data_5DPK # _entry.id 5DPK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5DPK WWPDB D_1000213575 # loop_ _pdbx_database_PDB_obs_spr.id _pdbx_database_PDB_obs_spr.date _pdbx_database_PDB_obs_spr.pdb_id _pdbx_database_PDB_obs_spr.replace_pdb_id _pdbx_database_PDB_obs_spr.details SPRSDE 2015-09-23 5DPK 3FSQ ? OBSLTE 2019-10-02 6U7T 5DPK ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DPK _pdbx_database_status.recvd_initial_deposition_date 2015-09-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Horvath, M.P.' 1 ;O'Shea, V.L. ; 2 'Cao, S.' 3 'David, S.S.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 44 _citation.language ? _citation.page_first 801 _citation.page_last 810 _citation.title 'Structure and stereochemistry of the base excision repair glycosylase MutY reveal a mechanism similar to retaining glycosidases.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkv1469 _citation.pdbx_database_id_PubMed 26673696 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Woods, R.D.' 1 ? primary ;O'Shea, V.L. ; 2 ? primary 'Chu, A.' 3 ? primary 'Cao, S.' 4 ? primary 'Richards, J.L.' 5 ? primary 'Horvath, M.P.' 6 ? primary 'David, S.S.' 7 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5DPK _cell.details ? _cell.formula_units_Z ? _cell.length_a 37.850 _cell.length_a_esd ? _cell.length_b 86.620 _cell.length_b_esd ? _cell.length_c 140.770 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DPK _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'A/G-specific adenine glycosylase' 41810.629 1 3.2.2.- ? ? ? 2 polymer syn ;DNA (5'-D(*AP*AP*GP*AP*CP*(8OG)P*TP*GP*GP*AP*C)-3') ; 3423.249 1 ? ? ? ? 3 polymer syn ;DNA (5'-D(P*GP*TP*CP*CP*AP*(NR1)P*GP*TP*CP*T)-3') ; 3191.096 1 ? ? ? ? 4 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640 1 ? ? ? ? 5 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 6 water nat water 18.015 70 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MTRETERFPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVL KAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDD IAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLA VAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPIVSFEHAFSHLVWQLTVFPGR LVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWASGVRPPP ; ;MTRETERFPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVL KAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDD IAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLA VAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPIVSFEHAFSHLVWQLTVFPGR LVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWASGVRPPP ; A ? 2 polydeoxyribonucleotide no yes '(DA)(DA)(DG)(DA)(DC)(8OG)(DT)(DG)(DG)(DA)(DC)' AAGACGTGGAC B ? 3 polydeoxyribonucleotide no yes '(DT)(DG)(DT)(DC)(DC)(DA)(NR1)(DG)(DT)(DC)(DT)' TGTCCAXGTCT C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ARG n 1 4 GLU n 1 5 THR n 1 6 GLU n 1 7 ARG n 1 8 PHE n 1 9 PRO n 1 10 ALA n 1 11 ARG n 1 12 GLU n 1 13 PHE n 1 14 GLN n 1 15 ARG n 1 16 ASP n 1 17 LEU n 1 18 LEU n 1 19 ASP n 1 20 TRP n 1 21 PHE n 1 22 ALA n 1 23 ARG n 1 24 GLU n 1 25 ARG n 1 26 ARG n 1 27 ASP n 1 28 LEU n 1 29 PRO n 1 30 TRP n 1 31 ARG n 1 32 LYS n 1 33 ASP n 1 34 ARG n 1 35 ASP n 1 36 PRO n 1 37 TYR n 1 38 LYS n 1 39 VAL n 1 40 TRP n 1 41 VAL n 1 42 SER n 1 43 GLU n 1 44 VAL n 1 45 MET n 1 46 LEU n 1 47 GLN n 1 48 GLN n 1 49 THR n 1 50 ARG n 1 51 VAL n 1 52 GLU n 1 53 THR n 1 54 VAL n 1 55 ILE n 1 56 PRO n 1 57 TYR n 1 58 PHE n 1 59 GLU n 1 60 GLN n 1 61 PHE n 1 62 ILE n 1 63 ASP n 1 64 ARG n 1 65 PHE n 1 66 PRO n 1 67 THR n 1 68 LEU n 1 69 GLU n 1 70 ALA n 1 71 LEU n 1 72 ALA n 1 73 ASP n 1 74 ALA n 1 75 ASP n 1 76 GLU n 1 77 ASP n 1 78 GLU n 1 79 VAL n 1 80 LEU n 1 81 LYS n 1 82 ALA n 1 83 TRP n 1 84 GLU n 1 85 GLY n 1 86 LEU n 1 87 GLY n 1 88 TYR n 1 89 TYR n 1 90 SER n 1 91 ARG n 1 92 VAL n 1 93 ARG n 1 94 ASN n 1 95 LEU n 1 96 HIS n 1 97 ALA n 1 98 ALA n 1 99 VAL n 1 100 LYS n 1 101 GLU n 1 102 VAL n 1 103 LYS n 1 104 THR n 1 105 ARG n 1 106 TYR n 1 107 GLY n 1 108 GLY n 1 109 LYS n 1 110 VAL n 1 111 PRO n 1 112 ASP n 1 113 ASP n 1 114 PRO n 1 115 ASP n 1 116 GLU n 1 117 PHE n 1 118 SER n 1 119 ARG n 1 120 LEU n 1 121 LYS n 1 122 GLY n 1 123 VAL n 1 124 GLY n 1 125 PRO n 1 126 TYR n 1 127 THR n 1 128 VAL n 1 129 GLY n 1 130 ALA n 1 131 VAL n 1 132 LEU n 1 133 SER n 1 134 LEU n 1 135 ALA n 1 136 TYR n 1 137 GLY n 1 138 VAL n 1 139 PRO n 1 140 GLU n 1 141 PRO n 1 142 ALA n 1 143 VAL n 1 144 ASP n 1 145 GLY n 1 146 ASN n 1 147 VAL n 1 148 MET n 1 149 ARG n 1 150 VAL n 1 151 LEU n 1 152 SER n 1 153 ARG n 1 154 LEU n 1 155 PHE n 1 156 LEU n 1 157 VAL n 1 158 THR n 1 159 ASP n 1 160 ASP n 1 161 ILE n 1 162 ALA n 1 163 LYS n 1 164 PRO n 1 165 SER n 1 166 THR n 1 167 ARG n 1 168 LYS n 1 169 ARG n 1 170 PHE n 1 171 GLU n 1 172 GLN n 1 173 ILE n 1 174 VAL n 1 175 ARG n 1 176 GLU n 1 177 ILE n 1 178 MET n 1 179 ALA n 1 180 TYR n 1 181 GLU n 1 182 ASN n 1 183 PRO n 1 184 GLY n 1 185 ALA n 1 186 PHE n 1 187 ASN n 1 188 GLU n 1 189 ALA n 1 190 LEU n 1 191 ILE n 1 192 GLU n 1 193 LEU n 1 194 GLY n 1 195 ALA n 1 196 LEU n 1 197 VAL n 1 198 CYS n 1 199 THR n 1 200 PRO n 1 201 ARG n 1 202 ARG n 1 203 PRO n 1 204 SER n 1 205 CYS n 1 206 LEU n 1 207 LEU n 1 208 CYS n 1 209 PRO n 1 210 VAL n 1 211 GLN n 1 212 ALA n 1 213 TYR n 1 214 CYS n 1 215 GLN n 1 216 ALA n 1 217 PHE n 1 218 ALA n 1 219 GLU n 1 220 GLY n 1 221 