data_5DOL # _entry.id 5DOL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5DOL pdb_00005dol 10.2210/pdb5dol/pdb WWPDB D_1000213545 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-01-20 2 'Structure model' 1 1 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DOL _pdbx_database_status.recvd_initial_deposition_date 2015-09-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cherrier, M.V.' 1 'Bazin, A.' 2 'Jameson, K.H.' 3 'Wilkinson, A.J.' 4 'Noirot-Gros, M.F.' 5 'Terradot, L.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 44 _citation.language ? _citation.page_first 449 _citation.page_last 463 _citation.title ;Tetramerization and interdomain flexibility of the replication initiation controller YabA enables simultaneous binding to multiple partners. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkv1318 _citation.pdbx_database_id_PubMed 26615189 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Felicori, L.' 1 ? primary 'Jameson, K.H.' 2 ? primary 'Roblin, P.' 3 ? primary 'Fogg, M.J.' 4 ? primary 'Garcia-Garcia, T.' 5 ? primary 'Ventroux, M.' 6 ? primary 'Cherrier, M.V.' 7 ? primary 'Bazin, A.' 8 ? primary 'Noirot, P.' 9 ? primary 'Wilkinson, A.J.' 10 ? primary 'Molina, F.' 11 ? primary 'Terradot, L.' 12 ? primary 'Noirot-Gros, M.F.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Initiation-control protein YabA' 7501.492 2 ? ? 'UNP residues 1-62' 'Amino-terminal domain of the protein (residus 1-62)' 2 water nat water 18.015 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLENKHLRKRLDDTTQQIEKF _entity_poly.pdbx_seq_one_letter_code_can MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLENKHLRKRLDDTTQQIEKF _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LYS n 1 4 LYS n 1 5 GLU n 1 6 LEU n 1 7 PHE n 1 8 ASP n 1 9 THR n 1 10 VAL n 1 11 ILE n 1 12 ASN n 1 13 LEU n 1 14 GLU n 1 15 GLU n 1 16 GLN n 1 17 ILE n 1 18 GLY n 1 19 SER n 1 20 LEU n 1 21 TYR n 1 22 ARG n 1 23 GLN n 1 24 LEU n 1 25 GLY n 1 26 ASP n 1 27 LEU n 1 28 LYS n 1 29 GLN n 1 30 HIS n 1 31 ILE n 1 32 GLY n 1 33 GLU n 1 34 MET n 1 35 ILE n 1 36 GLU n 1 37 GLU n 1 38 ASN n 1 39 HIS n 1 40 HIS n 1 41 LEU n 1 42 GLN n 1 43 LEU n 1 44 GLU n 1 45 ASN n 1 46 LYS n 1 47 HIS n 1 48 LEU n 1 49 ARG n 1 50 LYS n 1 51 ARG n 1 52 LEU n 1 53 ASP n 1 54 ASP n 1 55 THR n 1 56 THR n 1 57 GLN n 1 58 GLN n 1 59 ILE n 1 60 GLU n 1 61 LYS n 1 62 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 62 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'yabA, BSU00330' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis (strain 168)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET151/D-TOPO _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 PHE 62 62 62 PHE PHE A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 ASP 2 2 2 ASP ASP B . n B 1 3 LYS 3 3 3 LYS LYS B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 PHE 7 7 7 PHE PHE B . n B 1 8 ASP 8 8 8 ASP ASP B . n B 1 9 THR 9 9 9 THR THR B . n B 1 10 VAL 10 10 10 VAL VAL B . n B 1 11 ILE 11 11 11 ILE ILE B . n B 1 12 ASN 12 12 12 ASN ASN B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 GLU 14 14 14 GLU GLU B . n B 1 15 GLU 15 15 15 GLU GLU B . n B 1 16 GLN 16 16 16 GLN GLN B . n B 1 17 ILE 