data_5DT4 # _entry.id 5DT4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5DT4 pdb_00005dt4 10.2210/pdb5dt4/pdb WWPDB D_1000213754 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-20 2 'Structure model' 1 1 2024-01-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DT4 _pdbx_database_status.recvd_initial_deposition_date 2015-09-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Janecek, M.' 1 'Rossmann, M.' 2 'Sharma, P.' 3 'Emery, A.' 4 'McKenzie, G.J.' 5 'Huggins, D.J.' 6 'Stockwell, S.' 7 'Stokes, J.A.' 8 'Almeida, E.G.' 9 'Hardwick, B.' 10 'Narvaez, A.J.' 11 'Hyvonen, M.' 12 'Spring, D.R.' 13 'Venkitaraman, A.R.' 14 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 28528 _citation.page_last 28528 _citation.title 'Allosteric modulation of AURKA kinase activity by a small-molecule inhibitor of its protein-protein interaction with TPX2.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/srep28528 _citation.pdbx_database_id_PubMed 27339427 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Janecek, M.' 1 ? primary 'Rossmann, M.' 2 ? primary 'Sharma, P.' 3 ? primary 'Emery, A.' 4 ? primary 'Huggins, D.J.' 5 ? primary 'Stockwell, S.R.' 6 ? primary 'Stokes, J.E.' 7 ? primary 'Tan, Y.S.' 8 ? primary 'Almeida, E.G.' 9 ? primary 'Hardwick, B.' 10 ? primary 'Narvaez, A.J.' 11 ? primary 'Hyvonen, M.' 12 ? primary 'Spring, D.R.' 13 ? primary 'McKenzie, G.J.' 14 ? primary 'Venkitaraman, A.R.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aurora kinase A' 31837.553 1 2.7.11.1 ? 'UNP residues 126-390' ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn '2-(3-bromophenyl)-8-fluoroquinoline-4-carboxylic acid' 346.151 1 ? ? ? ? 4 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora 2,Aurora/IPL1-related kinase 1,hARK1,Breast tumor-amplified kinase,Serine/threonine-protein kinase 15,Serine/threonine-protein kinase 6,Serine/threonine-protein kinase aurora-A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDA TRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPS SRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRL LKHNPSQRPMLREVLEHPWITANSSKPHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDA TRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPS SRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRL LKHNPSQRPMLREVLEHPWITANSSKPHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 '2-(3-bromophenyl)-8-fluoroquinoline-4-carboxylic acid' 5DN 4 "ADENOSINE-5'-TRIPHOSPHATE" ATP # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ARG n 1 4 GLN n 1 5 TRP n 1 6 ALA n 1 7 LEU n 1 8 GLU n 1 9 ASP n 1 10 PHE n 1 11 GLU n 1 12 ILE n 1 13 GLY n 1 14 ARG n 1 15 PRO n 1 16 LEU n 1 17 GLY n 1 18 LYS n 1 19 GLY n 1 20 LYS n 1 21 PHE n 1 22 GLY n 1 23 ASN n 1 24 VAL n 1 25 TYR n 1 26 LEU n 1 27 ALA n 1 28 ARG n 1 29 GLU n 1 30 LYS n 1 31 GLN n 1 32 SER n 1 33 LYS n 1 34 PHE n 1 35 ILE n 1 36 LEU n 1 37 ALA n 1 38 LEU n 1 39 LYS n 1 40 VAL n 1 41 LEU n 1 42 PHE n 1 43 LYS n 1 44 ALA n 1 45 GLN n 1 46 LEU n 1 47 GLU n 1 48 LYS n 1 49 ALA n 1 50 GLY n 1 51 VAL n 1 52 GLU n 1 53 HIS n 1 54 GLN n 1 55 LEU n 1 56 ARG n 1 57 ARG n 1 58 GLU n 1 59 VAL n 1 60 GLU