ARG ARG A . n A 1 87 LYS 87 73 73 LYS LYS A . n A 1 88 LEU 88 74 74 LEU LEU A . n A 1 89 GLN 89 75 75 GLN GLN A . n A 1 90 THR 90 76 76 THR THR A . n A 1 91 TRP 91 77 77 TRP TRP A . n A 1 92 ILE 92 78 78 ILE ILE A . n A 1 93 GLY 93 79 79 GLY GLY A . n A 1 94 VAL 94 80 80 VAL VAL A . n A 1 95 PRO 95 81 81 PRO PRO A . n A 1 96 GLY 96 82 82 GLY GLY A . n A 1 97 VAL 97 83 83 VAL VAL A . n A 1 98 ASP 98 84 84 ASP ASP A . n A 1 99 GLN 99 85 85 GLN GLN A . n A 1 100 SER 100 86 86 SER SER A . n A 1 101 ARG 101 87 87 ARG ARG A . n A 1 102 ILE 102 88 88 ILE ILE A . n A 1 103 GLU 103 89 89 GLU GLU A . n A 1 104 ALA 104 90 90 ALA ALA A . n A 1 105 LEU 105 91 91 LEU LEU A . n A 1 106 ILE 106 92 92 ILE ILE A . n A 1 107 GLN 107 93 93 GLN GLN A . n A 1 108 GLN 108 94 94 GLN GLN A . n A 1 109 LEU 109 95 95 LEU LEU A . n A 1 110 LYS 110 96 96 LYS LYS A . n A 1 111 ALA 111 97 97 ALA ALA A . n A 1 112 ALA 112 98 98 ALA ALA A . n A 1 113 GLY 113 99 99 GLY GLY A . n A 1 114 SER 114 100 100 SER SER A . n A 1 115 VAL 115 101 101 VAL VAL A . n A 1 116 LEU 116 102 102 LEU LEU A . n A 1 117 ILE 117 103 103 ILE ILE A . n A 1 118 SER 118 104 104 SER SER A . n A 1 119 ALA 119 105 105 ALA ALA A . n A 1 120 PRO 120 106 106 PRO PRO A . n A 1 121 ARG 121 107 107 ARG ARG A . n A 1 122 ILE 122 108 108 ILE ILE A . n A 1 123 GLY 123 109 109 GLY GLY A . n A 1 124 GLN 124 110 110 GLN GLN A . n A 1 125 PHE 125 111 111 PHE PHE A . n A 1 126 LEU 126 112 112 LEU LEU A . n A 1 127 ARG 127 113 113 ARG ARG A . n A 1 128 GLU 128 114 114 GLU GLU A . n A 1 129 ASP 129 115 115 ASP ASP A . n A 1 130 ARG 130 116 116 ARG ARG A . n A 1 131 LEU 131 117 117 LEU LEU A . n A 1 132 ILE 132 118 118 ILE ILE A . n A 1 133 ALA 133 119 119 ALA ALA A . n A 1 134 LEU 134 120 120 LEU LEU A . n A 1 135 VAL 135 121 121 VAL VAL A . n A 1 136 ARG 136 122 122 ARG ARG A . n A 1 137 GLN 137 123 123 GLN GLN A . n A 1 138 ARG 138 124 124 ARG ARG A . n A 1 139 LEU 139 125 125 LEU LEU A . n A 1 140 SER 140 126 126 SER SER A . n A 1 141 ILE 141 127 127 ILE ILE A . n A 1 142 PRO 142 128 128 PRO PRO A . n A 1 143 GLY 143 129 129 GLY GLY A . n A 1 144 GLY 144 130 130 GLY GLY A . n A 1 145 CYS 145 131 131 CYS CYS A . n A 1 146 CYS 146 132 132 CYS CYS A . n A 1 147 SER 147 133 133 SER SER A . n A 1 148 PHE 148 134 134 PHE PHE A . n A 1 149 ASP 149 135 135 ASP ASP A . n A 1 150 LEU 150 136 136 LEU LEU A . n A 1 151 PRO 151 137 137 PRO PRO A . n A 1 152 THR 152 138 138 THR THR A . n A 1 153 LEU 153 139 139 LEU LEU A . n A 1 154 HIS 154 140 140 HIS HIS A . n A 1 155 ILE 155 141 141 ILE ILE A . n A 1 156 TRP 156 142 142 TRP TRP A . n A 1 157 LEU 157 143 143 LEU LEU A . n A 1 158 HIS 158 144 144 HIS HIS A . n A 1 159 LEU 159 145 145 LEU LEU A . n A 1 160 PRO 160 146 146 PRO PRO A . n A 1 161 GLN 161 147 147 GLN GLN A . n A 1 162 ALA 162 148 148 ALA ALA A . n A 1 163 GLN 163 149 149 GLN GLN A . n A 1 164 ARG 164 150 150 ARG ARG A . n A 1 165 ASP 165 151 151 ASP ASP A . n A 1 166 SER 166 152 152 SER SER A . n A 1 167 GLN 167 153 153 GLN GLN A . n A 1 168 VAL 168 154 154 VAL VAL A . n A 1 169 GLU 169 155 155 GLU GLU A . n A 1 170 THR 170 156 156 THR THR A . n A 1 171 TRP 171 157 157 TRP TRP A . n A 1 172 ILE 172 158 158 ILE ILE A . n A 1 173 ALA 173 159 159 ALA ALA A . n A 1 174 SER 174 160 160 SER SER A . n A 1 175 LEU 175 161 161 LEU LEU A . n A 1 176 ASN 176 162 162 ASN ASN A . n A 1 177 PRO 177 163 163 PRO