17 17 17 ILE ILE B . n B 1 18 GLY 18 18 18 GLY GLY B . n B 1 19 SER 19 19 19 SER SER B . n B 1 20 LEU 20 20 20 LEU LEU B . n B 1 21 TYR 21 21 21 TYR TYR B . n B 1 22 ARG 22 22 22 ARG ARG B . n B 1 23 GLN 23 23 23 GLN GLN B . n B 1 24 LEU 24 24 24 LEU LEU B . n B 1 25 GLY 25 25 25 GLY GLY B . n B 1 26 ASP 26 26 26 ASP ASP B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 GLN 29 29 29 GLN GLN B . n B 1 30 HIS 30 30 30 HIS HIS B . n B 1 31 ILE 31 31 31 ILE ILE B . n B 1 32 GLY 32 32 32 GLY GLY B . n B 1 33 GLU 33 33 33 GLU GLU B . n B 1 34 MET 34 34 34 MET MET B . n B 1 35 ILE 35 35 35 ILE ILE B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 ASN 38 38 38 ASN ASN B . n B 1 39 HIS 39 39 39 HIS HIS B . n B 1 40 HIS 40 40 40 HIS HIS B . n B 1 41 LEU 41 41 41 LEU LEU B . n B 1 42 GLN 42 42 42 GLN GLN B . n B 1 43 LEU 43 43 43 LEU LEU B . n B 1 44 GLU 44 44 44 GLU GLU B . n B 1 45 ASN 45 45 45 ASN ASN B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 HIS 47 47 47 HIS HIS B . n B 1 48 LEU 48 48 48 LEU LEU B . n B 1 49 ARG 49 49 49 ARG ARG B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 ARG 51 51 51 ARG ARG B . n B 1 52 LEU 52 52 52 LEU LEU B . n B 1 53 ASP 53 53 53 ASP ASP B . n B 1 54 ASP 54 54 54 ASP ASP B . n B 1 55 THR 55 55 55 THR THR B . n B 1 56 THR 56 56 56 THR THR B . n B 1 57 GLN 57 57 57 GLN GLN B . n B 1 58 GLN 58 58 58 GLN GLN B . n B 1 59 ILE 59 59 59 ILE ILE B . n B 1 60 GLU 60 60 60 GLU GLU B . n B 1 61 LYS 61 61 61 LYS LYS B . n B 1 62 PHE 62 62 62 PHE PHE B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 101 7 HOH HOH A . D 2 HOH 1 101 3 HOH HOH B . D 2 HOH 2 102 6 HOH HOH B . D 2 HOH 3 103 1 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A LYS 3 ? CG ? A LYS 3 CG 2 1 Y 0 A LYS 3 ? CD ? A LYS 3 CD 3 1 Y 0 A LYS 3 ? CE ? A LYS 3 CE 4 1 Y 0 A LYS 3 ? NZ ? A LYS 3 NZ 5 1 Y 0 A GLU 5 ? CG ? A GLU 5 CG 6 1 Y 0 A GLU 5 ? CD ? A GLU 5 CD 7 1 Y 0 A GLU 5 ? OE1 ? A GLU 5 OE1 8 1 Y 0 A GLU 5 ? OE2 ? A GLU 5 OE2 9 1 Y 0 A LYS 28 ? NZ ? A LYS 28 NZ 10 1 Y 0 A GLU 36 ? CG ? A GLU 36 CG 11 1 Y 0 A GLU 36 ? CD ? A GLU 36 CD 12 1 Y 0 A GLU 36 ? OE1 ? A GLU 36 OE1 13 1 Y 0 A GLU 36 ? OE2 ? A GLU 36 OE2 14 1 Y 0 A GLU 37 ? CD ? A GLU 37 CD 15 1 Y 0 A GLU 37 ? OE1 ? A GLU 37 OE1 16 1 Y 0 A GLU 37 ? OE2 ? A GLU 37 OE2 17 1 Y 0 A LYS 46 ? CD ? A LYS 46 CD 18 1 Y 0 A LYS 46 ? CE ? A LYS 46 CE 19 1 Y 0 A LYS 46 ? NZ ? A LYS 46 NZ 20 1 Y 0 A GLN 57 ? CG ? A GLN 57 CG 21 1 Y 0 A GLN 57 ? CD ? A GLN 57 CD 22 1 Y 0 A GLN 57 ? OE1 ? A GLN 57 OE1 23 1 Y 0 A GLN 57 ? NE2 ? A GLN 57 NE2 24 1 Y 0 A GLU 60 ? CG ? A GLU 60 CG 25 1 Y 0 A GLU 60 ? CD ? A GLU 60 CD 26 1 Y 0 A GLU 60 ? OE1 ? A GLU 60 OE1 27 1 Y 0 A GLU 60 ? OE2 ? A GLU 60 OE2 28 1 Y 0 A LYS 61 ? CB ? A LYS 61 CB 29 1 Y 0 A LYS 61 ? CG ? A LYS 61 CG 30 1 Y 0 A LYS 61 ? CD ? A LYS 61 CD 31 1 Y 0 A LYS 61 ? CE ? A LYS 61 CE 32 1 Y 0 A LYS 61 ? NZ ? A LYS 61 NZ 33 1 Y 0 B MET 1 ? CB ? B MET 1 CB 34 1 Y 0 B MET 1 ? CG ? B MET 1 CG 35 1 Y 0 B MET 1 ? SD ? B MET 1 SD 36 1 Y 0 B MET 1 ? CE ? B MET 1 CE 37 1 Y 0 B ASP 2 ? CB ? B ASP 2 CB 38 1 Y 0 B ASP 2 ? CG ? B ASP 2 CG 39 1 Y 0 B ASP 2 ? OD1 ? B ASP 2 OD1 40 1 Y 0 B ASP 2 ? OD2 ? B ASP 2 OD2 41 1 Y 0 B LYS 4 ? CB ? B LYS 4 CB 