data_5DR9 # _entry.id 5DR9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5DR9 WWPDB D_1000213509 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DR9 _pdbx_database_status.recvd_initial_deposition_date 2015-09-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Janecek, M.' 1 'Rossmann, M.' 2 'Sharma, P.' 3 'Emery, A.' 4 'McKenzie, G.J.' 5 'Huggins, D.J.' 6 'Stockwell, S.' 7 'Stokes, J.A.' 8 'Almeida, E.G.' 9 'Hardwick, B.' 10 'Narvaez, A.J.' 11 'Hyvonen, M.' 12 'Spring, D.R.' 13 'Venkitaraman, A.R.' 14 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 28528 _citation.page_last 28528 _citation.title 'Allosteric modulation of AURKA kinase activity by a small-molecule inhibitor of its protein-protein interaction with TPX2.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/srep28528 _citation.pdbx_database_id_PubMed 27339427 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Janecek, M.' 1 primary 'Rossmann, M.' 2 primary 'Sharma, P.' 3 primary 'Emery, A.' 4 primary 'Huggins, D.J.' 5 primary 'Stockwell, S.R.' 6 primary 'Stokes, J.E.' 7 primary 'Tan, Y.S.' 8 primary 'Almeida, E.G.' 9 primary 'Hardwick, B.' 10 primary 'Narvaez, A.J.' 11 primary 'Hyvonen, M.' 12 primary 'Spring, D.R.' 13 primary 'McKenzie, G.J.' 14 primary 'Venkitaraman, A.R.' 15 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5DR9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.425 _cell.length_a_esd ? _cell.length_b 83.425 _cell.length_b_esd ? _cell.length_c 167.246 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DR9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aurora kinase A' 31807.529 1 2.7.11.1 ? 'UNP residues 126-390' ? 2 non-polymer syn '4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1H-1,2,4-triazol-3-yl}amino)benzenesulfonamide' 394.356 1 ? ? ? ? 3 non-polymer syn '2-(3-bromophenyl)-6-chloroquinoline-4-carboxylic acid' 362.605 1 ? ? ? ? 4 water nat water 18.015 18 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora 2,Aurora/IPL1-related kinase 1,hARK1,Breast tumor-amplified kinase,Serine/threonine-protein kinase 15,Serine/threonine-protein kinase 6,Serine/threonine-protein kinase aurora-A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDA TRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPS SRRATLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRL LKHNPSQRPMLREVLEHPWITANSSKPHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDA TRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPS SRRATLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRL LKHNPSQRPMLREVLEHPWITANSSKPHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ARG n 1 4 GLN n 1 5 TRP n 1 6 ALA n 1 7 LEU n 1 8 GLU n 1 9 ASP n 1 10 PHE n 1 11 GLU n 1 12 ILE n 1 13 GLY n 1 14 ARG n 1 15 PRO n 1 16 LEU n 1 17 GLY n 1 18 LYS n 1 19 GLY n 1 20 LYS n 1 21 PHE n 1 22 GLY n 1 23 ASN n 1 24 VAL n 1 25 TYR n 1 26 LEU n 1 27 ALA n 1 28 ARG n 1 29 GLU n 1 30 LYS n 1 31 GLN n 1 32 SER n 1 33 LYS n 1 34 PHE n 1 35 ILE n 1 36 LEU n 1 37 ALA n 1 38 LEU n 1 39 LYS n 1 40 VAL n 1 41 LEU n 1 42 PHE n 1 43 LYS n 1 44 ALA n 1 45 GLN n 1 46 LEU n 1 47 GLU n 1 48 LYS n 1 49 ALA n 1 50 GLY n 1 51 VAL n 1 52 GLU n 1 53 HIS n 1 54 GLN n 1 55 LEU n 1 56 ARG n 1 57 ARG n 1 58 GLU n 1 59 VAL n 1 60 GLU n 1 61 ILE n 1 62 GLN n 1 63 SER n 1 64 HIS n 1 65 LEU n 1 66 ARG n 1 67 HIS n 1 68 PRO n 1 69 ASN n 1 70 ILE n 1 71 LEU n 1 72 ARG n 1 73 LEU n 1 74 TYR n 1 75 GLY n 1 76 TYR n 1 77 PHE n 1 