n 1 61 ILE n 1 62 GLN n 1 63 SER n 1 64 HIS n 1 65 LEU n 1 66 ARG n 1 67 HIS n 1 68 PRO n 1 69 ASN n 1 70 ILE n 1 71 LEU n 1 72 ARG n 1 73 LEU n 1 74 TYR n 1 75 GLY n 1 76 TYR n 1 77 PHE n 1 78 HIS n 1 79 ASP n 1 80 ALA n 1 81 THR n 1 82 ARG n 1 83 VAL n 1 84 TYR n 1 85 LEU n 1 86 ILE n 1 87 LEU n 1 88 GLU n 1 89 TYR n 1 90 ALA n 1 91 PRO n 1 92 LEU n 1 93 GLY n 1 94 THR n 1 95 VAL n 1 96 TYR n 1 97 ARG n 1 98 GLU n 1 99 LEU n 1 100 GLN n 1 101 LYS n 1 102 LEU n 1 103 SER n 1 104 LYS n 1 105 PHE n 1 106 ASP n 1 107 GLU n 1 108 GLN n 1 109 ARG n 1 110 THR n 1 111 ALA n 1 112 THR n 1 113 TYR n 1 114 ILE n 1 115 THR n 1 116 GLU n 1 117 LEU n 1 118 ALA n 1 119 ASN n 1 120 ALA n 1 121 LEU n 1 122 SER n 1 123 TYR n 1 124 CYS n 1 125 HIS n 1 126 SER n 1 127 LYS n 1 128 ARG n 1 129 VAL n 1 130 ILE n 1 131 HIS n 1 132 ARG n 1 133 ASP n 1 134 ILE n 1 135 LYS n 1 136 PRO n 1 137 GLU n 1 138 ASN n 1 139 LEU n 1 140 LEU n 1 141 LEU n 1 142 GLY n 1 143 SER n 1 144 ALA n 1 145 GLY n 1 146 GLU n 1 147 LEU n 1 148 LYS n 1 149 ILE n 1 150 ALA n 1 151 ASP n 1 152 PHE n 1 153 GLY n 1 154 TRP n 1 155 SER n 1 156 VAL n 1 157 HIS n 1 158 ALA n 1 159 PRO n 1 160 SER n 1 161 SER n 1 162 ARG n 1 163 ARG n 1 164 THR n 1 165 THR n 1 166 LEU n 1 167 CYS n 1 168 GLY n 1 169 THR n 1 170 LEU n 1 171 ASP n 1 172 TYR n 1 173 LEU n 1 174 PRO n 1 175 PRO n 1 176 GLU n 1 177 MET n 1 178 ILE n 1 179 GLU n 1 180 GLY n 1 181 ARG n 1 182 MET n 1 183 HIS n 1 184 ASP n 1 185 GLU n 1 186 LYS n 1 187 VAL n 1 188 ASP n 1 189 LEU n 1 190 TRP n 1 191 SER n 1 192 LEU n 1 193 GLY n 1 194 VAL n 1 195 LEU n 1 196 CYS n 1 197 TYR n 1 198 GLU n 1 199 PHE n 1 200 LEU n 1 201 VAL n 1 202 GLY n 1 203 LYS n 1 204 PRO n 1 205 PRO n 1 206 PHE n 1 207 GLU n 1 208 ALA n 1 209 ASN n 1 210 THR n 1 211 TYR n 1 212 GLN n 1 213 GLU n 1 214 THR n 1 215 TYR n 1 216 LYS n 1 217 ARG n 1 218 ILE n 1 219 SER n 1 220 ARG n 1 221 VAL n 1 222 GLU n 1 223 PHE n 1 224 THR n 1 225 PHE n 1 226 PRO n 1 227 ASP n 1 228 PHE n 1 229 VAL n 1 230 THR n 1 231 GLU n 1 232 GLY n 1 233 ALA n 1 234 ARG n 1 235 ASP n 1 236 LEU n 1 237 ILE n 1 238 SER n 1 239 ARG n 1 240 LEU n 1 241 LEU n 1 242 LYS n 1 243 HIS n 1 244 ASN n 1 245 PRO n 1 246 SER n 1 247 GLN n 1 248 ARG n 1 249 PRO n 1 250 MET n 1 251 LEU n 1 252 ARG n 1 253 GLU n 1 254 VAL n 1 255 LEU n 1 256 GLU n 1 257 HIS n 1 258 PRO n 1 259 TRP n 1 260 ILE n 1 261 THR n 1 262 ALA n 1 263 ASN n 1 264 SER n 1 265 SER n 1 266 LYS n 1 267 PRO n 1 268 HIS n 1 269 HIS n 1 270 HIS n 1 271 HIS n 1 272 HIS n 1 273 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 273 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant pUBS520 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details 'Expresses lambda phosphatase' _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBAT4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 5DN non-polymer . '2-(3-bromophenyl)-8-fluoroquinoline-4-carboxylic acid' ? 'C16 H9 Br F N O2' 346.151 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ATP non-polymer . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 124 ? ? ? A . n A 1 2 GLY 2 125 ? ? ? A . n A 1 3 ARG 3 126 ? ? ? A . n A 1 4 GLN 4 127 127 GLN GLN A . n A 1 5 TRP 5 128 128 TRP TRP A . n A 1 6 ALA 6 129 129 ALA ALA A . n A 1 7 LEU 7 130 130 LEU LEU A . n A 1 8 GLU 8 131 131 GLU GLU A . n A 1 9 ASP 9 132 132 ASP ASP A . n A 1 10 PHE 10 133 133 PHE PHE A . n A 1 11 GLU 11 134 134 GLU GLU A . n A 1 12 ILE 12 135 135 ILE ILE A . n A 1 13 GLY 13 136 136 GLY GLY A . n A 1 14 ARG 14 137 137 ARG ARG A . n A 1 15 PRO 15 138 138 PRO PRO A . n A 1 16 LEU 16 139 139 LEU LEU A . n A 1 17 GLY 17 140 140 GLY GLY A . n A 1 18 LYS 18 141 141 LYS LYS A . n A 1 19 GLY 19 142 142 GLY GLY A . n A 1 20 LYS 20 143 143 LYS LYS A . n A 1 21 PHE 21 144 144 PHE PHE A . n A 1 22 GLY 22 145 145 GLY GLY A . n A 1 23 ASN 23 146 146 ASN ASN A . n A 1 24 VAL 24 147 147 VAL VAL A . n A 1 25 TYR 25 148 148 TYR TYR A . n A 1 26 LEU 26 149 149 LEU LEU A . n A 1 27 ALA 27 150 150 ALA ALA A . n A 1 28 ARG 28 151 151 ARG ARG A . n A 1 29 GLU 29 152 152 GLU GLU A . n A 1 30 LYS 30 153 153 LYS LYS A . n A 1 31 GLN 31 154 154 GLN GLN A . n A 1 32 SER 32 155 155 SER SER A . n A 1 33 LYS 33 156 156 LYS LYS A . n A 1 34 PHE 34 157 157 PHE PHE A . n A 1 35 ILE 35 158 158 ILE ILE A . n A 1 36 LEU 36 159 159 LEU LEU A . n A 1 37 ALA 37 160 160 ALA ALA A . n A 1 38 LEU 38 161 161 LEU LEU A . n A 1 39 LYS 39 162 162 LYS LYS A . n A 1 40 VAL 40 163 163 VAL VAL A . n A 1 41 LEU 41 164 164 LEU LEU A . n A 1 42 PHE 42 165 165 PHE PHE A . n A 1 43 LYS 43 166 166 LYS LYS A . n A 1 44 ALA 44 167 167 ALA ALA A . n A 1 45 GLN 45 168 168 GLN GLN A . n A 1 46 LEU 46 169 169 LEU LEU A . n A 1 47 GLU 47 170 170 GLU GLU A . n A 1 48 LYS 48 171 171 LYS LYS A . n A 1 49 ALA 49 172 172 ALA ALA A . n A 1 50 GLY 50 173 173 GLY GLY A . n A 1 51 VAL 51 174 174 VAL VAL A . n A 1 52 GLU 52 175 175 GLU GLU A . n A 1 53 HIS 53 176 176 HIS HIS A . n A 1 54 GLN 54 177 177 GLN GLN A . n A 1 55 LEU 55 178 178 LEU LEU A . n A 1 56 ARG 56 179 179 ARG ARG A . n A 1 57 ARG 57 180 180 ARG ARG A . n A 1 58 GLU 58 181 181 GLU GLU A . n A 1 59 VAL 59 182 182 VAL VAL A . n A 1 60 GLU 60 183 183 GLU GLU A . n A 1 61 ILE 61 184 184 ILE ILE A . n A 1 62 GLN 62 185 185 GLN GLN A . n A 1 63 SER 63 186 186 SER SER A . n A 1 64 HIS 64 187 187 HIS HIS A . n A 1 65 LEU 65 188 188 LEU LEU A . n A 1 66 ARG 66 189 189 ARG ARG A . n A 1 67 HIS 67 190 190 HIS HIS A . n A 1 68 PRO 68 191 191 PRO PRO A . n A 1 69 ASN 69 192 192 ASN ASN A . n A 1 70 ILE 70 193 193 ILE ILE A . n A 1 71 LEU 71 194 194 LEU LEU A . n A 1 72 ARG 72 195 195 ARG ARG A . n A 1 73 LEU 73 196 196 LEU LEU A . n A 1 74 TYR 74 197 197 TYR TYR A . n A 1 75 GLY 75 198 198 GLY GLY A . n A 1 76 TYR 76 199 199 TYR TYR A . n A 1 77 PHE 77 200 200 PHE PHE A . n A 1 78 HIS 78 201 201 HIS HIS A . n A 1 79 ASP 79 202 202 ASP ASP A . n A 1 80 ALA 80 203 203 ALA ALA A . n A 1 81 THR 81 204 204 THR THR A . n A 1 82 ARG 82 205 205 ARG ARG A . n A 1 83 VAL 83 206 206 VAL VAL A . n A 1 84 TYR 84 207 207 TYR TYR A . n A 1 85 LEU 85 208 208 LEU LEU A . n A 1 86 ILE 86 209 209 ILE ILE A . n A 1 87 LEU 87 210 210 LEU LEU A . n A 1 88 GLU 88 211 211 GLU GLU A . n A 1 89 TYR 89 212 212 TYR TYR A . n A 1 90 ALA 90 213 213 ALA ALA A . n A 