42 1 Y 0 B LYS 4 ? CG ? B LYS 4 CG 43 1 Y 0 B LYS 4 ? CD ? B LYS 4 CD 44 1 Y 0 B LYS 4 ? CE ? B LYS 4 CE 45 1 Y 0 B LYS 4 ? NZ ? B LYS 4 NZ 46 1 Y 0 B ASP 8 ? OD1 ? B ASP 8 OD1 47 1 Y 0 B ASP 8 ? OD2 ? B ASP 8 OD2 48 1 Y 0 B GLU 15 ? CG ? B GLU 15 CG 49 1 Y 0 B GLU 15 ? CD ? B GLU 15 CD 50 1 Y 0 B GLU 15 ? OE1 ? B GLU 15 OE1 51 1 Y 0 B GLU 15 ? OE2 ? B GLU 15 OE2 52 1 Y 0 B ARG 22 ? CG ? B ARG 22 CG 53 1 Y 0 B ARG 22 ? CD ? B ARG 22 CD 54 1 Y 0 B ARG 22 ? NE ? B ARG 22 NE 55 1 Y 0 B LYS 46 ? CD ? B LYS 46 CD 56 1 Y 0 B LYS 46 ? CE ? B LYS 46 CE 57 1 Y 0 B LYS 46 ? NZ ? B LYS 46 NZ 58 1 Y 0 B ASP 53 ? CG ? B ASP 53 CG 59 1 Y 0 B ASP 53 ? OD1 ? B ASP 53 OD1 60 1 Y 0 B ASP 53 ? OD2 ? B ASP 53 OD2 61 1 Y 0 B ASP 54 ? CG ? B ASP 54 CG 62 1 Y 0 B ASP 54 ? OD1 ? B ASP 54 OD1 63 1 Y 0 B ASP 54 ? OD2 ? B ASP 54 OD2 64 1 Y 0 B GLN 57 ? CD ? B GLN 57 CD 65 1 Y 0 B GLN 57 ? OE1 ? B GLN 57 OE1 66 1 Y 0 B GLN 57 ? NE2 ? B GLN 57 NE2 67 1 Y 0 B GLU 60 ? CG ? B GLU 60 CG 68 1 Y 0 B GLU 60 ? CD ? B GLU 60 CD 69 1 Y 0 B GLU 60 ? OE1 ? B GLU 60 OE1 70 1 Y 0 B GLU 60 ? OE2 ? B GLU 60 OE2 71 1 Y 0 B LYS 61 ? CG ? B LYS 61 CG 72 1 Y 0 B LYS 61 ? CD ? B LYS 61 CD 73 1 Y 0 B LYS 61 ? CE ? B LYS 61 CE 74 1 Y 0 B LYS 61 ? NZ ? B LYS 61 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.6 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SOLVE ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5DOL _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.480 _cell.length_a_esd ? _cell.length_b 83.480 _cell.length_b_esd ? _cell.length_c 64.710 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DOL _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DOL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 71.65 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG 3350 (W/V), 100 mM Bis-Tris propane pH 6.5, 200 mM potassium thiocyanate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-12-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.93222 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.93222 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 90.050 _reflns.entry_id 5DOL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.700 _reflns.d_resolution_low 36.1 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7306 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 98.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs 0.999 _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.200 _reflns.pdbx_Rmerge_I_obs 0.073 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.072 _reflns.pdbx_netI_over_av_sigmaI 2.000 _reflns.pdbx_netI_over_sigmaI 17.980 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.991 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.079 _reflns.pdbx_Rpim_I_all 0.036 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 51889 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.700 2.800 ? 1.230 6834 5562 753 297 752 99.900 ? ? 0.537 ? 2.626 ? ? ? ? ? ? ? ? 23.000 1.450 ? ? 2.600 2.832 0.309 0 1 1 ? ? 2.800 2.900 ? 2.090 6358 4646 629 282 629 100.000 ? ? 0.686 ? 1.566 ? ? ? ? ? ? ? ? 22.500 0.940 ? ? 4.200 1.680 0.204 0 2 1 ? ? 2.900 3.000 ? 3.350 5676 4204 571 274 571 100.000 ? ? 0.801 ? 0.985 ? ? ? ? ? ? ? ? 