78 HIS n 1 79 ASP n 1 80 ALA n 1 81 THR n 1 82 ARG n 1 83 VAL n 1 84 TYR n 1 85 LEU n 1 86 ILE n 1 87 LEU n 1 88 GLU n 1 89 TYR n 1 90 ALA n 1 91 PRO n 1 92 LEU n 1 93 GLY n 1 94 THR n 1 95 VAL n 1 96 TYR n 1 97 ARG n 1 98 GLU n 1 99 LEU n 1 100 GLN n 1 101 LYS n 1 102 LEU n 1 103 SER n 1 104 LYS n 1 105 PHE n 1 106 ASP n 1 107 GLU n 1 108 GLN n 1 109 ARG n 1 110 THR n 1 111 ALA n 1 112 THR n 1 113 TYR n 1 114 ILE n 1 115 THR n 1 116 GLU n 1 117 LEU n 1 118 ALA n 1 119 ASN n 1 120 ALA n 1 121 LEU n 1 122 SER n 1 123 TYR n 1 124 CYS n 1 125 HIS n 1 126 SER n 1 127 LYS n 1 128 ARG n 1 129 VAL n 1 130 ILE n 1 131 HIS n 1 132 ARG n 1 133 ASP n 1 134 ILE n 1 135 LYS n 1 136 PRO n 1 137 GLU n 1 138 ASN n 1 139 LEU n 1 140 LEU n 1 141 LEU n 1 142 GLY n 1 143 SER n 1 144 ALA n 1 145 GLY n 1 146 GLU n 1 147 LEU n 1 148 LYS n 1 149 ILE n 1 150 ALA n 1 151 ASP n 1 152 PHE n 1 153 GLY n 1 154 TRP n 1 155 SER n 1 156 VAL n 1 157 HIS n 1 158 ALA n 1 159 PRO n 1 160 SER n 1 161 SER n 1 162 ARG n 1 163 ARG n 1 164 ALA n 1 165 THR n 1 166 LEU n 1 167 CYS n 1 168 GLY n 1 169 THR n 1 170 LEU n 1 171 ASP n 1 172 TYR n 1 173 LEU n 1 174 PRO n 1 175 PRO n 1 176 GLU n 1 177 MET n 1 178 ILE n 1 179 GLU n 1 180 GLY n 1 181 ARG n 1 182 MET n 1 183 HIS n 1 184 ASP n 1 185 GLU n 1 186 LYS n 1 187 VAL n 1 188 ASP n 1 189 LEU n 1 190 TRP n 1 191 SER n 1 192 LEU n 1 193 GLY n 1 194 VAL n 1 195 LEU n 1 196 CYS n 1 197 TYR n 1 198 GLU n 1 199 PHE n 1 200 LEU n 1 201 VAL n 1 202 GLY n 1 203 LYS n 1 204 PRO n 1 205 PRO n 1 206 PHE n 1 207 GLU n 1 208 ALA n 1 209 ASN n 1 210 THR n 1 211 TYR n 1 212 GLN n 1 213 GLU n 1 214 THR n 1 215 TYR n 1 216 LYS n 1 217 ARG n 1 218 ILE n 1 219 SER n 1 220 ARG n 1 221 VAL n 1 222 GLU n 1 223 PHE n 1 224 THR n 1 225 PHE n 1 226 PRO n 1 227 ASP n 1 228 PHE n 1 229 VAL n 1 230 THR n 1 231 GLU n 1 232 GLY n 1 233 ALA n 1 234 ARG n 1 235 ASP n 1 236 LEU n 1 237 ILE n 1 238 SER n 1 239 ARG n 1 240 LEU n 1 241 LEU n 1 242 LYS n 1 243 HIS n 1 244 ASN n 1 245 PRO n 1 246 SER n 1 247 GLN n 1 248 ARG n 1 249 PRO n 1 250 MET n 1 251 LEU n 1 252 ARG n 1 253 GLU n 1 254 VAL n 1 255 LEU n 1 256 GLU n 1 257 HIS n 1 258 PRO n 1 259 TRP n 1 260 ILE n 1 261 THR n 1 262 ALA n 1 263 ASN n 1 264 SER n 1 265 SER n 1 266 LYS n 1 267 PRO n 1 268 HIS n 1 269 HIS n 1 270 HIS n 1 271 HIS n 1 272 HIS n 1 273 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 273 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant pUBS520 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details 'Expresses lambda phosphatase' _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBAT4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AURKA_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATR VYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSR RTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLK HNPSQRPMLREVLEHPWITANSSKP ; _struct_ref.pdbx_align_begin 126 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5DR9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 267 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 126 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 390 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 126 _struct_ref_seq.pdbx_auth_seq_align_end 390 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5DR9 MET A 1 ? UNP O14965 ? ? 'initiating methionine' 124 1 1 5DR9 GLY A 2 ? UNP O14965 ? ? 'expression tag' 125 2 1 5DR9 ALA A 164 ? UNP O14965 THR 287 'engineered mutation' 287 3 1 5DR9 HIS A 268 ? UNP O14965 ? ? 