VAL n 1 222 ALA n 1 223 GLU n 1 224 GLU n 1 225 LEU n 1 226 PRO n 1 227 VAL n 1 228 LYS n 1 229 MET n 1 230 LYS n 1 231 LYS n 1 232 THR n 1 233 ALA n 1 234 VAL n 1 235 LYS n 1 236 GLN n 1 237 VAL n 1 238 PRO n 1 239 LEU n 1 240 ALA n 1 241 VAL n 1 242 ALA n 1 243 VAL n 1 244 LEU n 1 245 ALA n 1 246 ASP n 1 247 ASP n 1 248 GLU n 1 249 GLY n 1 250 ARG n 1 251 VAL n 1 252 LEU n 1 253 ILE n 1 254 ARG n 1 255 LYS n 1 256 ARG n 1 257 ASP n 1 258 SER n 1 259 THR n 1 260 GLY n 1 261 LEU n 1 262 LEU n 1 263 ALA n 1 264 ASN n 1 265 LEU n 1 266 TRP n 1 267 GLU n 1 268 PHE n 1 269 PRO n 1 270 SER n 1 271 CYS n 1 272 GLU n 1 273 THR n 1 274 ASP n 1 275 GLY n 1 276 ALA n 1 277 ASP n 1 278 GLY n 1 279 LYS n 1 280 GLU n 1 281 LYS n 1 282 LEU n 1 283 GLU n 1 284 GLN n 1 285 MET n 1 286 VAL n 1 287 GLY n 1 288 GLU n 1 289 GLN n 1 290 TYR n 1 291 GLY n 1 292 LEU n 1 293 GLN n 1 294 VAL n 1 295 GLU n 1 296 LEU n 1 297 THR n 1 298 GLU n 1 299 PRO n 1 300 ILE n 1 301 VAL n 1 302 SER n 1 303 PHE n 1 304 GLU n 1 305 HIS n 1 306 ALA n 1 307 PHE n 1 308 SER n 1 309 HIS n 1 310 LEU n 1 311 VAL n 1 312 TRP n 1 313 GLN n 1 314 LEU n 1 315 THR n 1 316 VAL n 1 317 PHE n 1 318 PRO n 1 319 GLY n 1 320 ARG n 1 321 LEU n 1 322 VAL n 1 323 HIS n 1 324 GLY n 1 325 GLY n 1 326 PRO n 1 327 VAL n 1 328 GLU n 1 329 GLU n 1 330 PRO n 1 331 TYR n 1 332 ARG n 1 333 LEU n 1 334 ALA n 1 335 PRO n 1 336 GLU n 1 337 ASP n 1 338 GLU n 1 339 LEU n 1 340 LYS n 1 341 ALA n 1 342 TYR n 1 343 ALA n 1 344 PHE n 1 345 PRO n 1 346 VAL n 1 347 SER n 1 348 HIS n 1 349 GLN n 1 350 ARG n 1 351 VAL n 1 352 TRP n 1 353 ARG n 1 354 GLU n 1 355 TYR n 1 356 LYS n 1 357 GLU n 1 358 TRP n 1 359 ALA n 1 360 SER n 1 361 GLY n 1 362 VAL n 1 363 ARG n 1 364 PRO n 1 365 PRO n 1 366 PRO n 2 1 DA n 2 2 DA n 2 3 DG n 2 4 DA n 2 5 DC n 2 6 8OG n 2 7 DT n 2 8 DG n 2 9 DG n 2 10 DA n 2 11 DC n 3 1 DT n 3 2 DG n 3 3 DT n 3 4 DC n 3 5 DC n 3 6 DA n 3 7 NR1 n 3 8 DG n 3 9 DT n 3 10 DC n 3 11 DT n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 366 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MutY _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Geobacillus stearothermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1422 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 2 1 sample 1 11 'synthetic construct' ? 32630 ? 3 1 sample 1 11 'synthetic construct' ? 32630 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP P83847_GEOSE P83847 ? 1 ;MTRETERFPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVL KAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLFLVTDD IAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLA VAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPIVSFEHAFSHLVWQLTVFPGR LVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWASGVRPPP ; 1 2 PDB 5DPK 5DPK ? 2 ? 1 3 PDB 5DPK 5DPK ? 3 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5DPK A 1 ? 366 ? P83847 1 ? 366 ? 1 366 2 2 5DPK B 1 ? 11 ? 5DPK 1 ? 11 ? 1 11 3 3 5DPK C 1 ? 11 ? 5DPK 12 ? 22 ? 12 22 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5DPK _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 144 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P83847 _struct_ref_seq_dif.db_mon_id ASN _struct_ref_seq_dif.pdbx_seq_db_seq_num 144 _struct_ref_seq_dif.details variant _struct_ref_seq_dif.pdbx_auth_seq_num 144 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8OG 'DNA linking' n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" "8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 'C10 H14 N5 O8 P' 363.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DA 'DNA linking' y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 DC 'DNA linking' y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.197 DG 'DNA linking' y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 DT 'DNA linking' y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NR1 'DNA linking' . '(3R,4R)-3-hydroxy-4-[(phosphonooxy)methyl]pyrrolidinium' ? 'C5 H13 N O5 P 1' 198.134 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SF4 non-polymer . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4' 351.640 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DPK _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.41 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.91 _exptl_crystal.description rod _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'micro-seeded, 0.5 M calcium acetate, 0.1 M Tris, 14% w/v PEG4000, 0.005 M beta-mercaptoethanol, 5% w/v ethylene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2007-05-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.11583 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 12.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.11583 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 12.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 47.9 _reflns.entry_id 5DPK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.20 _reflns.d_resolution_low 41.3 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 24104 _reflns.number_obs 24104 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.percent_possible_obs 99.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.1 _reflns.pdbx_Rmerge_I_obs 0.071 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.26 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 96.