PRO A . n A 1 178 LEU 178 164 164 LEU LEU A . n A 1 179 THR 179 165 165 THR THR A . n A 1 180 GLN 180 166 166 GLN GLN A . n A 1 181 ALA 181 167 167 ALA ALA A . n A 1 182 LEU 182 168 168 LEU LEU A . n A 1 183 THR 183 169 169 THR THR A . n A 1 184 MET 184 170 170 MET MET A . n A 1 185 VAL 185 171 171 VAL VAL A . n A 1 186 LEU 186 172 172 LEU LEU A . n A 1 187 ASP 187 173 173 ASP ASP A . n A 1 188 LEU 188 174 174 LEU LEU A . n A 1 189 ILE 189 175 175 ILE ILE A . n A 1 190 ARG 190 176 176 ARG ARG A . n A 1 191 GLN 191 177 177 GLN GLN A . n A 1 192 SER 192 178 178 SER SER A . n A 1 193 ALA 193 179 179 ALA ALA A . n A 1 194 PRO 194 180 180 PRO PRO A . n A 1 195 PHE 195 181 181 PHE PHE A . n A 1 196 ARG 196 182 182 ARG ARG A . n A 1 197 LYS 197 183 183 LYS LYS A . n A 1 198 GLN 198 184 184 GLN GLN A . n A 1 199 THR 199 185 185 THR THR A . n A 1 200 SER 200 186 186 SER SER A . n A 1 201 LEU 201 187 187 LEU LEU A . n A 1 202 ASN 202 188 188 ASN ASN A . n A 1 203 GLY 203 189 189 GLY GLY A . n A 1 204 PHE 204 190 190 PHE PHE A . n A 1 205 TYR 205 191 191 TYR TYR A . n A 1 206 GLN 206 192 192 GLN GLN A . n A 1 207 ASP 207 193 193 ASP ASP A . n A 1 208 ASN 208 194 194 ASN ASN A . n A 1 209 GLY 209 195 195 GLY GLY A . n A 1 210 GLY 210 196 196 GLY GLY A . n A 1 211 ASP 211 197 197 ASP ASP A . n A 1 212 ALA 212 198 198 ALA ALA A . n A 1 213 ASP 213 199 199 ASP ASP A . n A 1 214 LEU 214 200 200 LEU LEU A . n A 1 215 LEU 215 201 201 LEU LEU A . n A 1 216 ARG 216 202 202 ARG ARG A . n A 1 217 LEU 217 203 203 LEU LEU A . n A 1 218 ASN 218 204 204 ASN ASN A . n A 1 219 LEU 219 205 205 LEU LEU A . n A 1 220 SER 220 206 206 SER SER A . n A 1 221 LEU 221 207 207 LEU LEU A . n A 1 222 ASP 222 208 208 ASP ASP A . n A 1 223 SER 223 209 209 SER SER A . n A 1 224 GLN 224 210 210 GLN GLN A . n A 1 225 LEU 225 211 211 LEU LEU A . n A 1 226 TYR 226 212 212 TYR TYR A . n A 1 227 PRO 227 213 213 PRO PRO A . n A 1 228 GLN 228 214 214 GLN GLN A . n A 1 229 ILE 229 215 215 ILE ILE A . n A 1 230 SER 230 216 216 SER SER A . n A 1 231 GLY 231 217 217 GLY GLY A . n A 1 232 HIS 232 218 218 HIS HIS A . n A 1 233 LYS 233 219 219 LYS LYS A . n A 1 234 SER 234 220 220 SER SER A . n A 1 235 ARG 235 221 221 ARG ARG A . n A 1 236 PHE 236 222 222 PHE PHE A . n A 1 237 ALA 237 223 223 ALA ALA A . n A 1 238 ILE 238 224 224 ILE ILE A . n A 1 239 ARG 239 225 225 ARG ARG A . n A 1 240 PHE 240 226 226 PHE PHE A . n A 1 241 MET 241 227 227 MET MET A . n A 1 242 PRO 242 228 228 PRO PRO A . n A 1 243 LEU 243 229 229 LEU LEU A . n A 1 244 ASP 244 230 230 ASP ASP A . n A 1 245 THR 245 231 231 THR THR A . n A 1 246 GLU 246 232 232 GLU GLU A . n A 1 247 ASN 247 233 233 ASN ASN A . n A 1 248 GLY 248 234 234 GLY GLY A . n A 1 249 GLN 249 235 235 GLN GLN A . n A 1 250 VAL 250 236 236 VAL VAL A . n A 1 251 PRO 251 237 237 PRO PRO A . n A 1 252 GLU 252 238 238 GLU GLU A . n A 1 253 ARG 253 239 239 ARG ARG A . n A 1 254 LEU 254 240 240 LEU LEU A . n A 1 255 ASP 255 241 241 ASP ASP A . n A 1 256 PHE 256 242 242 PHE PHE A . n A 1 257 GLU 257 243 243 GLU GLU A . n A 1 258 LEU 258 244 244 LEU LEU A . n A 1 259 ALA 259 245 245 ALA ALA A . n A 1 260 CYS 260 246 246 CYS CYS A . n A 1 261 CYS 261 247 247 CYS CYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 1 SO4 SO4 A . C 2 SO4 1 302 1 SO4 SO4 A . D 2 SO4 1 303 1 SO4 SO4 A . E 3 HOH 1 401 6 HOH HOH A . E 3 HOH 2 402 2 HOH HOH A . E 3 HOH 3 403 10 HOH HOH A . E 3 HOH 4 404 8 HOH HOH A . E 3 HOH 5 405 1 HOH HOH A . E 3 HOH 6 406 7 HOH HOH A . E 3 HOH 7 407 3 HOH HOH A . E 3 HOH 8 408 4 HOH HOH A . E 3 HOH 9 409 5 HOH HOH A . E 3 HOH 10 410 9 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4650 ? 