'expression tag' 391 4 1 5DR9 HIS A 269 ? UNP O14965 ? ? 'expression tag' 392 5 1 5DR9 HIS A 270 ? UNP O14965 ? ? 'expression tag' 393 6 1 5DR9 HIS A 271 ? UNP O14965 ? ? 'expression tag' 394 7 1 5DR9 HIS A 272 ? UNP O14965 ? ? 'expression tag' 395 8 1 5DR9 HIS A 273 ? UNP O14965 ? ? 'expression tag' 396 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 5E2 non-polymer . '2-(3-bromophenyl)-6-chloroquinoline-4-carboxylic acid' ? 'C16 H9 Br Cl N O2' 362.605 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SKE non-polymer . '4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1H-1,2,4-triazol-3-yl}amino)benzenesulfonamide' ? 'C15 H12 F2 N6 O3 S' 394.356 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DR9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.81 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM HEPES pH 7.4, 200 mM magnesium sulfate, 2-20% PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-05-22 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.918400 1.0 2 0.9184 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5DR9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.467 _reflns.d_resolution_low 72.25 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13121 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.5 _reflns.pdbx_Rmerge_I_obs 0.059 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.059 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.467 _reflns_shell.d_res_low 2.475 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.559 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 20.2 _reflns_shell.pdbx_Rsym_value 1.559 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.20 _refine.aniso_B[1][2] -0.10 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.20 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.66 _refine.B_iso_max ? _refine.B_iso_mean 92.920 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.947 _refine.correlation_coeff_Fo_to_Fc_free 0.940 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DR9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.47 _refine.ls_d_res_low 72.25 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12344 _refine.ls_number_reflns_R_free 669 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.00 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.22670 _refine.ls_R_factor_R_free 0.26240 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22482 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.436 _refine.pdbx_overall_ESU_R_Free 0.277 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 8.226 _refine.overall_SU_ML 0.193 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2108 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 2174 _refine_hist.d_res_high 2.47 _refine_hist.d_res_low 72.25 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.017 0.019 2214 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 2106 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.980 1.991 2998 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.148 3.000 4835 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.121 5.000 255 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.821 22.952 105 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.902 15.000 383 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.355 15.000 18 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.110 0.200 