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.764 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 50.7 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DPK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.200 _refine.ls_d_res_low 41.258 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24103 _refine.ls_number_reflns_R_free 1163 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.03 _refine.ls_percent_reflns_R_free 4.83 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2430 _refine.ls_R_factor_R_free 0.2573 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2423 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 1RRQ' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.01 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.37 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2748 _refine_hist.pdbx_number_atoms_nucleic_acid 421 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 70 _refine_hist.number_atoms_total 3249 _refine_hist.d_res_high 2.200 _refine_hist.d_res_low 41.258 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 3309 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.759 ? 4595 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 19.475 ? 1908 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.043 ? 501 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 523 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2000 2.3001 . . 153 2752 98.00 . . . 0.3913 . 0.3687 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3001 2.4214 . . 146 2795 98.00 . . . 0.3683 . 0.3331 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4214 2.5730 . . 149 2805 99.00 . . . 0.3146 . 0.3056 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5730 2.7717 . . 145 2821 99.00 . . . 0.2727 . 0.2959 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7717 3.0505 . . 145 2863 99.00 . . . 0.3215 . 0.2851 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0505 3.4917 . . 136 2893 99.00 . . . 0.2410 . 0.2430 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4917 4.3984 . . 138 2922 100.00 . . . 0.2167 . 0.2041 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3984 41.2657 . . 151 3089 100.00 . . . 0.2151 . 0.2016 . . . . . . . . . . # _struct.entry_id 5DPK _struct.title 'MutY adenine glycosylase bound to a transition state analog (1N) paired with d(8-oxoG) in duplexed DNA to 2.2 A' _struct.pdbx_descriptor 'A/G-specific adenine glycosylase/DNA Complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DPK _struct_keywords.text 'protein-DNA complex, DNA repair, glycosylase, transition state analog, HYDROLASE-DNA complex' _struct_keywords.pdbx_keywords HYDROLASE/DNA # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? G N N 6 ? H N N 6 ? I N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 9 ? ARG A 25 ? PRO A 9 ARG A 25 1 ? 17 HELX_P HELX_P2 AA2 LEU A 28 ? LYS A 32 ? LEU A 28 LYS A 32 5 ? 5 HELX_P HELX_P3 AA3 ASP A 35 ? LEU A 46 ? ASP A 35 LEU A 46 1 ? 12 HELX_P HELX_P4 AA4 ARG A 50 ? PHE A 65 ? ARG A 50 PHE A 65 1 ? 16 HELX_P HELX_P5 AA5 THR A 67 ? ASP A 73 ? THR A 67 ASP A 73 1 ? 7 HELX_P HELX_P6 AA6 ASP A 75 ? TRP A 83 ? ASP A 75 TRP A 83 1 ? 9 HELX_P HELX_P7 AA7 TYR A 89 ? ARG A 105 ? TYR A 89 ARG A 105 1 ? 17 HELX_P HELX_P8 AA8 ASP A 113 ? ARG A 119 ? ASP A 113 ARG A 119 1 ? 7 HELX_P HELX_P9 AA9 GLY A 124 ? TYR A 136 ? GLY A 124 TYR A 136 1 ? 13 HELX_P HELX_P10 AB1 ASP A 144 ? PHE A 155 ? ASP A 144 PHE A 155 1 ? 12 HELX_P HELX_P11 AB2 LYS A 163 ? MET A 178 ? LYS A 163 MET A 178 1 ? 16 HELX_P HELX_P12 AB3 ASN A 182 ? VAL A 197 ? ASN A 182 VAL A 197 1 ? 16 HELX_P HELX_P13 AB4 VAL A 210 ? TYR A 213 ? VAL A 210 TYR A 213 5 ? 4 HELX_P HELX_P14 AB5 CYS A 214 ? GLY A 220 ? CYS A 214 GLY A 220 1 ? 7 HELX_P HELX_P15 AB6 VAL A 221 ? LEU A 225 ? VAL A 221 LEU A 225 5 ? 5 HELX_P HELX_P16 AB7 ASP A 277 ? GLN A 289 ? ASP A 277 GLN A 289 1 ? 13 HELX_P HELX_P17 AB8 PRO A 335 ? TYR A 342 ? PRO A 335 TYR A 342 5 ? 8 HELX_P HELX_P18 AB9 PRO A 345 ? ALA A 359 ? PRO A 345 ALA A 359 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A SER 118 O ? ? ? 1_555 E CA . CA ? ? A SER 118 A CA 402 1_555 ? ? ? ? ? ? ? 2.388 ? metalc2 metalc ? ? A SER 118 OG ? ? ? 1_555 E CA . CA ? ? A SER 118 A CA 402 1_555 ? ? ? ? ? ? ? 2.252 ? metalc3 metalc ? ? A VAL 123 O ? ? ? 1_555 E CA . CA ? ? A VAL 123 A CA 402 1_555 ? ? ? ? ? ? ? 2.426 ? metalc4 metalc ? ? A CYS 205 SG ? ? ? 1_555 D SF4 . FE2 ? ? A CYS 205 A SF4 401 1_555 ? ? ? ? ? ? ? 2.589 ? metalc5 metalc ? ? A CYS 208 SG ? ? ? 1_555 D SF4 . FE1 ? ? A CYS 208 A SF4 401 1_555 ? ? ? ? ? ? ? 2.491 ? metalc6 metalc ? ? A CYS 214 SG ? ? ? 1_555 D SF4 . FE4 ? ? A CYS 214 A SF4 401 1_555 ? ? ? ? ? ? ? 2.699 ? metalc7 metalc ? ? A ASP 257 OD2 ? ? ? 1_555 F CA . CA ? ? A ASP 257 A CA 403 1_555 ? ? ? ? ? ? ? 2.319 ? metalc8 metalc ? ? A THR 259 O ? ? ? 1_555 F CA . CA ? ? A THR 259 A CA 403 1_555 ? ? ? ? ? ? ? 2.308 ? metalc9 metalc ? ? A THR 259 OG1 ? ? ? 1_555 F CA . CA ? ? A THR 259 A CA 403 1_555 ? ? ? ? ? ? ? 2.292 ? covale1 covale both ? B DC 5 "O3'" ? ? ? 1_555 B 8OG 6 P ? ? B DC 5 B 8OG 6 1_555 ? ? ? ? ? ? ? 1.599 ? covale2 covale both ? B 8OG 6 "O3'" ? ? ? 1_555 B DT 7 P ? ? B 8OG 6 B DT 7 1_555 ? ? ? ? ? ? ? 1.598 ? covale3 covale both ? C DA 6 "O3'" ? ? ? 1_555 C NR1 7 P ? ? C DA 17 C NR1 18 1_555 ? ? ? ? ? ? ? 1.598 ? covale4 covale both ? C NR1 7 "O3'" ? ? ? 1_555 C DG 8 P ? ? C NR1 18 C DG 19 1_555 ? ? ? ? ? ? ? 