20.700 0.686 ? ? 5.400 1.057 0.153 0 3 1 ? ? 3.000 3.100 ? 4.590 5548 3706 507 249 507 100.000 ? ? 0.885 ? 0.719 ? ? ? ? ? ? ? ? 22.300 0.380 ? ? 8.700 0.771 0.083 0 4 1 ? ? 3.100 3.200 ? 5.870 5217 3342 452 235 452 100.000 ? ? 0.904 ? 0.573 ? ? ? ? ? ? ? ? 22.200 0.427 ? ? 7.800 0.614 0.093 0 5 1 ? ? 3.200 3.300 ? 7.930 4442 2772 381 217 381 100.000 ? ? 0.938 ? 0.414 ? ? ? ? ? ? ? ? 20.500 0.372 ? ? 7.900 0.444 0.085 0 6 1 ? ? 3.300 4.000 ? 18.170 4210 12818 1765 199 1765 100.000 ? ? 0.996 ? 0.113 ? ? ? ? ? ? ? ? 21.200 0.180 ? ? 13.700 0.121 0.042 0 7 1 ? ? 4.000 6.000 ? 37.260 3378 11137 1623 167 1620 99.800 ? ? 0.999 ? 0.039 ? ? ? ? ? ? ? ? 20.200 0.101 ? ? 22.900 0.042 0.026 0 8 1 ? ? 6.000 10.000 ? 42.260 2666 3395 560 143 545 97.300 ? ? 1.000 ? 0.026 ? ? ? ? ? ? ? ? 18.600 0.050 ? ? 36.400 0.029 0.018 0 9 1 ? ? 10.000 41.516 ? 44.720 1428 307 176 94 84 47.700 ? ? 0.998 ? 0.025 ? ? ? ? ? ? ? ? 15.200 0.057 ? ? 42.500 0.029 0.018 0 10 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 249.420 _refine.B_iso_mean 125.3684 _refine.B_iso_min 42.620 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DOL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7000 _refine.ls_d_res_low 36.1 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7301 _refine.ls_number_reflns_R_free 728 _refine.ls_number_reflns_R_work 6573 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.4900 _refine.ls_percent_reflns_R_free 9.9700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2270 _refine.ls_R_factor_R_free 0.2701 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2223 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.9300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.7000 _refine_hist.d_res_low 36.1 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 1046 _refine_hist.pdbx_number_residues_total 123 _refine_hist.pdbx_B_iso_mean_solvent 92.81 _refine_hist.pdbx_number_atoms_protein 1042 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 1081 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.616 ? 1448 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.023 ? 156 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 191 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.831 ? 432 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7002 2.9085 . . 143 1301 100.0000 . . . 0.3911 . 0.3460 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9085 3.2011 . . 146 1325 100.0000 . . . 0.3472 . 0.2848 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2011 3.6639 . . 146 1311 100.0000 . . . 0.3313 . 0.2486 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6639 4.6146 . . 150 1341 100.0000 . . . 0.2488 . 0.1910 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.6146 36.1 . . 143 1295 93.0000 . . . 0.2414 . 0.2106 . . . . . . . . . . # _struct.entry_id 5DOL _struct.title 'Crystal structure of YabA amino-terminal domain from Bacillus subtilis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DOL _struct_keywords.text 'YabA, DnaA, DnaN, Zinc finger, initiation control, replication' _struct_keywords.pdbx_keywords REPLICATION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YABA_BACSU _struct_ref.pdbx_db_accession P37542 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLENKHLRKRLDDTTQQIEKF _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5DOL A 1 ? 