314 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.021 2564 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 542 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 8.784 8.843 1027 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 8.777 8.835 1025 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 10.967 13.238 1280 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 10.964 13.242 1281 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 9.374 9.621 1185 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 9.371 9.621 1186 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 13.029 14.123 1719 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 16.453 83.977 8972 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 16.449 83.967 8968 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.470 _refine_ls_shell.d_res_low 2.534 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.number_reflns_R_work 899 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.378 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.211 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5DR9 _struct.title 'Aurora A Kinase in Complex with AA29 and JNJ-7706621 in Space Group P6122' _struct.pdbx_descriptor 'Aurora kinase A (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DR9 _struct_keywords.text 'Aurora A kinase, mitotic kinase, PPI, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 6 ? GLU A 8 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 AA2 LYS A 43 ? ALA A 49 ? LYS A 166 ALA A 172 1 ? 7 HELX_P HELX_P3 AA3 VAL A 51 ? LEU A 65 ? VAL A 174 LEU A 188 1 ? 15 HELX_P HELX_P4 AA4 THR A 94 ? SER A 103 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P5 AA5 ASP A 106 ? SER A 126 ? ASP A 229 SER A 249 1 ? 21 HELX_P HELX_P6 AA6 LYS A 135 ? GLU A 137 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P7 AA7 PRO A 174 ? GLU A 179 ? PRO A 297 GLU A 302 1 ? 6 HELX_P HELX_P8 AA8 GLU A 185 ? GLY A 202 ? GLU A 308 GLY A 325 1 ? 18 HELX_P HELX_P9 AA9 THR A 210 ? VAL A 221 ? THR A 333 VAL A 344 1 ? 12 HELX_P HELX_P10 AB1 THR A 230 ? LEU A 241 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P11 AB2 MET A 250 ? GLU A 256 ? MET A 373 GLU A 379 1 ? 7 HELX_P HELX_P12 AB3 HIS A 257 ? SER A 264 ? HIS A 380 SER A 387 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 19 A . ? GLY 142 A LYS 20 A ? LYS 143 A 1 13.21 2 ALA 158 A . ? ALA 281 A PRO 159 A ? PRO 282 A 1 1.41 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 10 ? GLY A 17 ? PHE A 133 GLY A 140 AA1 2 GLY A 22 ? GLU A 29 ? GLY A 145 GLU A 152 AA1 3 ILE A 35 ? PHE A 42 ? ILE A 158 PHE A 165 AA1 4 ARG A 82 ? LEU A 87 ? ARG A 205 LEU A 210 AA1 5 LEU A 73 ? HIS A 78 ? LEU A 196 HIS A 201 AA2 1 LEU A 139 ? LEU A 141 ? LEU A 262 LEU A 264 AA2 2 LEU A 147 ? ILE A 149 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 13 ? N GLY A 136 O LEU A 26 ? O LEU A 149 AA1 2 3 N TYR A 25 ? N TYR A 148 O LEU A 38 ? O LEU A 161 AA1 3 4 N LEU A 41 ? N LEU A 164 O VAL A 83 ? O VAL A 206 AA1 4 5 O ILE A 86 ? O ILE A 209 N GLY A 75 ? N GLY A 198 AA2 1 2 N LEU A 140 ? N LEU A 263 O LYS A 148 ? O LYS A 271 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SKE 401 ? 11 'binding site for residue SKE A 401' AC2 Software A 5E2 402 ? 9 'binding site for residue 5E2 A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 ARG A 14 ? ARG A 137 . ? 1_555 ? 2 AC1 11 LEU A 16 ? LEU A 139 . ? 1_555 ? 3 AC1 11 VAL A 24 ? VAL A 147 . ? 