1.603 ? metalc10 metalc ? ? E CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 402 A HOH 509 1_555 ? ? ? ? ? ? ? 2.328 ? metalc11 metalc ? ? E CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 402 A HOH 529 1_555 ? ? ? ? ? ? ? 2.292 ? metalc12 metalc ? ? E CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 402 C HOH 102 1_555 ? ? ? ? ? ? ? 2.247 ? hydrog1 hydrog ? ? B DA 2 N1 ? ? ? 1_555 C DT 11 N3 ? ? B DA 2 C DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog2 hydrog ? ? B DA 2 N6 ? ? ? 1_555 C DT 11 O4 ? ? B DA 2 C DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog3 hydrog ? ? B DG 3 N1 ? ? ? 1_555 C DC 10 N3 ? ? B DG 3 C DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog4 hydrog ? ? B DG 3 N2 ? ? ? 1_555 C DC 10 O2 ? ? B DG 3 C DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog5 hydrog ? ? B DG 3 O6 ? ? ? 1_555 C DC 10 N4 ? ? B DG 3 C DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog6 hydrog ? ? B DA 4 N1 ? ? ? 1_555 C DT 9 N3 ? ? B DA 4 C DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog7 hydrog ? ? B DA 4 N6 ? ? ? 1_555 C DT 9 O4 ? ? B DA 4 C DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog8 hydrog ? ? B DC 5 N3 ? ? ? 1_555 C DG 8 N1 ? ? B DC 5 C DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog9 hydrog ? ? B DC 5 N4 ? ? ? 1_555 C DG 8 O6 ? ? B DC 5 C DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog10 hydrog ? ? B DC 5 O2 ? ? ? 1_555 C DG 8 N2 ? ? B DC 5 C DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog11 hydrog ? ? B DT 7 N3 ? ? ? 1_555 C DA 6 N1 ? ? B DT 7 C DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog12 hydrog ? ? B DT 7 O4 ? ? ? 1_555 C DA 6 N6 ? ? B DT 7 C DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog13 hydrog ? ? B DG 8 N1 ? ? ? 1_555 C DC 5 N3 ? ? B DG 8 C DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog14 hydrog ? ? B DG 8 N2 ? ? ? 1_555 C DC 5 O2 ? ? B DG 8 C DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog15 hydrog ? ? B DG 8 O6 ? ? ? 1_555 C DC 5 N4 ? ? B DG 8 C DC 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog16 hydrog ? ? B DG 9 N1 ? ? ? 1_555 C DC 4 N3 ? ? B DG 9 C DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog17 hydrog ? ? B DG 9 N2 ? ? ? 1_555 C DC 4 O2 ? ? B DG 9 C DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog18 hydrog ? ? B DG 9 O6 ? ? ? 1_555 C DC 4 N4 ? ? B DG 9 C DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog19 hydrog ? ? B DA 10 N1 ? ? ? 1_555 C DT 3 N3 ? ? B DA 10 C DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog20 hydrog ? ? B DA 10 N6 ? ? ? 1_555 C DT 3 O4 ? ? B DA 10 C DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog21 hydrog ? ? B DC 11 N3 ? ? ? 1_555 C DG 2 N1 ? ? B DC 11 C DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog22 hydrog ? ? B DC 11 N4 ? ? ? 1_555 C DG 2 O6 ? ? B DC 11 C DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? hydrog23 hydrog ? ? B DC 11 O2 ? ? ? 1_555 C DG 2 N2 ? ? B DC 11 C DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? hydrog ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 225 A . ? LEU 225 A PRO 226 A ? PRO 226 A 1 -0.24 2 ASP 274 A . ? ASP 274 A GLY 275 A ? GLY 275 A 1 -7.24 3 GLU 329 A . ? GLU 329 A PRO 330 A ? PRO 330 A 1 1.98 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 270 ? GLU A 272 ? SER A 270 GLU A 272 AA1 2 LYS A 235 ? ALA A 245 ? LYS A 235 ALA A 245 AA1 3 LEU A 310 ? ARG A 320 ? LEU A 310 ARG A 320 AA1 4 VAL A 301 ? ALA A 306 ? VAL A 301 ALA A 306 AA2 1 TRP A 266 ? GLU A 267 ? TRP A 266 GLU A 267 AA2 2 VAL A 251 ? LYS A 255 ? VAL A 251 LYS A 255 AA2 3 TYR A 331 ? ALA A 334 ? TYR A 331 ALA A 334 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O CYS A 271 ? O CYS A 271 N ALA A 240 ? N ALA A 240 AA1 2 3 N LEU A 239 ? N LEU A 239 O GLN A 313 ? O GLN A 313 AA1 3 4 O TRP A 312 ? O TRP A 312 N HIS A 305 ? N HIS A 305 AA2 1 2 O GLU A 267 ? O GLU A 267 N ARG A 254 ? N ARG A 254 AA2 2 3 N VAL A 251 ? N VAL A 251 O ALA A 334 ? O ALA A 334 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SF4 401 ? 5 'binding site for residue SF4 A 401' AC2 Software A CA 402 ? 5 'binding site for residue CA A 402' AC3 Software A CA 403 ? 2 'binding site for residue CA A 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 198 ? CYS A 198 . ? 1_555 ? 2 AC1 5 CYS A 205 ? CYS A 205 . ? 1_555 ? 3 AC1 5 CYS A 208 ? CYS A 208 . ? 1_555 ? 4 AC1 5 GLN A 211 ? GLN A 211 . ? 1_555 ? 5 AC1 5 CYS A 214 ? CYS A 214 . ? 1_555 ? 6 AC2 5 SER A 118 ? SER A 118 . ? 1_555 ? 7 AC2 5 VAL A 123 ? VAL A 123 . ? 1_555 ? 8 AC2 5 HOH G . ? HOH A 509 . ? 1_555 ? 9 AC2 5 HOH G . ? HOH A 529 . ? 1_555 ? 10 AC2 5 HOH I . ? HOH C 102 . ? 1_555 ? 11 AC3 2 ASP A 257 ? ASP A 257 . ? 1_555 ? 12 AC3 2 THR A 259 ? THR A 259 . ? 