62 ? P37542 1 ? 62 ? 1 62 2 1 5DOL B 1 ? 62 ? P37542 1 ? 62 ? 1 62 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9880 ? 1 MORE -88 ? 1 'SSA (A^2)' 15600 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_467 y-1,x+1,-z+2 -0.5000000000 0.8660254038 0.0000000000 -125.2200000000 0.8660254038 0.5000000000 0.0000000000 72.2958007079 0.0000000000 0.0000000000 -1.0000000000 129.4200000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? PHE A 62 ? ASP A 2 PHE A 62 1 ? 61 HELX_P HELX_P2 AA2 LYS B 3 ? GLU B 60 ? LYS B 3 GLU B 60 1 ? 58 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 49 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE2 _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 44 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_467 _pdbx_validate_symm_contact.dist 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id B _pdbx_validate_torsion.auth_seq_id 3 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -122.40 _pdbx_validate_torsion.psi -103.96 # _pdbx_point_symmetry.entry_id 5DOL _pdbx_point_symmetry.Schoenflies_symbol C _pdbx_point_symmetry.circular_symmetry 2 _pdbx_point_symmetry.H-M_notation ? # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 4.002 _diffrn_reflns.pdbx_d_res_low 71.908 _diffrn_reflns.pdbx_number_obs 2157 _diffrn_reflns.pdbx_Rmerge_I_obs ? _diffrn_reflns.pdbx_Rsym_value 0.141 _diffrn_reflns.pdbx_chi_squared ? _diffrn_reflns.pdbx_redundancy 21.20 _diffrn_reflns.pdbx_rejects ? _diffrn_reflns.pdbx_percent_possible_obs 99.90 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.number 45757 _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 12.65 41.52 ? ? 0.057 0.057 ? 15.20 ? 1 8.94 12.65 ? ? 0.050 0.050 ? 18.60 ? 1 7.30 8.94 ? ? 0.101 0.101 ? 20.20 ? 1 6.32 7.30 ? ? 0.180 0.180 ? 21.20 ? 1 5.66 6.32 ? ? 0.372 0.372 ? 20.50 ? 1 5.16 5.66 ? ? 0.427 0.427 ? 22.20 ? 1 4.78 5.16 ? ? 0.380 0.380 ? 22.30 ? 1 4.47 4.78 ? ? 0.686 0.686 ? 20.70 ? 1 4.22 4.47 ? ? 0.940 0.940 ? 22.50 ? 1 4.00 4.22 ? ? 1.450 1.450 ? 23.00 ? # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 2.2596 107.0581 70.1872 0.4798 ? 0.0500 ? 0.0421 ? 1.1559 ? 0.0457 ? 0.8870 ? 3.7408 ? -3.5748 ? 1.7242 ? 3.7235 ? -0.2875 ? 1.8384 ? 0.3047 ? -1.2845 ? -0.8663 ? -0.2095 ? 0.1948 ? 0.1333 ? 0.1370 ? 0.3364 ? -0.4237 ? 2 'X-RAY DIFFRACTION' ? refined -32.7307 129.3694 66.2272 0.7601 ? 0.0055 ? 0.1727 ? 0.8103 ? 0.0305 ? 0.8637 ? 5.5022 ? -6.6258 ? 2.9275 ? 6.2092 ? -2.0880 ? 3.5117 ? -0.5536 ? -1.4007 ? -0.0251 ? 0.3327 ? 0.7924 ? -0.1292 ? -0.6438 ? -0.5547 ? -0.3544 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 2 through 62 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? B 0 ? ? B 0 ? ;chain 'B' and (resid 1 through 62 ) ; # _pdbx_phasing_MR.entry_id 5DOL _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 4.120 _pdbx_phasing_MR.d_res_low_rotation 36.150 _pdbx_phasing_MR.d_res_high_translation 4.120 _pdbx_phasing_MR.d_res_low_translation 36.150 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # loop_ _phasing.method SAD MR # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 