1_555 ? 4 AC1 11 ALA A 37 ? ALA A 160 . ? 1_555 ? 5 AC1 11 LEU A 87 ? LEU A 210 . ? 1_555 ? 6 AC1 11 GLU A 88 ? GLU A 211 . ? 1_555 ? 7 AC1 11 ALA A 90 ? ALA A 213 . ? 1_555 ? 8 AC1 11 GLY A 93 ? GLY A 216 . ? 1_555 ? 9 AC1 11 ARG A 97 ? ARG A 220 . ? 1_555 ? 10 AC1 11 GLU A 137 ? GLU A 260 . ? 1_555 ? 11 AC1 11 LEU A 140 ? LEU A 263 . ? 1_555 ? 12 AC2 9 LYS A 43 ? LYS A 166 . ? 1_555 ? 13 AC2 9 GLU A 47 ? GLU A 170 . ? 1_555 ? 14 AC2 9 GLU A 52 ? GLU A 175 . ? 1_555 ? 15 AC2 9 LEU A 55 ? LEU A 178 . ? 1_555 ? 16 AC2 9 ARG A 56 ? ARG A 179 . ? 1_555 ? 17 AC2 9 VAL A 59 ? VAL A 182 . ? 1_555 ? 18 AC2 9 TYR A 76 ? TYR A 199 . ? 1_555 ? 19 AC2 9 HIS A 78 ? HIS A 201 . ? 1_555 ? 20 AC2 9 VAL A 83 ? VAL A 206 . ? 1_555 ? # _atom_sites.entry_id 5DR9 _atom_sites.fract_transf_matrix[1][1] 0.011987 _atom_sites.fract_transf_matrix[1][2] 0.006921 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013841 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005979 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol BR C CL F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 124 ? ? ? A . n A 1 2 GLY 2 125 ? ? ? A . n A 1 3 ARG 3 126 ? ? ? A . n A 1 4 GLN 4 127 127 GLN GLN A . n A 1 5 TRP 5 128 128 TRP TRP A . n A 1 6 ALA 6 129 129 ALA ALA A . n A 1 7 LEU 7 130 130 LEU LEU A . n A 1 8 GLU 8 131 131 GLU GLU A . n A 1 9 ASP 9 132 132 ASP ASP A . n A 1 10 PHE 10 133 133 PHE PHE A . n A 1 11 GLU 11 134 134 GLU GLU A . n A 1 12 ILE 12 135 135 ILE ILE A . n A 1 13 GLY 13 136 136 GLY GLY A . n A 1 14 ARG 14 137 137 ARG ARG A . n A 1 15 PRO 15 138 138 PRO PRO A . n A 1 16 LEU 16 139 139 LEU LEU A . n A 1 17 GLY 17 140 140 GLY GLY A . n A 1 18 LYS 18 141 141 LYS LYS A . n A 1 19 GLY 19 142 142 GLY GLY A . n A 1 20 LYS 20 143 143 LYS LYS A . n A 1 21 PHE 21 144 144 PHE PHE A . n A 1 22 GLY 22 145 145 GLY GLY A . n A 1 23 ASN 23 146 146 ASN ASN A . n A 1 24 VAL 24 147 147 VAL VAL A . n A 1 25 TYR 25 148 148 TYR TYR A . n A 1 26 LEU 26 149 149 LEU LEU A . n A 1 27 ALA 27 150 150 ALA ALA A . n A 1 28 ARG 28 151 151 ARG ARG A . n A 1 29 GLU 29 152 152 GLU GLU A . n A 1 30 LYS 30 153 153 LYS LYS A . n A 1 31 GLN 31 154 154 GLN GLN A . n A 1 32 SER 32 155 155 SER SER A . n A 1 33 LYS 33 156 156 LYS LYS A . n A 1 34 PHE 34 157 157 PHE PHE A . n A 1 35 ILE 35 158 158 ILE ILE A . n A 1 36 LEU 36 159 159 LEU LEU A . n A 1 37 ALA 37 160 160 ALA ALA A . n A 1 38 LEU 38 161 161 LEU LEU A . n A 1 39 LYS 39 162 162 LYS LYS A . n A 1 40 VAL 40 163 163 VAL VAL A . n A 1 41 LEU 41 164 164 LEU LEU A . n A 1 42 PHE 42 165 165 PHE PHE A . n A 1 43 LYS 43 166 166 LYS LYS A . n A 1 44 ALA 44 167 167 ALA ALA A . n A 1 45 GLN 45 168 168 GLN GLN A . n A 1 46 LEU 46 169 169 LEU LEU A . n A 1 47 GLU 47 170 170 GLU GLU A . n A 1 48 LYS 48 171 171 LYS LYS A . n A 1 49 ALA 49 172 172 ALA ALA A . n A 1 50 GLY 50 173 173 GLY GLY A . n A 1 51 VAL 51 174 174 VAL VAL A . n A 1 52 GLU 52 175 175 GLU GLU A . n A 1 53 HIS 53 176 176 HIS HIS A . n A 1 54 GLN 54 177 177 GLN GLN A . n A 1 55 LEU 55 178 178 LEU LEU A . n A 1 56 ARG 56 179 179 ARG ARG A . n A 1 57 ARG 57 180 180 ARG ARG A . n A 1 58 GLU 58 181 181 GLU GLU A . n A 1 59 VAL 59 182 182 VAL VAL A . n A 1 60 GLU 60 183 183 GLU GLU A . n A 1 61 ILE 61 184 184 ILE ILE A . n A 1 62 GLN 62 185 185 GLN GLN A . n A 1 63 SER 63 186 186 SER SER A . n A 1 64 HIS 64 187 187 HIS HIS A . n A 1 65 LEU 65 188 188 LEU LEU A . n A 1 66 ARG 66 189 189 ARG ARG A . n