1_555 ? # _atom_sites.entry_id 5DPK _atom_sites.fract_transf_matrix[1][1] 0.026420 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011545 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007104 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA FE H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 MET 148 148 148 MET MET A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 MET 178 178 178 MET MET A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 CYS 198 198 198 CYS CYS A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 PRO 203 203 203 PRO PRO A . n A 1 204 SER 204 204 204 SER SER A . n A 1 205 CYS 205 205 205 CYS CYS A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 CYS 208 208 208 CYS CYS A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 GLN 211 211 211 GLN GLN A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 TYR 213 213 213 TYR TYR A . n A 1 214 CYS 214 214 214 CYS CYS A . n A 1 215 GLN 215 215 215 GLN GLN A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 PHE 217 217 217 PHE PHE A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 LYS 228 228 228 LYS LYS A . n A 1 229 MET 229 229 229 MET MET A . n A 1 230 LYS 230 230 230 LYS LYS A . n A 1 231 LYS 231 231 231 LYS LYS A . n A 1 232 THR 232 232 232 THR THR A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 LYS 235 235 235 LYS LYS A . n A 1 236 GLN 236 236 236 GLN GLN A . n A 1 237 VAL 237 237 237 VAL VAL A . n A 1 238 PRO 238 238 238 PRO PRO A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 ALA 240 240 240 ALA ALA A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 ALA 242 242 242 ALA ALA A . n A 1 243 VAL 243 243 243 VAL VAL A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 ALA 245 245 245 ALA ALA A . n A 1 246 ASP 246 246 246 ASP ASP A . n A 1 247 ASP 247 247 247 ASP ASP A . n A 1 248 GLU 248 248 248 GLU GLU A . n A 1 249 GLY 249 249 249 GLY GLY A . n A 1 250 ARG 250 250 250 ARG ARG A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 ILE 253 253 253 ILE ILE A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 ASP 257 257 257 ASP ASP A . n A 1 258 SER 258 258 258 SER SER A . n A 1 259 THR 259 259 259 THR THR A . n A 1 260 GLY 260 260 260 GLY GLY A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 ASN 264 264 264 ASN ASN A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 TRP 266 266 266 TRP TRP A . n A 1 267 GLU 267 267 267 GLU GLU A . n A 1 268 PHE 268 268 268 PHE PHE A . n A 1 269 PRO 269 269 269 PRO PRO A . n A 1 270 SER 270 270 270 SER SER A . n A 1 271 CYS 271 271 271 CYS CYS A . n A 1 272 GLU 272 272 272 GLU GLU A . n A 1 273 THR 273 273 273 THR THR A . n A 1 274 ASP 274 274 274 ASP ASP A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 ALA 276 276 276 ALA ALA A . n A 1 277 ASP 277 277 277 ASP ASP A . n A 1 278 GLY 278 278 278 GLY GLY A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 GLU 280 280 280 GLU GLU A . n A 1 281 LYS 281 281 281 LYS LYS A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 GLU 283 283 283 GLU GLU A . n A 1 284 GLN 284 284 284 GLN GLN A . n A 1 285 MET 285 285 285 MET MET A . n A 1 286 VAL 286 286 286 VAL VAL A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 GLU 288 288 288 GLU GLU A . n A 1 289 GLN 289 289 289 GLN GLN A . n A 1 290 TYR 290 290 ? ? ? A . n A 1 291 GLY 291 291 ? ? ? A . n A 1 292 LEU 292 292 ? ? ? A . n A 1 293 GLN 293 293 ? ? ? A . n A 1 294 VAL 294 294 ? ? ? A . n A 1 295 GLU 295 295 295 GLU GLU A . n A 1 296 LEU 296 296 296 LEU LEU A . n A 1 297 THR 297 297 297 THR THR A . n A 1 298 GLU 298 298 298 GLU GLU A . n A 1 299 PRO 299 299 299 PRO PRO A . n A 1 300 ILE 300 300 300 ILE ILE A . n A 1 301 VAL 301 301 301 VAL VAL A . n A 1 302 SER 302 302 302 SER SER A . n A 1 303 PHE 303 303 303 PHE PHE A . n A 1 304 GLU 304 304 304 GLU GLU A . n A 1 305 HIS 305 305 305 HIS HIS A . n A 1 306 ALA 306 306 306 ALA ALA A . n A 1 307 PHE 307 307 307 PHE PHE A . n A 1 308 SER 308 308 308 SER SER A . n A 1 309 HIS 309 309 309 HIS HIS A . n A 1 310 LEU 310 310 310 LEU LEU A . n A 1 311 VAL 311 311 311 VAL VAL A . n A 1 312 TRP 312 312 312 TRP TRP A . n A 1 313 GLN 313 313 313 GLN GLN A . n A 1 314 LEU 314 314 314 LEU LEU A . n A 1 315 THR 315 315 315 THR THR A . n A 1 316 VAL 316 316 316 VAL VAL A . n A 1 317 PHE 317 317 317 PHE PHE A . n A 1 318 PRO 318 318 318 PRO PRO A . n A 1 319 GLY 319 319 319 GLY GLY A . n A 1 320 ARG 320 320 320 ARG ARG A . n A 1 321 LEU 321 321 321 LEU LEU A . n A 1 322 VAL 322 322 322 VAL VAL A . n A 1 323 HIS 323 323 323 HIS HIS A . n A 1 324 GLY 324 324 324 GLY GLY A . n A 1 325 GLY 325 325 325 GLY GLY A . n A 1 326 PRO 326 326 326 PRO PRO A . n A 1 327 VAL 327 327 327 VAL VAL A . n A 1 328 GLU 328 328 328 GLU GLU A . n A 1 329 GLU 329 329 329 GLU GLU A . n A 1 330 PRO 330 330 330 PRO PRO A . n A 1 331 TYR 331 331 331 TYR TYR A . n A 1 332 ARG 332 332 332 ARG ARG A . n A 1 333 LEU 333 333 333 LEU LEU A . n A 1 334 ALA 334 334 334 ALA ALA A . n A 1 335 PRO 335 335 335 PRO PRO A . n A 1 336 GLU 336 336 336 GLU GLU A . n A 1 337 ASP 337 337 337 ASP ASP A . n A 1 338 GLU 338 338 338 GLU GLU A . n A 1 339 LEU 339 339 339 LEU LEU A . n A 1 340 LYS 340 340 340 LYS LYS A . n A 1 341 ALA 341 341 341 ALA ALA A . n A 1 342 TYR 342 342 342 TYR TYR A . n A 1 343 ALA 343 343 343 ALA ALA A . n A 1 344 PHE 344 344 344 PHE PHE A . n A 1 345 PRO 345 345 345 PRO PRO A . n A 1 346 VAL 346 346 346 VAL VAL A . n A 1 347 SER 347 347 347 SER SER A . n A 1 348 HIS 348 348 348 HIS HIS A . n A 1 349 GLN 349 349 349 GLN GLN A . n A 1 350 ARG 350 350 350 ARG ARG A . n A 1 351 VAL 351 351 351 VAL VAL A . n A 1 352 TRP 352 352 352 TRP TRP A . n A 1 353 ARG 353 353 353 ARG ARG A . n A 1 354 GLU 354 354 354 GLU GLU A . n A 1 355 TYR 355 355 355 TYR TYR A . n A 1 356 LYS 356 356 356 LYS LYS A . n A 1 357 GLU 357 357 357 GLU GLU A . n A 1 358 TRP 358 358 358 TRP TRP A . n A 1 359 ALA 359 359 359 ALA ALA A . n A 1 360 SER 360 360 360 SER SER A . n A 1 361 GLY 361 361 ? ? ? A . n A 1 362 VAL 362 362 ? ? ? A . n A 1 363 ARG 363 363 ? ? ? A . n A 1 364 PRO 364 364 ? ? ? A . n A 1 365 PRO 365 365 ? ? ? A . n A 1 366 PRO 366 366 ? ? ? A . n B 2 1 DA 1 1 1 DA DA B . n B 2 2 DA 2 2 2 DA DA B . n B 2 3 DG 3 3 3 DG DG B . n B 2 4 DA 4 4 4 DA DA B . n B 2 5 DC 5 5 5 DC DC B . n B 2 6 8OG 6 6 6 8OG 8OG B . n B 2 7 DT 7 7 7 DT DT B . n B 2 8 DG 8 8 8 DG DG B . n B 2 9 DG 9 9 9 DG DG B . n B 2 10 DA 10 10 10 DA DA B . n B 2 11 DC 11 11 11 DC DC B . n C 3 1 DT 1 12 ? ? ? C . n C 3 2 DG 2 13 13 DG DG C . n C 3 3 DT 3 14 14 DT DT C . n C 3 4 DC 4 15 15 DC DC C . n C 3 5 DC 5 16 16 DC DC C . n C 3 6 DA 6 17 17 DA DA C . n C 3 7 NR1 7 18 18 NR1 NR1 C . n C 3 8 DG 8 19 19 DG DG C . n C 3 9 DT 9 20 20 DT DT C . n C 3 10 DC 10 21 21 DC DC C . n C 3 11 DT 11 22 22 DT DT C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 SF4 1 401 400 SF4 SF4 A . E 5 CA 1 402 501 CA CA A . F 5 CA 1 403 1 CA CA A . G 6 HOH 1 501 21 HOH HOH A . G 6 HOH 2 502 88 HOH HOH A . G 6 HOH 3 503 14 HOH HOH A . G 6 HOH 4 504 23 HOH HOH A . G 6 HOH 5 505 35 HOH HOH A . G 6 HOH 6 506 69 HOH HOH A . G 6 HOH 7 507 43 HOH HOH A . G 6 HOH 8 508 15 HOH HOH A . G 6 HOH 9 509 48 HOH HOH A . G 6 HOH 10 510 42 HOH HOH A . G 6 HOH 11 511 8 HOH HOH A . G 6 HOH 12 512 17 HOH HOH A . G 6 HOH 13 513 70 HOH HOH A . G 6 HOH 14 514 57 HOH HOH A . G 6 HOH 15 515 18 HOH HOH A . G 6 HOH 16 516 38 HOH HOH A . G 6 HOH 17 517 9 HOH HOH A . G 6 HOH 18 518 51 HOH HOH A . G 6 HOH 19 519 3 HOH HOH A . G 6 HOH 20 520 75 HOH HOH A . G 6 HOH 21 521 11 HOH HOH A . G 6 HOH 22 522 13 HOH HOH A . G 6 HOH 23 523 63 HOH HOH A . G 6 HOH 24 524 83 HOH HOH A . G 6 HOH 25 525 46 HOH HOH A . G 6 HOH 26 526 66 HOH HOH A . G 6 HOH 27 527 1 HOH HOH A . G 6 HOH 28 528 59 HOH HOH A . G 6 HOH 29 529 27 HOH HOH A . G 6 HOH 30 530 31 HOH HOH A . G 6 HOH 31 531 36 HOH HOH A . G 6 HOH 32 532 74 HOH HOH A . G 6 HOH 33 533 25 HOH HOH A . G 6 HOH 34 534 33 HOH HOH A . G 6 HOH 35 535 20 HOH HOH A . G 6 HOH 36 536 12 HOH HOH A . G 6 HOH 37 537 32 HOH HOH A . G 6 HOH 38 538 44 HOH HOH A . G 6 HOH 39 539 79 HOH HOH A . G 6 HOH 40 540 61 HOH HOH A . G 6 HOH 41 541 60 HOH HOH A . G 6 HOH 42 542 89 HOH HOH A . G 6 HOH 43 543 40 HOH HOH A . G 6 HOH 44 544 86 HOH HOH A . H 6 HOH 1 101 4 HOH HOH B . H 6 HOH 2 102 67 HOH HOH B . H 6 HOH 3 103 73 HOH HOH B . H 6 HOH 4 104 2 HOH HOH B . H 6 HOH 5 105 10 HOH HOH B . H 6 HOH 6 106 80 HOH HOH B . H 6 HOH 7 107 39 HOH HOH B . H 6 HOH 8 108 85 HOH HOH B . H 6 HOH 9 109 16 HOH HOH B . H 6 HOH 10 110 56 HOH HOH B . H 6 HOH 11 111 65 HOH HOH B . H 6 HOH 12 112 49 HOH HOH B . H 6 HOH 13 113 41 HOH HOH B . H 6 HOH 14 114 47 HOH HOH B . H 6 HOH 15 115 81 HOH HOH B . I 6 HOH 1 101 71 HOH HOH C . I 6 HOH 2 102 78 HOH HOH C . I 6 HOH 3 103 6 HOH HOH C . I 6 HOH 4 104 87 HOH HOH C . I 6 HOH 5 105 68 HOH HOH C . I 6 HOH 6 106 5 HOH HOH C . I 6 HOH 7 107 7 HOH HOH C . I 6 HOH 8 108 19 HOH HOH C . I 6 HOH 9 109 50 HOH HOH C . I 6 HOH 10 110 55 HOH HOH C . I 6 HOH 11 111 34 HOH HOH C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5180 ? 1 MORE -63 ? 1 'SSA (A^2)' 18480 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A SER 118 ? A SER 118 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OG ? A SER 118 ? A SER 118 ? 1_555 76.3 ? 2 O ? A SER 118 ? A SER 118 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? A VAL 123 ? A VAL 123 ? 1_555 87.6 ? 3 OG ? A SER 118 ? A SER 118 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? A VAL 123 ? A VAL 123 ? 1_555 97.9 ? 4 O ? A SER 118 ? A SER 118 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? G HOH . ? A HOH 509 ? 1_555 62.2 ? 5 OG ? A SER 118 ? A SER 118 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? G HOH . ? A HOH 509 ? 1_555 137.4 ? 6 O ? A VAL 123 ? A VAL 123 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? G HOH . ? A HOH 509 ? 1_555 72.5 ? 7 O ? A SER 118 ? A SER 118 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? G HOH . ? A HOH 529 ? 1_555 152.3 ? 8 OG ? A SER 118 ? A SER 118 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? G HOH . ? A HOH 529 ? 1_555 76.3 ? 9 O ? A VAL 123 ? A VAL 123 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? G HOH . ? A HOH 529 ? 1_555 99.7 ? 10 O ? G HOH . ? A HOH 509 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? G HOH . ? A HOH 529 ? 1_555 145.5 ? 11 O ? A SER 118 ? A SER 118 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? I HOH . ? C HOH 102 ? 1_555 139.3 ? 12 OG ? A SER 118 ? A SER 118 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? I HOH . ? C HOH 102 ? 1_555 144.0 ? 13 O ? A VAL 123 ? A VAL 123 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? I HOH . ? C HOH 102 ? 1_555 90.8 ? 14 O ? G HOH . ? A HOH 509 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? I HOH . ? C HOH 102 ? 1_555 78.6 ? 15 O ? G HOH . ? A HOH 529 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? I HOH . ? C HOH 102 ? 1_555 67.8 ? 16 SG ? A CYS 205 ? A CYS 205 ? 1_555 FE2 ? D SF4 . ? A SF4 401 ? 1_555 S1 ? D SF4 . ? A SF4 401 ? 1_555 116.3 ? 17 SG ? A CYS 205 ? A CYS 205 ? 1_555 FE2 ? D SF4 . ? A SF4 401 ? 1_555 S3 ? D SF4 . ? A SF4 401 ? 1_555 149.5 ? 18 S1 ? D SF4 . ? A SF4 401 ? 1_555 FE2 ? D SF4 . ? A SF4 401 ? 1_555 S3 ? D SF4 . ? A SF4 401 ? 1_555 89.5 ? 19 SG ? A CYS 205 ? A CYS 205 ? 1_555 FE2 ? D SF4 . ? A SF4 401 ? 1_555 S4 ? D SF4 . ? A SF4 401 ? 