1 91 PRO 91 214 214 PRO PRO A . n A 1 92 LEU 92 215 215 LEU LEU A . n A 1 93 GLY 93 216 216 GLY GLY A . n A 1 94 THR 94 217 217 THR THR A . n A 1 95 VAL 95 218 218 VAL VAL A . n A 1 96 TYR 96 219 219 TYR TYR A . n A 1 97 ARG 97 220 220 ARG ARG A . n A 1 98 GLU 98 221 221 GLU GLU A . n A 1 99 LEU 99 222 222 LEU LEU A . n A 1 100 GLN 100 223 223 GLN GLN A . n A 1 101 LYS 101 224 224 LYS LYS A . n A 1 102 LEU 102 225 225 LEU LEU A . n A 1 103 SER 103 226 226 SER SER A . n A 1 104 LYS 104 227 227 LYS LYS A . n A 1 105 PHE 105 228 228 PHE PHE A . n A 1 106 ASP 106 229 229 ASP ASP A . n A 1 107 GLU 107 230 230 GLU GLU A . n A 1 108 GLN 108 231 231 GLN GLN A . n A 1 109 ARG 109 232 232 ARG ARG A . n A 1 110 THR 110 233 233 THR THR A . n A 1 111 ALA 111 234 234 ALA ALA A . n A 1 112 THR 112 235 235 THR THR A . n A 1 113 TYR 113 236 236 TYR TYR A . n A 1 114 ILE 114 237 237 ILE ILE A . n A 1 115 THR 115 238 238 THR THR A . n A 1 116 GLU 116 239 239 GLU GLU A . n A 1 117 LEU 117 240 240 LEU LEU A . n A 1 118 ALA 118 241 241 ALA ALA A . n A 1 119 ASN 119 242 242 ASN ASN A . n A 1 120 ALA 120 243 243 ALA ALA A . n A 1 121 LEU 121 244 244 LEU LEU A . n A 1 122 SER 122 245 245 SER SER A . n A 1 123 TYR 123 246 246 TYR TYR A . n A 1 124 CYS 124 247 247 CYS CYS A . n A 1 125 HIS 125 248 248 HIS HIS A . n A 1 126 SER 126 249 249 SER SER A . n A 1 127 LYS 127 250 250 LYS LYS A . n A 1 128 ARG 128 251 251 ARG ARG A . n A 1 129 VAL 129 252 252 VAL VAL A . n A 1 130 ILE 130 253 253 ILE ILE A . n A 1 131 HIS 131 254 254 HIS HIS A . n A 1 132 ARG 132 255 255 ARG ARG A . n A 1 133 ASP 133 256 256 ASP ASP A . n A 1 134 ILE 134 257 257 ILE ILE A . n A 1 135 LYS 135 258 258 LYS LYS A . n A 1 136 PRO 136 259 259 PRO PRO A . n A 1 137 GLU 137 260 260 GLU GLU A . n A 1 138 ASN 138 261 261 ASN ASN A . n A 1 139 LEU 139 262 262 LEU LEU A . n A 1 140 LEU 140 263 263 LEU LEU A . n A 1 141 LEU 141 264 264 LEU LEU A . n A 1 142 GLY 142 265 265 GLY GLY A . n A 1 143 SER 143 266 266 SER SER A . n A 1 144 ALA 144 267 267 ALA ALA A . n A 1 145 GLY 145 268 268 GLY GLY A . n A 1 146 GLU 146 269 269 GLU GLU A . n A 1 147 LEU 147 270 270 LEU LEU A . n A 1 148 LYS 148 271 271 LYS LYS A . n A 1 149 ILE 149 272 272 ILE ILE A . n A 1 150 ALA 150 273 273 ALA ALA A . n A 1 151 ASP 151 274 274 ASP ASP A . n A 1 152 PHE 152 275 275 PHE PHE A . n A 1 153 GLY 153 276 276 GLY GLY A . n A 1 154 TRP 154 277 277 TRP TRP A . n A 1 155 SER 155 278 278 SER SER A . n A 1 156 VAL 156 279 279 VAL VAL A . n A 1 157 HIS 157 280 280 HIS HIS A . n A 1 158 ALA 158 281 281 ALA ALA A . n A 1 159 PRO 159 282 282 PRO PRO A . n A 1 160 SER 160 283 283 SER SER A . n A 1 161 SER 161 284 284 SER SER A . n A 1 162 ARG 162 285 ? ? ? A . n A 1 163 ARG 163 286 ? ? ? A . n A 1 164 THR 164 287 ? ? ? A . n A 1 165 THR 165 288 ? ? ? A . n A 1 166 LEU 166 289 ? ? ? A . n A 1 167 CYS 167 290 290 CYS CYS A . n A 1 168 GLY 168 291 291 GLY GLY A . n A 1 169 THR 169 292 292 THR THR A . n A 1 170 LEU 170 293 293 LEU LEU A . n A 1 171 ASP 171 294 294 ASP ASP A . n A 1 172 TYR 172 295 295 TYR TYR A . n A 1 173 LEU 173 296 296 LEU LEU A . n A 1 174 PRO 174 297 297 PRO