A 1 67 HIS 67 190 190 HIS HIS A . n A 1 68 PRO 68 191 191 PRO PRO A . n A 1 69 ASN 69 192 192 ASN ASN A . n A 1 70 ILE 70 193 193 ILE ILE A . n A 1 71 LEU 71 194 194 LEU LEU A . n A 1 72 ARG 72 195 195 ARG ARG A . n A 1 73 LEU 73 196 196 LEU LEU A . n A 1 74 TYR 74 197 197 TYR TYR A . n A 1 75 GLY 75 198 198 GLY GLY A . n A 1 76 TYR 76 199 199 TYR TYR A . n A 1 77 PHE 77 200 200 PHE PHE A . n A 1 78 HIS 78 201 201 HIS HIS A . n A 1 79 ASP 79 202 202 ASP ASP A . n A 1 80 ALA 80 203 203 ALA ALA A . n A 1 81 THR 81 204 204 THR THR A . n A 1 82 ARG 82 205 205 ARG ARG A . n A 1 83 VAL 83 206 206 VAL VAL A . n A 1 84 TYR 84 207 207 TYR TYR A . n A 1 85 LEU 85 208 208 LEU LEU A . n A 1 86 ILE 86 209 209 ILE ILE A . n A 1 87 LEU 87 210 210 LEU LEU A . n A 1 88 GLU 88 211 211 GLU GLU A . n A 1 89 TYR 89 212 212 TYR TYR A . n A 1 90 ALA 90 213 213 ALA ALA A . n A 1 91 PRO 91 214 214 PRO PRO A . n A 1 92 LEU 92 215 215 LEU LEU A . n A 1 93 GLY 93 216 216 GLY GLY A . n A 1 94 THR 94 217 217 THR THR A . n A 1 95 VAL 95 218 218 VAL VAL A . n A 1 96 TYR 96 219 219 TYR TYR A . n A 1 97 ARG 97 220 220 ARG ARG A . n A 1 98 GLU 98 221 221 GLU GLU A . n A 1 99 LEU 99 222 222 LEU LEU A . n A 1 100 GLN 100 223 223 GLN GLN A . n A 1 101 LYS 101 224 224 LYS LYS A . n A 1 102 LEU 102 225 225 LEU LEU A . n A 1 103 SER 103 226 226 SER SER A . n A 1 104 LYS 104 227 227 LYS LYS A . n A 1 105 PHE 105 228 228 PHE PHE A . n A 1 106 ASP 106 229 229 ASP ASP A . n A 1 107 GLU 107 230 230 GLU GLU A . n A 1 108 GLN 108 231 231 GLN GLN A . n A 1 109 ARG 109 232 232 ARG ARG A . n A 1 110 THR 110 233 233 THR THR A . n A 1 111 ALA 111 234 234 ALA ALA A . n A 1 112 THR 112 235 235 THR THR A . n A 1 113 TYR 113 236 236 TYR TYR A . n A 1 114 ILE 114 237 237 ILE ILE A . n A 1 115 THR 115 238 238 THR THR A . n A 1 116 GLU 116 239 239 GLU GLU A . n A 1 117 LEU 117 240 240 LEU LEU A . n A 1 118 ALA 118 241 241 ALA ALA A . n A 1 119 ASN 119 242 242 ASN ASN A . n A 1 120 ALA 120 243 243 ALA ALA A . n A 1 121 LEU 121 244 244 LEU LEU A . n A 1 122 SER 122 245 245 SER SER A . n A 1 123 TYR 123 246 246 TYR TYR A . n A 1 124 CYS 124 247 247 CYS CYS A . n A 1 125 HIS 125 248 248 HIS HIS A . n A 1 126 SER 126 249 249 SER SER A . n A 1 127 LYS 127 250 250 LYS LYS A . n A 1 128 ARG 128 251 251 ARG ARG A . n A 1 129 VAL 129 252 252 VAL VAL A . n A 1 130 ILE 130 253 253 ILE ILE A . n A 1 131 HIS 131 254 254 HIS HIS A . n A 1 132 ARG 132 255 255 ARG ARG A . n A 1 133 ASP 133 256 256 ASP ASP A . n A 1 134 ILE 134 257 257 ILE ILE A . n A 1 135 LYS 135 258 258 LYS LYS A . n A 1 136 PRO 136 259 259 PRO PRO A . n A 1 137 GLU 137 260 260 GLU GLU A . n A 1 138 ASN 138 261 261 ASN ASN A . n A 1 139 LEU 139 262 262 LEU LEU A . n A 1 140 LEU 140 263 263 LEU LEU A . n A 1 141 LEU 141 264 264 LEU LEU A . n A 1 142 GLY 142 265 265 GLY GLY A . n A 1 143 SER 143 266 266 SER SER A . n A 1 144 ALA 144 267 267 ALA ALA A . n A 1 145 GLY 145 268 268 GLY GLY A . n A 1 146 GLU 146 269 269 GLU GLU A . n A 1 147 LEU 147 270 270 LEU LEU A . n A 1 148 LYS 148 271 271 LYS LYS A . n A 1 149 ILE 149 272 272 ILE ILE A . n A 1 150 ALA 150 273 273 ALA ALA A . n A 1 151 ASP 151 274 274 ASP ASP A . n A 1 152 PHE 152 275 275 PHE PHE A . n A 1 153 GLY 153 276 276 GLY GLY A . n A 1 154 TRP 154 277 277 TRP TRP A . n A 1 155 SER 155 278 278 SER SER A . n A 1 156 VAL 156 279 279 VAL VAL A . n A 1 157 HIS 157 280 280 HIS HIS A . n A 1 158 ALA 158 281 281 ALA ALA A . n A 1 159 PRO 159 282 282 PRO PRO A . n A 1 160 SER 160 283 ? ? ? A . n A 1 161 SER 161 284 ? ? ? A . n A 1 162 ARG 162 285 ? ? ? A . n A 1 163 ARG 163 286 ? ? ? A . n A 1 164 ALA 164 287 ? ? ? A . n A 1 165 THR 165 288 ? ? ? A . n A 1 166 LEU 166 289 ? ? ? A . n A 1 167 CYS 167 290 290 CYS CYS A . n A 1 168 GLY 168 291 291 GLY GLY A . n A 1 169 THR 169 292 292 THR THR A . n A 1 170 LEU 170 293 293 LEU LEU A . n A 1 171 ASP 171 294 294 ASP ASP A . n A 1 172 TYR 172 295 295 TYR TYR A . n A 1 173 LEU 173 296 296 LEU LEU A . n A 1 174 PRO 174 297 297 PRO PRO A . n A 1 175 PRO 175 298 298 PRO PRO A . n A 1 176 GLU 176 299 299 GLU GLU A . n A 1 177 MET 177 300 300 MET MET A . n A 1 178 ILE 178 301 301 ILE ILE A . n A 1 179 GLU 179 302 302 GLU GLU A . n A 1 180 GLY 180 303 303 GLY GLY A . n A 1 181 ARG 181 304 304 ARG ARG A . n A 1 182 MET 182 305 305 MET MET A . n A 1 183 HIS 183 306 306 HIS HIS A . n A 1 184 ASP 184 307 307 ASP ASP A . n A 1 185 GLU 185 308 308 GLU GLU A . n A 1 186 LYS 186 309 309 LYS LYS A . n A 1 187 VAL 187 310 310 VAL VAL A . n A 1 188 ASP 188 311 311 ASP ASP A . n A 1 189 LEU 189 312 312 LEU LEU A . n A 1 190 TRP 190 313 313 TRP TRP A . n A 1 191 SER 191 314 314 SER SER A . n A 1 192 LEU 192 315 315 LEU LEU A . n A 1 193 GLY 193 316 316 GLY GLY A . n A 1 194 VAL 194 317 317 VAL VAL A . n A 1 195 LEU 195 318 318 LEU LEU A . n A 1 196 CYS 196 319 319 CYS CYS A . n A 1 197 TYR 197 320 320 TYR TYR A . n A 1 198 GLU 198 321 321 GLU GLU A . n A 1 199 PHE 199 322 322 PHE PHE A . n A 1 200 LEU 200 323 323 LEU LEU A . n A 1 201 VAL 201 324 324 VAL VAL A . n A 1 202 GLY 202 325 325 GLY GLY A . n A 1 203 LYS 203 326 326 LYS LYS A . n A 1 204 PRO 204 327 327 PRO PRO A . n A 1 205 PRO 205 328 328 PRO PRO A . n A 1 206 PHE 206 329 329 PHE PHE A . n A 1 207 GLU 207 330 330 GLU GLU A . n A 1 208 ALA 208 331 331 ALA ALA A . n A 1 209 ASN 209 332 332 ASN ASN A . n A 1 210 THR 210 333 333 THR THR A . n A 1 211 TYR 211 334 334 TYR TYR A . n A 1 212 GLN 212 335 335 GLN GLN A . n A 1 213 GLU 213 336 336 GLU GLU A . n A 1 214 THR 214 337 337 THR THR A . n A 1 215 TYR 215 338 338 TYR TYR A . n A 1 216 LYS 216 339 339 LYS LYS A . n A 1 217 ARG 217 340 340 ARG ARG A . n A 1 218 ILE 218 341 341 ILE ILE A . n A 1 219 SER 219 342 342 SER SER A . n A 1 220 ARG 220 343 343 ARG ARG A . n A 1 221 VAL 221 344 344 VAL VAL A . n A 1 222 GLU 222 345 345 GLU GLU A . n A 1 223 PHE 223 346 346 PHE PHE A . n A 1 224 THR 224 347 347 THR THR A . n A 1 225 PHE 225 348 348 PHE PHE A . n A 1 226 PRO 226 349 349 PRO PRO A . n A 1 227 ASP 227 350 350 ASP ASP A . n A 1 228 PHE 228 351 351 PHE PHE A . n A 1 229 VAL 229 352 352 VAL VAL A . n A 1 230 THR 230 353 353 THR THR A . n A 1 231 GLU 231 354 354 GLU GLU A . n A 1 232 GLY 232 355 355 GLY GLY A . n A 1 233 ALA 233 356 356 ALA ALA A . n A 1 234 ARG 234 357 357 ARG ARG A . n A 1 235 ASP 235 358 358 ASP ASP A . n A 1 236 LEU 236 359 359 LEU LEU A . n A 1 237 ILE 237 360 360 ILE ILE A . n A 1 238 SER 238 361 361 SER SER A . n A 1 239 ARG 239 362 362 ARG ARG A . n A 1 240 LEU 240 363 363 LEU LEU A . n A 1 241 LEU 241 364 364 LEU LEU A . n A 1 242 LYS 242 365 365 LYS LYS A . n A 1 243 HIS 243 366 366 HIS HIS A . n A 1 244 ASN 244 367 367 ASN ASN A . n A 1 245 PRO 245 368 368 PRO PRO A . n A 1 246 SER 246 369 369 SER SER A . n A 1 247 GLN 247 370 370 GLN GLN A . n A 1 248 ARG 248 371 371 ARG ARG A . n A 1 249 PRO 249 372 372 PRO PRO A . n A 1 250 