1_555 102.5 ? 20 S1 ? D SF4 . ? A SF4 401 ? 1_555 FE2 ? D SF4 . ? A SF4 401 ? 1_555 S4 ? D SF4 . ? A SF4 401 ? 1_555 90.8 ? 21 S3 ? D SF4 . ? A SF4 401 ? 1_555 FE2 ? D SF4 . ? A SF4 401 ? 1_555 S4 ? D SF4 . ? A SF4 401 ? 1_555 92.5 ? 22 SG ? A CYS 208 ? A CYS 208 ? 1_555 FE1 ? D SF4 . ? A SF4 401 ? 1_555 S2 ? D SF4 . ? A SF4 401 ? 1_555 132.2 ? 23 SG ? A CYS 208 ? A CYS 208 ? 1_555 FE1 ? D SF4 . ? A SF4 401 ? 1_555 S3 ? D SF4 . ? A SF4 401 ? 1_555 104.7 ? 24 S2 ? D SF4 . ? A SF4 401 ? 1_555 FE1 ? D SF4 . ? A SF4 401 ? 1_555 S3 ? D SF4 . ? A SF4 401 ? 1_555 92.9 ? 25 SG ? A CYS 208 ? A CYS 208 ? 1_555 FE1 ? D SF4 . ? A SF4 401 ? 1_555 S4 ? D SF4 . ? A SF4 401 ? 1_555 131.2 ? 26 S2 ? D SF4 . ? A SF4 401 ? 1_555 FE1 ? D SF4 . ? A SF4 401 ? 1_555 S4 ? D SF4 . ? A SF4 401 ? 1_555 90.9 ? 27 S3 ? D SF4 . ? A SF4 401 ? 1_555 FE1 ? D SF4 . ? A SF4 401 ? 1_555 S4 ? D SF4 . ? A SF4 401 ? 1_555 92.5 ? 28 SG ? A CYS 214 ? A CYS 214 ? 1_555 FE4 ? D SF4 . ? A SF4 401 ? 1_555 S1 ? D SF4 . ? A SF4 401 ? 1_555 81.9 ? 29 SG ? A CYS 214 ? A CYS 214 ? 1_555 FE4 ? D SF4 . ? A SF4 401 ? 1_555 S2 ? D SF4 . ? A SF4 401 ? 1_555 163.7 ? 30 S1 ? D SF4 . ? A SF4 401 ? 1_555 FE4 ? D SF4 . ? A SF4 401 ? 1_555 S2 ? D SF4 . ? A SF4 401 ? 1_555 90.6 ? 31 SG ? A CYS 214 ? A CYS 214 ? 1_555 FE4 ? D SF4 . ? A SF4 401 ? 1_555 S3 ? D SF4 . ? A SF4 401 ? 1_555 101.5 ? 32 S1 ? D SF4 . ? A SF4 401 ? 1_555 FE4 ? D SF4 . ? A SF4 401 ? 1_555 S3 ? D SF4 . ? A SF4 401 ? 1_555 89.1 ? 33 S2 ? D SF4 . ? A SF4 401 ? 1_555 FE4 ? D SF4 . ? A SF4 401 ? 1_555 S3 ? D SF4 . ? A SF4 401 ? 1_555 92.8 ? 34 OD2 ? A ASP 257 ? A ASP 257 ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 O ? A THR 259 ? A THR 259 ? 1_555 83.6 ? 35 OD2 ? A ASP 257 ? A ASP 257 ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 OG1 ? A THR 259 ? A THR 259 ? 1_555 88.0 ? 36 O ? A THR 259 ? A THR 259 ? 1_555 CA ? F CA . ? A CA 403 ? 1_555 OG1 ? A THR 259 ? A THR 259 ? 1_555 70.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-23 2 'Structure model' 1 1 2015-12-16 3 'Structure model' 1 2 2015-12-30 4 'Structure model' 1 3 2016-02-10 5 'Structure model' 1 4 2017-09-13 6 'Structure model' 1 5 2019-10-02 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 6 'Structure model' repository Obsolete ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Author supporting evidence' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 6 'Structure model' Advisory 8 6 'Structure model' 'Data collection' 9 6 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' citation 2 5 'Structure model' pdbx_audit_support 3 5 'Structure model' pdbx_struct_oper_list 4 6 'Structure model' pdbx_database_PDB_obs_spr 5 6 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_citation.journal_id_CSD' 2 5 'Structure model' '_pdbx_audit_support.funding_organization' 3 5 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 6 'Structure model' '_pdbx_database_status.status_code' 5 6 'Structure model' '_pdbx_database_status.status_code_sf' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10pre_2119 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.compound_details ? _pdbx_entry_details.entry_id 5DPK _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.source_details 'Authors assert sequence is correct.' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH21 A ARG 15 ? ? OD1 A ASP 19 ? ? 1.36 2 1 O A ARG 175 ? ? HH A TYR 180 ? ? 1.54 3 1 OD2 A ASP 159 ? ? HH22 A ARG 169 ? ? 1.58 4 1 NH1 A ARG 353 ? ? O A HOH 501 ? ? 2.12 5 1 OP1 C DT 14 ? ? O C HOH 101 ? ? 2.14 6 1 N7 B DA 1 ? ? O B HOH 101 ? ? 2.19 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 "O3'" _pdbx_validate_rmsd_bond.auth_asym_id_1 C _pdbx_validate_rmsd_bond.auth_comp_id_1 DC _pdbx_validate_rmsd_bond.auth_seq_id_1 16 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 "C3'" _pdbx_validate_rmsd_bond.auth_asym_id_2 C _pdbx_validate_rmsd_bond.auth_comp_id_2 DC _pdbx_validate_rmsd_bond.auth_seq_id_2 16 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.374 _pdbx_validate_rmsd_bond.bond_target_value 1.419 _pdbx_validate_rmsd_bond.bond_deviation -0.045 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.006 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 "O4'" _pdbx_validate_rmsd_angle.auth_asym_id_1 C _pdbx_validate_rmsd_angle.auth_comp_id_1 DC _pdbx_validate_rmsd_angle.auth_seq_id_1 16 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 "C1'" _pdbx_validate_rmsd_angle.auth_asym_id_2 C _pdbx_validate_rmsd_angle.auth_comp_id_2 DC _pdbx_validate_rmsd_angle.auth_seq_id_2 16 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 N1 _pdbx_validate_rmsd_angle.auth_asym_id_3 C _pdbx_validate_rmsd_angle.auth_comp_id_3 DC _pdbx_validate_rmsd_angle.auth_seq_id_3 16 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 110.21 _pdbx_validate_rmsd_angle.angle_target_value 108.30 _pdbx_validate_rmsd_angle.angle_deviation 1.91 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 34 ? ? -99.43 42.46 2 1 TYR A 88 ? ? 