HOH O O N N 131 HOH H1 H N N 132 HOH H2 H N N 133 ILE N N N N 134 ILE CA C N S 135 ILE C C N N 136 ILE O O N N 137 ILE CB C N S 138 ILE CG1 C N N 139 ILE CG2 C N N 140 ILE CD1 C N N 141 ILE OXT O N N 142 ILE H H N N 143 ILE H2 H N N 144 ILE HA H N N 145 ILE HB H N N 146 ILE HG12 H N N 147 ILE HG13 H N N 148 ILE HG21 H N N 149 ILE HG22 H N N 150 ILE HG23 H N N 151 ILE HD11 H N N 152 ILE HD12 H N N 153 ILE HD13 H N N 154 ILE HXT H N N 155 LEU N N N N 156 LEU CA C N S 157 LEU C C N N 158 LEU O O N N 159 LEU CB C N N 160 LEU CG C N N 161 LEU CD1 C N N 162 LEU CD2 C N N 163 LEU OXT O N N 164 LEU H H N N 165 LEU H2 H N N 166 LEU HA H N N 167 LEU HB2 H N N 168 LEU HB3 H N N 169 LEU HG H N N 170 LEU HD11 H N N 171 LEU HD12 H N N 172 LEU HD13 H N N 173 LEU HD21 H N N 174 LEU HD22 H N N 175 LEU HD23 H N N 176 LEU HXT H N N 177 LYS N N N N 178 LYS CA C N S 179 LYS C C N N 180 LYS O O N N 181 LYS CB C N N 182 LYS CG C N N 183 LYS CD C N N 184 LYS CE C N N 185 LYS NZ N N N 186 LYS OXT O N N 187 LYS H H N N 188 LYS H2 H N N 189 LYS HA H N N 190 LYS HB2 H N N 191 LYS HB3 H N N 192 LYS HG2 H N N 193 LYS HG3 H N N 194 LYS HD2 H N N 195 LYS HD3 H N N 196 LYS HE2 H N N 197 LYS HE3 H N N 198 LYS HZ1 H N N 199 LYS HZ2 H N N 200 LYS HZ3 H N N 201 LYS HXT H N N 202 MET N N N N 203 MET CA C N S 204 MET C C N N 205 MET O O N N 206 MET CB C N N 207 MET CG C N N 208 MET SD S N N 209 MET CE C N N 210 MET OXT O N N 211 MET H H N N 212 MET H2 H N N 213 MET HA H N N 214 MET HB2 H N N 215 MET HB3 H N N 216 MET HG2 H N N 217 MET HG3 H N N 218 MET HE1 H N N 219 MET HE2 H N N 220 MET HE3 H N N 221 MET HXT H N N 222 PHE N N N N 223 PHE CA C N S 224 PHE C C N N 225 PHE O O N N 226 PHE CB C N N 227 PHE CG C Y N 228 PHE CD1 C Y N 229 PHE CD2 C Y N 230 PHE CE1 C Y N 231 PHE CE2 C Y N 232 PHE CZ C Y N 233 PHE OXT O N N 234 PHE H H N N 235 PHE H2 H N N 236 PHE HA H N N 237 PHE HB2 H N N 238 PHE HB3 H N N 239 PHE HD1 H N N 240 PHE HD2 H N N 241 PHE HE1 H N N 242 PHE HE2 H N N 243 PHE HZ H N N 244 PHE HXT H N N 245 SER N N N N 246 SER CA C N S 247 SER C C N N 248 SER O O N N 249 SER CB C N N 250 SER OG O N N 251 SER OXT O N N 252 SER H H N N 253 SER H2 H N N 254 SER HA H N N 255 SER HB2 H N N 256 SER HB3 H N N 257 SER HG H N N 258 SER HXT H N N 259 THR N N N N 260 THR CA C N S 261 THR C C N N 262 THR O O N N 263 THR CB C N R 264 THR OG1 O N N 265 THR CG2 C N N 266 THR OXT O N N 267 THR H H N N 268 THR H2 H N N 269 THR HA H N N 270 THR HB H N N 271 THR HG1 H N N 272 THR HG21 H N N 273 THR HG22 H N N 274 THR HG23 H N N 275 THR HXT H N N 276 TYR N N N N 277 TYR CA C N S 278 TYR C C N N 279 TYR O O N N 280 TYR CB C N N 281 TYR CG C Y N 282 TYR CD1 C Y N 283 TYR CD2 C Y N 284 TYR CE1 C Y N 285 TYR CE2 C Y N 286 TYR CZ C Y N 287 TYR OH O N N 288 TYR OXT O N N 289 TYR H H N N 290 TYR H2 H N N 291 TYR HA H N N 292 TYR HB2 H N N 293 TYR HB3 H N N 294 TYR HD1 H N N 295 TYR HD2 H N N 296 TYR HE1 H N N 297 TYR HE2 H N N 298 TYR HH H N N 299 TYR HXT H N N 300 VAL N N N N 301 VAL CA C N S 302 VAL C C N N 303 VAL O O N N 304 VAL CB C N N 305 VAL CG1 C N N 306 VAL CG2 C N N 307 VAL OXT O N N 308 VAL H H N N 309 VAL H2 H N N 310 VAL HA H N N 311 VAL HB H N N 312 VAL HG11 H N N 313 VAL HG12 H N