PRO A . n A 1 175 PRO 175 298 298 PRO PRO A . n A 1 176 GLU 176 299 299 GLU GLU A . n A 1 177 MET 177 300 300 MET MET A . n A 1 178 ILE 178 301 301 ILE ILE A . n A 1 179 GLU 179 302 302 GLU GLU A . n A 1 180 GLY 180 303 303 GLY GLY A . n A 1 181 ARG 181 304 304 ARG ARG A . n A 1 182 MET 182 305 305 MET MET A . n A 1 183 HIS 183 306 306 HIS HIS A . n A 1 184 ASP 184 307 307 ASP ASP A . n A 1 185 GLU 185 308 308 GLU GLU A . n A 1 186 LYS 186 309 309 LYS LYS A . n A 1 187 VAL 187 310 310 VAL VAL A . n A 1 188 ASP 188 311 311 ASP ASP A . n A 1 189 LEU 189 312 312 LEU LEU A . n A 1 190 TRP 190 313 313 TRP TRP A . n A 1 191 SER 191 314 314 SER SER A . n A 1 192 LEU 192 315 315 LEU LEU A . n A 1 193 GLY 193 316 316 GLY GLY A . n A 1 194 VAL 194 317 317 VAL VAL A . n A 1 195 LEU 195 318 318 LEU LEU A . n A 1 196 CYS 196 319 319 CYS CYS A . n A 1 197 TYR 197 320 320 TYR TYR A . n A 1 198 GLU 198 321 321 GLU GLU A . n A 1 199 PHE 199 322 322 PHE PHE A . n A 1 200 LEU 200 323 323 LEU LEU A . n A 1 201 VAL 201 324 324 VAL VAL A . n A 1 202 GLY 202 325 325 GLY GLY A . n A 1 203 LYS 203 326 326 LYS LYS A . n A 1 204 PRO 204 327 327 PRO PRO A . n A 1 205 PRO 205 328 328 PRO PRO A . n A 1 206 PHE 206 329 329 PHE PHE A . n A 1 207 GLU 207 330 330 GLU GLU A . n A 1 208 ALA 208 331 331 ALA ALA A . n A 1 209 ASN 209 332 332 ASN ASN A . n A 1 210 THR 210 333 333 THR THR A . n A 1 211 TYR 211 334 334 TYR TYR A . n A 1 212 GLN 212 335 335 GLN GLN A . n A 1 213 GLU 213 336 336 GLU GLU A . n A 1 214 THR 214 337 337 THR THR A . n A 1 215 TYR 215 338 338 TYR TYR A . n A 1 216 LYS 216 339 339 LYS LYS A . n A 1 217 ARG 217 340 340 ARG ARG A . n A 1 218 ILE 218 341 341 ILE ILE A . n A 1 219 SER 219 342 342 SER SER A . n A 1 220 ARG 220 343 343 ARG ARG A . n A 1 221 VAL 221 344 344 VAL VAL A . n A 1 222 GLU 222 345 345 GLU GLU A . n A 1 223 PHE 223 346 346 PHE PHE A . n A 1 224 THR 224 347 347 THR THR A . n A 1 225 PHE 225 348 348 PHE PHE A . n A 1 226 PRO 226 349 349 PRO PRO A . n A 1 227 ASP 227 350 350 ASP ASP A . n A 1 228 PHE 228 351 351 PHE PHE A . n A 1 229 VAL 229 352 352 VAL VAL A . n A 1 230 THR 230 353 353 THR THR A . n A 1 231 GLU 231 354 354 GLU GLU A . n A 1 232 GLY 232 355 355 GLY GLY A . n A 1 233 ALA 233 356 356 ALA ALA A . n A 1 234 ARG 234 357 357 ARG ARG A . n A 1 235 ASP 235 358 358 ASP ASP A . n A 1 236 LEU 236 359 359 LEU LEU A . n A 1 237 ILE 237 360 360 ILE ILE A . n A 1 238 SER 238 361 361 SER SER A . n A 1 239 ARG 239 362 362 ARG ARG A . n A 1 240 LEU 240 363 363 LEU LEU A . n A 1 241 LEU 241 364 364 LEU LEU A . n A 1 242 LYS 242 365 365 LYS LYS A . n A 1 243 HIS 243 366 366 HIS HIS A . n A 1 244 ASN 244 367 367 ASN ASN A . n A 1 245 PRO 245 368 368 PRO PRO A . n A 1 246 SER 246 369 369 SER SER A . n A 1 247 GLN 247 370 370 GLN GLN A . n A 1 248 ARG 248 371 371 ARG ARG A . n A 1 249 PRO 249 372 372 PRO PRO A . n A 1 250 MET 250 373 373 MET MET A . n A 1 251 LEU 251 374 374 LEU LEU A . n A 1 252 ARG 252 375 375 ARG ARG A . n A 1 253 GLU 253 376 376 GLU GLU A . n A 1 254 VAL 254 377 377 VAL VAL A . n A 1 255 LEU 255 378 378 LEU LEU A . n A 1 256 GLU 256 379 379 GLU GLU A . n A 1 