1 MORE -80 ? 1 'SSA (A^2)' 24700 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_555 -x+y,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_point_symmetry.entry_id 5DKO _pdbx_point_symmetry.Schoenflies_symbol C _pdbx_point_symmetry.circular_symmetry 2 _pdbx_point_symmetry.H-M_notation ? # _pdbx_helical_symmetry.entry_id 5DKO _pdbx_helical_symmetry.number_of_operations . _pdbx_helical_symmetry.rotation_per_n_subunits . _pdbx_helical_symmetry.rise_per_n_subunits . _pdbx_helical_symmetry.n_subunits_divisor . _pdbx_helical_symmetry.dyad_axis . _pdbx_helical_symmetry.circular_symmetry 2 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id SO4 _pdbx_struct_special_symmetry.auth_seq_id 303 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id SO4 _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-04-13 2 'Structure model' 1 1 2016-06-01 3 'Structure model' 1 2 2017-09-06 4 'Structure model' 1 3 2020-01-08 5 'Structure model' 1 4 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 4 'Structure model' '_pdbx_audit_support.funding_organization' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 24.5361 -36.4522 16.5144 0.4248 0.7953 0.7696 -0.0124 0.0956 0.2314 2.5293 4.7569 2.5054 -0.7574 1.9612 1.4987 -0.0501 0.0785 0.0104 0.8504 0.6043 0.0014 -0.2432 -0.2416 0.4958 'X-RAY DIFFRACTION' 2 ? refined -4.3286 -34.7546 16.1257 0.4626 0.6653 0.7190 -0.0034 0.1782 -0.0641 0.4621 0.2445 2.9547 -0.0188 1.1033 -0.1443 -0.1198 -0.1442 0.2215 -0.0613 0.0706 0.0655 0.0710 0.1297 -0.2533 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 3 A 12 '( CHAIN A AND ( RESID 3:12 OR RESID 179:247 ) )' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 A 179 A 247 '( CHAIN A AND ( RESID 3:12 OR RESID 179:247 ) )' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 2 A 13 A 178 '( CHAIN A AND RESID 13:178 )' ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLY _pdbx_validate_close_contact.auth_seq_id_1 217 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 401 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.07 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 106 ? ? -68.11 -160.87 2 1 ASP A 197 ? ? -96.46 59.15 3 1 LEU A 205 ? ? -110.30 -122.04 4 1 LYS A 219 ? ? 54.04 -124.72 5 1 THR A 231 ? ? -68.94 3.71 6 1 GLU A 232 ? ? -140.75 -42.77 7 1 ASN A 233 ? ? -114.66 75.14 8 1 PRO A 237 ? ? -76.09 -157.73 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -13 ? A MET 1 2 1 Y 1 A HIS -12 ? A HIS 2 3 1 Y 1 A HIS -11 ? A HIS 3 4 1 Y 1 A HIS -10 ? A HIS 4 5 1 Y 1 A HIS -9 ? A HIS 5 6 1 Y 1 A HIS -8 ? A HIS 6 7 1 Y 1 A HIS -7 ? A HIS 7 8 1 Y 1 A SER -6 ? A SER 8 9 1 Y 1 A SER -5 ? A SER 9 10 1 Y 1 A ILE -4 ? A ILE 10 11 1 Y 1 A GLU -3 ? A GLU 11 12 1 Y 1 A GLY -2 ? A GLY 12 13 1 Y 1 A ARG -1 ? A ARG 13 14 1 Y 1 A SER 0 ? A SER 14 15 1 Y 1 A MET 1 ? A MET 15 16 1 Y 1 A GLN 2 ? A GLN 16 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_audit_support.funding_organization 'Natural Sciences and Engineering Research Council (NSERC, Canada)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2OEZ _pdbx_initial_refinement_model.details 'PDB entry 2OEZ' #