N 314 VAL HG13 H N N 315 VAL HG21 H N N 316 VAL HG22 H N N 317 VAL HG23 H N N 318 VAL HXT H N N 319 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 GLN N CA sing N N 58 GLN N H sing N N 59 GLN N H2 sing N N 60 GLN CA C sing N N 61 GLN CA CB sing N N 62 GLN CA HA sing N N 63 GLN C O doub N N 64 GLN C OXT sing N N 65 GLN CB CG sing N N 66 GLN CB HB2 sing N N 67 GLN CB HB3 sing N N 68 GLN CG CD sing N N 69 GLN CG HG2 sing N N 70 GLN CG HG3 sing N N 71 GLN CD OE1 doub N N 72 GLN CD NE2 sing N N 73 GLN NE2 HE21 sing N N 74 GLN NE2 HE22 sing N N 75 GLN OXT HXT sing N N 76 GLU N CA sing N N 77 GLU N H sing N N 78 GLU N H2 sing N N 79 GLU CA C sing N N 80 GLU CA CB sing N N 81 GLU CA HA sing N N 82 GLU C O doub N N 83 GLU C OXT sing N N 84 GLU CB CG sing N N 85 GLU CB HB2 sing N N 86 GLU CB HB3 sing N N 87 GLU CG CD sing N N 88 GLU CG HG2 sing N N 89 GLU CG HG3 sing N N 90 GLU CD OE1 doub N N 91 GLU CD OE2 sing N N 92 GLU OE2 HE2 sing N N 93 GLU OXT HXT sing N N 94 GLY N CA sing N N 95 GLY N H sing N N 96 GLY N H2 sing N N 97 GLY CA C sing N N 98 GLY CA HA2 sing N N 99 GLY CA HA3 sing N N 100 GLY C O doub N N 101 GLY C OXT sing N N 102 GLY OXT HXT sing N N 103 HIS N CA sing N N 104 HIS N H sing N N 105 HIS N H2 sing N N 106 HIS CA C sing N N 107 HIS CA CB sing N N 108 HIS CA HA sing N N 109 HIS C O doub N N 110 HIS C OXT sing N N 111 HIS CB CG sing N N 112 HIS CB HB2 sing N N 113 HIS CB HB3 sing N N 114 HIS CG ND1 sing Y N 115 HIS CG CD2 doub Y N 116 HIS ND1 CE1 doub Y N 117 HIS ND1 HD1 sing N N 118 HIS CD2 NE2 sing Y N 119 HIS CD2 HD2 sing N N 120 HIS CE1 NE2 sing Y N 121 HIS CE1 HE1 sing N N 122 HIS NE2 HE2 sing N N 123 HIS OXT HXT sing N N 124 HOH O H1 sing N N 125 HOH O H2 sing N N 126 ILE N CA sing N N 127 ILE N H sing N N 128 ILE N H2 sing N N 129 ILE CA C sing N N 130 ILE CA CB sing N N 131 ILE CA HA sing N N 132 ILE C O doub N N 133 ILE C OXT sing N N 134 ILE CB CG1 sing N N 135 ILE CB CG2 sing N N 136 ILE CB HB sing N N 137 ILE CG1 CD1 sing N N 138 ILE CG1 HG12 sing N N 139 ILE CG1 HG13 sing N N 140 ILE CG2 HG21 sing N N 141 ILE CG2 HG22 sing N N 142 ILE CG2 HG23 sing N N 143 ILE CD1 HD11 sing N N 144 ILE CD1 HD12 sing N N 145 ILE CD1 HD13 sing N N 146 ILE OXT HXT sing N N 147 LEU N CA sing N N 148 LEU N H sing N N 149 LEU N H2 sing N N 150 LEU CA C sing N N 151 LEU CA CB sing N N 152 LEU CA HA sing N N 153 LEU C O doub N N 154 LEU C OXT sing N N 155 LEU CB CG sing N N 156 LEU CB HB2 sing N N 157 LEU CB HB3 sing N N 158 LEU CG CD1 sing N N 159 LEU CG CD2 sing N N 160 LEU CG HG sing N N 161 LEU CD1 HD11 sing N N 162 LEU CD1 HD12 sing N N 163 LEU CD1 HD13 sing N N 164 LEU CD2 HD21 sing N N 165 LEU CD2 HD22 sing N N 166 LEU CD2 HD23 sing N N 167 LEU OXT HXT sing N N 168 LYS N CA sing N N 169 LYS N H sing N N 170 LYS N H2 sing N N 171 LYS CA C sing N N 172 LYS CA CB sing N N 173 LYS CA HA sing N N 174 LYS C O doub N N 175 LYS C OXT sing N N 176 LYS CB CG sing N N 177 LYS CB HB2 sing N N 178 LYS CB HB3 sing N N 179 LYS CG CD sing N N 180 LYS CG HG2 sing N N 181 LYS CG HG3 sing N N 182 LYS CD CE sing N N 183 LYS CD HD2 sing N N 184 LYS CD HD3 sing N N 185 LYS CE NZ sing N N 186 LYS CE HE2 sing N N 187 LYS CE HE3 sing N N 188 LYS NZ HZ1 sing