257 HIS 257 380 380 HIS HIS A . n A 1 258 PRO 258 381 381 PRO PRO A . n A 1 259 TRP 259 382 382 TRP TRP A . n A 1 260 ILE 260 383 383 ILE ILE A . n A 1 261 THR 261 384 384 THR THR A . n A 1 262 ALA 262 385 385 ALA ALA A . n A 1 263 ASN 263 386 386 ASN ASN A . n A 1 264 SER 264 387 387 SER SER A . n A 1 265 SER 265 388 388 SER SER A . n A 1 266 LYS 266 389 389 LYS LYS A . n A 1 267 PRO 267 390 390 PRO PRO A . n A 1 268 HIS 268 391 ? ? ? A . n A 1 269 HIS 269 392 ? ? ? A . n A 1 270 HIS 270 393 ? ? ? A . n A 1 271 HIS 271 394 ? ? ? A . n A 1 272 HIS 272 395 ? ? ? A . n A 1 273 HIS 273 396 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 401 1 MG MG A . C 3 5DN 1 402 1 5DN 035 A . D 4 ATP 1 403 1 ATP ATP A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.1 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5DT4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 82.500 _cell.length_a_esd ? _cell.length_b 82.500 _cell.length_b_esd ? _cell.length_c 170.020 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DT4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DT4 _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.62 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.11 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM HEPES pH 7.4, 200 mM magnesium sulfate, 2-20% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-03-07 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I02' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I02 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 125.41 _reflns.entry_id 5DT4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.86 _reflns.d_resolution_low 56.67 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8500 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.2 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.86 _reflns_shell.d_res_low 2.93 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.21 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 18.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.3635 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -0.3635 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.7269 _refine.B_iso_max ? _refine.B_iso_mean 112.45 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.9622 _refine.correlation_coeff_Fo_to_Fc_free 0.9379 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DT4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.86 _refine.ls_d_res_low 54.70 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8453 _refine.ls_number_reflns_R_free 432 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.87 _refine.ls_percent_reflns_R_free 5.11 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1932 _refine.ls_R_factor_R_free 0.2559 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1899 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3FDN _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI 0.373 _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5DT4 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.542 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2126 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 53 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2179 _refine_hist.d_res_high 2.86 _refine_hist.d_res_low 54.70 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2236 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.11 ? 