MET 250 373 373 MET MET A . n A 1 251 LEU 251 374 374 LEU LEU A . n A 1 252 ARG 252 375 375 ARG ARG A . n A 1 253 GLU 253 376 376 GLU GLU A . n A 1 254 VAL 254 377 377 VAL VAL A . n A 1 255 LEU 255 378 378 LEU LEU A . n A 1 256 GLU 256 379 379 GLU GLU A . n A 1 257 HIS 257 380 380 HIS HIS A . n A 1 258 PRO 258 381 381 PRO PRO A . n A 1 259 TRP 259 382 382 TRP TRP A . n A 1 260 ILE 260 383 383 ILE ILE A . n A 1 261 THR 261 384 384 THR THR A . n A 1 262 ALA 262 385 385 ALA ALA A . n A 1 263 ASN 263 386 386 ASN ASN A . n A 1 264 SER 264 387 387 SER SER A . n A 1 265 SER 265 388 388 SER SER A . n A 1 266 LYS 266 389 389 LYS LYS A . n A 1 267 PRO 267 390 390 PRO PRO A . n A 1 268 HIS 268 391 ? ? ? A . n A 1 269 HIS 269 392 ? ? ? A . n A 1 270 HIS 270 393 ? ? ? A . n A 1 271 HIS 271 394 ? ? ? A . n A 1 272 HIS 272 395 ? ? ? A . n A 1 273 HIS 273 396 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SKE 1 401 1 SKE JNJ A . C 3 5E2 1 402 4000 5E2 029 A . D 4 HOH 1 501 2 HOH HOH A . D 4 HOH 2 502 14 HOH HOH A . D 4 HOH 3 503 3 HOH HOH A . D 4 HOH 4 504 1 HOH HOH A . D 4 HOH 5 505 15 HOH HOH A . D 4 HOH 6 506 10 HOH HOH A . D 4 HOH 7 507 18 HOH HOH A . D 4 HOH 8 508 9 HOH HOH A . D 4 HOH 9 509 21 HOH HOH A . D 4 HOH 10 510 12 HOH HOH A . D 4 HOH 11 511 30 HOH HOH A . D 4 HOH 12 512 22 HOH HOH A . D 4 HOH 13 513 33 HOH HOH A . D 4 HOH 14 514 8 HOH HOH A . D 4 HOH 15 515 17 HOH HOH A . D 4 HOH 16 516 24 HOH HOH A . D 4 HOH 17 517 11 HOH HOH A . D 4 HOH 18 518 34 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12700 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2016-07-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASES ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? '(VERSION March 1' 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? '(version 0.3.11)' 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0131 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? AutoPROC ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASN 367 ? ? OG A SER 369 ? ? 1.58 2 1 O A ILE 253 ? ? OG A SER 278 ? ? 1.62 3 1 OD1 A ASP 307 ? ? N A LYS 309 ? ? 2.13 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 336 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 336 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 10_444 _pdbx_validate_symm_contact.dist 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 143 ? ? 75.24 -150.40 2 1 LYS A 227 ? ? 106.39 154.45 3 1 ARG A 255 ? ? 79.45 -32.13 4 1 ALA A 273 ? ? -123.32 -163.78 5 1 TRP A 277 ? ? 89.38 5.93 6 1 GLU A 299 ? ? -59.94 -5.94 7 1 ASP A 307 ? ? -123.20 -155.31 8 1 LEU A 364 ? ? -90.66 57.29 9 1 SER A 387 ? ? -66.59 -175.28 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 124 ? A MET 1 2 1 Y 1 A GLY 125 ? A GLY 2 3 1 Y 1 A ARG 126 ? A ARG 3 4 1 Y 1 A SER 283 ? A SER 160 5 1 Y 1 A SER 284 ? A SER 161 6 1 Y 1 A ARG 285 ? A ARG 162 7 1 Y 1 A ARG 286 ? A ARG 163 8 1 Y 1 A ALA 287 ? A ALA 164 9 1 Y 1 A THR 288 ? A THR 165 10 1 Y 1 A LEU 289 ? A LEU 166 11 1 Y 1 A HIS 391 ? A HIS 268 12 1 Y 1 A HIS 392 ? A HIS 269 13 1 Y 1 A HIS 393 ? A HIS 270 14 1 Y 1 A HIS 394 ? A HIS 271 15 1 Y 1 A HIS 395 ? A HIS 272 16 1 Y 1 A HIS 396 ? A HIS 273 # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 'Strategic Award 090340/Z/09/Z' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1H-1,2,4-triazol-3-yl}amino)benzenesulfonamide' SKE 3 '2-(3-bromophenyl)-6-chloroquinoline-4-carboxylic acid' 5E2 4 water HOH #