N N 189 LYS NZ HZ2 sing N N 190 LYS NZ HZ3 sing N N 191 LYS OXT HXT sing N N 192 MET N CA sing N N 193 MET N H sing N N 194 MET N H2 sing N N 195 MET CA C sing N N 196 MET CA CB sing N N 197 MET CA HA sing N N 198 MET C O doub N N 199 MET C OXT sing N N 200 MET CB CG sing N N 201 MET CB HB2 sing N N 202 MET CB HB3 sing N N 203 MET CG SD sing N N 204 MET CG HG2 sing N N 205 MET CG HG3 sing N N 206 MET SD CE sing N N 207 MET CE HE1 sing N N 208 MET CE HE2 sing N N 209 MET CE HE3 sing N N 210 MET OXT HXT sing N N 211 PHE N CA sing N N 212 PHE N H sing N N 213 PHE N H2 sing N N 214 PHE CA C sing N N 215 PHE CA CB sing N N 216 PHE CA HA sing N N 217 PHE C O doub N N 218 PHE C OXT sing N N 219 PHE CB CG sing N N 220 PHE CB HB2 sing N N 221 PHE CB HB3 sing N N 222 PHE CG CD1 doub Y N 223 PHE CG CD2 sing Y N 224 PHE CD1 CE1 sing Y N 225 PHE CD1 HD1 sing N N 226 PHE CD2 CE2 doub Y N 227 PHE CD2 HD2 sing N N 228 PHE CE1 CZ doub Y N 229 PHE CE1 HE1 sing N N 230 PHE CE2 CZ sing Y N 231 PHE CE2 HE2 sing N N 232 PHE CZ HZ sing N N 233 PHE OXT HXT sing N N 234 SER N CA sing N N 235 SER N H sing N N 236 SER N H2 sing N N 237 SER CA C sing N N 238 SER CA CB sing N N 239 SER CA HA sing N N 240 SER C O doub N N 241 SER C OXT sing N N 242 SER CB OG sing N N 243 SER CB HB2 sing N N 244 SER CB HB3 sing N N 245 SER OG HG sing N N 246 SER OXT HXT sing N N 247 THR N CA sing N N 248 THR N H sing N N 249 THR N H2 sing N N 250 THR CA C sing N N 251 THR CA CB sing N N 252 THR CA HA sing N N 253 THR C O doub N N 254 THR C OXT sing N N 255 THR CB OG1 sing N N 256 THR CB CG2 sing N N 257 THR CB HB sing N N 258 THR OG1 HG1 sing N N 259 THR CG2 HG21 sing N N 260 THR CG2 HG22 sing N N 261 THR CG2 HG23 sing N N 262 THR OXT HXT sing N N 263 TYR N CA sing N N 264 TYR N H sing N N 265 TYR N H2 sing N N 266 TYR CA C sing N N 267 TYR CA CB sing N N 268 TYR CA HA sing N N 269 TYR C O doub N N 270 TYR C OXT sing N N 271 TYR CB CG sing N N 272 TYR CB HB2 sing N N 273 TYR CB HB3 sing N N 274 TYR CG CD1 doub Y N 275 TYR CG CD2 sing Y N 276 TYR CD1 CE1 sing Y N 277 TYR CD1 HD1 sing N N 278 TYR CD2 CE2 doub Y N 279 TYR CD2 HD2 sing N N 280 TYR CE1 CZ doub Y N 281 TYR CE1 HE1 sing N N 282 TYR CE2 CZ sing Y N 283 TYR CE2 HE2 sing N N 284 TYR CZ OH sing N N 285 TYR OH HH sing N N 286 TYR OXT HXT sing N N 287 VAL N CA sing N N 288 VAL N H sing N N 289 VAL N H2 sing N N 290 VAL CA C sing N N 291 VAL CA CB sing N N 292 VAL CA HA sing N N 293 VAL C O doub N N 294 VAL C OXT sing N N 295 VAL CB CG1 sing N N 296 VAL CB CG2 sing N N 297 VAL CB HB sing N N 298 VAL CG1 HG11 sing N N 299 VAL CG1 HG12 sing N N 300 VAL CG1 HG13 sing N N 301 VAL CG2 HG21 sing N N 302 VAL CG2 HG22 sing N N 303 VAL CG2 HG23 sing N N 304 VAL OXT HXT sing N N 305 # _pdbx_audit_support.funding_organization 'Region Rhone-Alpes' _pdbx_audit_support.country France _pdbx_audit_support.grant_number 'CIBLE 2011' _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 5DOL _atom_sites.fract_transf_matrix[1][1] 0.011979 _atom_sites.fract_transf_matrix[1][2] 0.006916 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013832 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015454 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_