3031 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 783 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 48 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 333 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2236 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 0 ? t_nbd 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 2.69 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 20.58 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 271 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2545 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.86 _refine_ls_shell.d_res_low 3.20 _refine_ls_shell.number_reflns_all 2312 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 112 _refine_ls_shell.number_reflns_R_work 2200 _refine_ls_shell.percent_reflns_obs 99.87 _refine_ls_shell.percent_reflns_R_free 4.84 _refine_ls_shell.R_factor_all 0.2525 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3389 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2482 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5DT4 _struct.title 'Aurora A Kinase in Complex with AA35 and ATP in Space Group P6122' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DT4 _struct_keywords.text 'Aurora A kinase, mitotic kinase, PPI, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AURKA_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATR VYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSR RTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLK HNPSQRPMLREVLEHPWITANSSKP ; _struct_ref.pdbx_align_begin 126 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5DT4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 267 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 126 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 390 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 126 _struct_ref_seq.pdbx_auth_seq_align_end 390 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5DT4 MET A 1 ? UNP O14965 ? ? 'initiating methionine' 124 1 1 5DT4 GLY A 2 ? UNP O14965 ? ? 'expression tag' 125 2 1 5DT4 HIS A 268 ? UNP O14965 ? ? 'expression tag' 391 3 1 5DT4 HIS A 269 ? UNP O14965 ? ? 'expression tag' 392 4 1 5DT4 HIS A 270 ? UNP O14965 ? ? 'expression tag' 393 5 1 5DT4 HIS A 271 ? UNP O14965 ? ? 'expression tag' 394 6 1 5DT4 HIS A 272 ? UNP O14965 ? ? 'expression tag' 395 7 1 5DT4 HIS A 273 ? UNP O14965 ? ? 'expression tag' 396 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1050 ? 1 MORE -14 ? 1 'SSA (A^2)' 12330 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 6 ? GLU A 8 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 AA2 LYS A 43 ? LYS A 48 ? LYS A 166 LYS A 171 1 ? 6 HELX_P HELX_P3 AA3 HIS A 53 ? HIS A 64 ? HIS A 176 HIS A 187 1 ? 12 HELX_P HELX_P4 AA4 THR A 94 ? SER A 103 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P5 AA5 ASP A 106 ? SER A 126 ? ASP A 229 SER A 249 1 ? 