39.70 68.57 3 1 PRO A 139 ? ? -83.40 49.47 4 1 VAL A 197 ? ? -105.35 -75.26 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 7 ? CG ? A ARG 7 CG 2 1 Y 1 A ARG 7 ? CD ? A ARG 7 CD 3 1 Y 1 A ARG 7 ? NE ? A ARG 7 NE 4 1 Y 1 A ARG 7 ? CZ ? A ARG 7 CZ 5 1 Y 1 A ARG 7 ? NH1 ? A ARG 7 NH1 6 1 Y 1 A ARG 7 ? NH2 ? A ARG 7 NH2 7 1 Y 1 A GLU 52 ? CG ? A GLU 52 CG 8 1 Y 1 A GLU 52 ? CD ? A GLU 52 CD 9 1 Y 1 A GLU 52 ? OE1 ? A GLU 52 OE1 10 1 Y 1 A GLU 52 ? OE2 ? A GLU 52 OE2 11 1 Y 1 A LYS 103 ? CE ? A LYS 103 CE 12 1 Y 1 A LYS 103 ? NZ ? A LYS 103 NZ 13 1 Y 1 A GLU 116 ? CG ? A GLU 116 CG 14 1 Y 1 A GLU 116 ? CD ? A GLU 116 CD 15 1 Y 1 A GLU 116 ? OE1 ? A GLU 116 OE1 16 1 Y 1 A GLU 116 ? OE2 ? A GLU 116 OE2 17 1 Y 1 A ARG 202 ? CG ? A ARG 202 CG 18 1 Y 1 A ARG 202 ? CD ? A ARG 202 CD 19 1 Y 1 A ARG 202 ? NE ? A ARG 202 NE 20 1 Y 1 A ARG 202 ? CZ ? A ARG 202 CZ 21 1 Y 1 A ARG 202 ? NH1 ? A ARG 202 NH1 22 1 Y 1 A ARG 202 ? NH2 ? A ARG 202 NH2 23 1 Y 1 A LYS 228 ? CG ? A LYS 228 CG 24 1 Y 1 A LYS 228 ? CD ? A LYS 228 CD 25 1 Y 1 A LYS 228 ? CE ? A LYS 228 CE 26 1 Y 1 A LYS 228 ? NZ ? A LYS 228 NZ 27 1 Y 1 A LYS 231 ? CG ? A LYS 231 CG 28 1 Y 1 A LYS 231 ? CD ? A LYS 231 CD 29 1 Y 1 A LYS 231 ? CE ? A LYS 231 CE 30 1 Y 1 A LYS 231 ? NZ ? A LYS 231 NZ 31 1 Y 1 A ASP 277 ? CG ? A ASP 277 CG 32 1 Y 1 A ASP 277 ? OD1 ? A ASP 277 OD1 33 1 Y 1 A ASP 277 ? OD2 ? A ASP 277 OD2 34 1 Y 1 A LYS 279 ? CG ? A LYS 279 CG 35 1 Y 1 A LYS 279 ? CD ? A LYS 279 CD 36 1 Y 1 A LYS 279 ? CE ? A LYS 279 CE 37 1 Y 1 A LYS 279 ? NZ ? A LYS 279 NZ 38 1 Y 1 A GLN 289 ? CG ? A GLN 289 CG 39 1 Y 1 A GLN 289 ? CD ? A GLN 289 CD 40 1 Y 1 A GLN 289 ? OE1 ? A GLN 289 OE1 41 1 Y 1 A GLN 289 ? NE2 ? A GLN 289 NE2 42 1 Y 1 A GLU 295 ? CG ? A GLU 295 CG 43 1 Y 1 A GLU 295 ? CD ? A GLU 295 CD 44 1 Y 1 A GLU 295 ? OE1 ? A GLU 295 OE1 45 1 Y 1 A GLU 295 ? OE2 ? A GLU 295 OE2 46 1 Y 1 A GLU 298 ? CD ? A GLU 298 CD 47 1 Y 1 A GLU 298 ? OE1 ? A GLU 298 OE1 48 1 Y 1 A GLU 298 ? OE2 ? A GLU 298 OE2 49 1 Y 1 A ARG 320 ? CG ? A ARG 320 CG 50 1 Y 1 A ARG 320 ? CD ? A ARG 320 CD 51 1 Y 1 A ARG 320 ? NE ? A ARG 320 NE 52 1 Y 1 A ARG 320 ? CZ ? A ARG 320 CZ 53 1 Y 1 A ARG 320 ? NH1 ? A ARG 320 NH1 54 1 Y 1 A ARG 320 ? NH2 ? A ARG 320 NH2 55 1 Y 1 A GLU 328 ? CG ? A GLU 328 CG 56 1 Y 1 A GLU 328 ? CD ? A GLU 328 CD 57 1 Y 1 A GLU 328 ? OE1 ? A GLU 328 OE1 58 1 Y 1 A GLU 328 ? OE2 ? A GLU 328 OE2 59 1 Y 1 A GLU 329 ? CG ? A GLU 329 CG 60 1 Y 1 A GLU 329 ? CD ? A GLU 329 CD 61 1 Y 1 A GLU 329 ? OE1 ? A GLU 329 OE1 62 1 Y 1 A GLU 329 ? OE2 ? A GLU 329 OE2 63 1 Y 1 A ASP 337 ? CG ? A ASP 337 CG 64 1 Y 1 A ASP 337 ? OD1 ? A ASP 337 OD1 65 1 Y 1 A ASP 337 ? OD2 ? A ASP 337 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A TYR 290 ? A TYR 290 8 1 Y 1 A GLY 291 ? A GLY 291 9 1 Y 1 A LEU 292 ? A LEU 292 10 1 Y 1 A GLN 293 ? A GLN 293 11 1 Y 1 A VAL 294 ? A VAL 294 12 1 Y 1 A GLY 361 ? A GLY 361 13 1 Y 1 A VAL 362 ? A VAL 362 14 1 Y 1 A ARG 363 ? A ARG 363 15 1 Y 1 A PRO 364 ? A PRO 364 16 1 Y 1 A PRO 365 ? A PRO 365 17 1 Y 1 A PRO 366 ? A PRO 366 18 1 Y 1 C DT 12 ? C DT 1 # loop_ _ndb_struct_conf_na.entry_id _ndb_struct_conf_na.feature 5DPK 'double helix' 5DPK 'b-form double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 B DA 2 1_555 C DT 11 1_555 0.365 -0.259 -0.197 -0.366 -5.122 3.482 1 B_DA2:DT22_C B 2 ? C 22 ? 20 1 1 B DG 3 1_555 C DC 10 1_555 -0.353 -0.141 0.058 4.472 -7.862 1.756 2 B_DG3:DC21_C B 3 ? C 21 ? 19 1 1 B DA 4 1_555 C DT 9 1_555 0.428 -0.088 0.217 2.394 -5.474 3.980 3 B_DA4:DT20_C B 4 ? C 20 ? 20 1 1 B DC 5 1_555 C DG 8 1_555 0.224 -0.046 -0.484 19.112 0.491 0.411 4 B_DC5:DG19_C B 5 ? C 19 ? 19 1 1 B DT 7 1_555 C DA 6 1_555 -0.399 -0.062 0.158 -10.550 -11.851 4.082 5 B_DT7:DA17_C B 7 ? C 17 ? 20 1 1 B DG 8 1_555 C DC 5 1_555 -0.154 -0.050 -0.409 -6.603 -0.147 2.976 6 B_DG8:DC16_C B 8 ? C 16 ? 19 1 1 B DG 9 1_555 C DC 4 1_555 0.196 -0.004 -0.378 -2.084 -2.694 6.684 7 B_DG9:DC15_C B 9 ? C 15 ? 19 1 1 B DA 10 1_555 C DT 3 1_555 0.382 0.003 0.029 2.801 -3.570 9.252 8 B_DA10:DT14_C B 10 ? C 14 ? 20 1 1 B DC 11 1_555 C DG 2 1_555 0.045 0.132 -0.254 18.356 -7.190 1.134 9 B_DC11:DG13_C B 11 ? C 13 ? 19 1 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 B DA 2 1_555 C DT 11 1_555 B DG 3 1_555 C DC 10 1_555 -0.729 0.182 3.167 -4.839 1.279 32.200 0.104 0.468 3.244 2.289 8.660 32.577 1 BB_DA2DG3:DC21DT22_CC B 2 ? C 22 ? B 3 ? C 21 ? 1 B DG 3 1_555 C DC 10 1_555 B DA 4 1_555 C DT 9 1_555 0.214 -0.271 3.308 -2.513 1.547 39.413 -0.585 -0.614 3.276 2.289 3.720 39.519 2 BB_DG3DA4:DT20DC21_CC B 3 ? C 21 ? B 4 ? C 20 ? 1 B DA 4 1_555 C DT 9 1_555 B DC 5 1_555 C DG 8 1_555 0.703 -0.651 3.007 4.532 3.665 25.246 -2.391 -0.408 2.963 8.245 -10.196 25.900 3 BB_DA4DC5:DG19DT20_CC B 4 ? C 20 ? B 5 ? C 19 ? 1 B DT 7 1_555 C DA 6 1_555 B DG 8 1_555 C DC 5 1_555 0.643 0.494 3.296 4.164 3.484 37.326 0.302 -0.442 3.376 5.408 -6.465 37.704 4 BB_DT7DG8:DC16DA17_CC B 7 ? C 17 ? B 8 ? C 16 ? 1 B DG 8 1_555 C DC 5 1_555 B DG 9 1_555 C DC 4 1_555 -0.836 -0.171 3.232 -2.560 7.153 32.277 -1.496 1.039 3.177 12.649 4.527 33.136 5 BB_DG8DG9:DC15DC16_CC B 8 ? C 16 ? B 9 ? C 15 ? 1 B DG 9 1_555 C DC 4 1_555 B DA 10 1_555 C DT 3 1_555 -0.040 -0.172 3.215 -3.945 1.750 32.781 -0.593 -0.585 3.185 3.085 6.953 33.056 6 BB_DG9DA10:DT14DC15_CC B 9 ? C 15 ? B 10 ? C 14 ? 1 B DA 10 1_555 C DT 3 1_555 B DC 11 1_555 C DG 2 1_555 0.513 -0.877 3.027 1.031 -4.119 31.342 -0.889 -0.762 3.129 -7.580 -1.897 31.621 7 BB_DA10DC11:DG13DT14_CC B 10 ? C 14 ? B 11 ? C 13 ? # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Cancer Institute' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number CA067985 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 'IRON/SULFUR CLUSTER' SF4 5 'CALCIUM ION' CA 6 water HOH #