21 HELX_P HELX_P6 AA6 LYS A 135 ? GLU A 137 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P7 AA7 THR A 169 ? LEU A 173 ? THR A 292 LEU A 296 5 ? 5 HELX_P HELX_P8 AA8 PRO A 174 ? GLU A 179 ? PRO A 297 GLU A 302 1 ? 6 HELX_P HELX_P9 AA9 LYS A 186 ? GLY A 202 ? LYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P10 AB1 THR A 210 ? VAL A 221 ? THR A 333 VAL A 344 1 ? 12 HELX_P HELX_P11 AB2 THR A 230 ? LEU A 241 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P12 AB3 MET A 250 ? GLU A 256 ? MET A 373 GLU A 379 1 ? 7 HELX_P HELX_P13 AB4 HIS A 257 ? SER A 264 ? HIS A 380 SER A 387 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASN 138 OD1 ? ? ? 1_555 B MG . MG ? ? A ASN 261 A MG 401 1_555 ? ? ? ? ? ? ? 2.234 ? ? metalc2 metalc ? ? A ASP 151 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 274 A MG 401 1_555 ? ? ? ? ? ? ? 2.597 ? ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 D ATP . O1B ? ? A MG 401 A ATP 403 1_555 ? ? ? ? ? ? ? 2.194 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASN 138 ? A ASN 261 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 151 ? A ASP 274 ? 1_555 72.1 ? 2 OD1 ? A ASN 138 ? A ASN 261 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O1B ? D ATP . ? A ATP 403 ? 1_555 151.7 ? 3 OD2 ? A ASP 151 ? A ASP 274 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O1B ? D ATP . ? A ATP 403 ? 1_555 80.1 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 158 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 281 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 159 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 282 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.26 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 10 ? LYS A 18 ? PHE A 133 LYS A 141 AA1 2 ASN A 23 ? GLU A 29 ? ASN A 146 GLU A 152 AA1 3 PHE A 34 ? PHE A 42 ? PHE A 157 PHE A 165 AA1 4 ARG A 82 ? GLU A 88 ? ARG A 205 GLU A 211 AA1 5 LEU A 73 ? HIS A 78 ? LEU A 196 HIS A 201 AA2 1 VAL A 129 ? ILE A 130 ? VAL A 252 ILE A 253 AA2 2 VAL A 156 ? HIS A 157 ? VAL A 279 HIS A 280 AA3 1 LEU A 139 ? LEU A 141 ? LEU A 262 LEU A 264 AA3 2 LEU A 147 ? ILE A 149 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 16 ? N LEU A 139 O VAL A 24 ? O VAL A 147 AA1 2 3 N ALA A 27 ? N ALA A 150 O LEU A 36 ? O LEU A 159 AA1 3 4 N ALA A 37 ? N ALA A 160 O LEU A 87 ? O LEU A 210 AA1 4 5 O TYR A 84 ? O TYR A 207 N PHE A 77 ? N PHE A 200 AA2 1 2 N ILE A 130 ? N ILE A 253 O VAL A 156 ? O VAL A 279 AA3 1 2 N LEU A 140 ? N LEU A 263 O LYS A 148 ? O LYS A 271 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 401 ? 3 'binding site for residue MG A 401' AC2 Software A 5DN 402 ? 8 'binding site for residue 5DN A 402' AC3 Software A ATP 403 ? 21 'binding site for residue ATP A 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ASN A 138 ? ASN A 261 . ? 1_555 ? 2 AC1 3 ASP A 151 ? ASP A 274 . ? 1_555 ? 3 AC1 3 ATP D . ? ATP A 403 . ? 1_555 ? 4 AC2 8 LYS A 43 ? LYS A 166 . ? 1_555 ? 5 AC2 8 LEU A 46 ? LEU A 169 . ? 1_555 ? 6 AC2 8 GLU A 47 ? GLU A 170 . ? 1_555 ? 7 AC2 8 GLU A 52 ? GLU A 175 . ? 1_555 ? 8 AC2 8 ARG A 56 ? ARG A 179 . ? 1_555 ? 9 AC2 8 TYR A 76 ? TYR A 199 . ? 1_555 ? 10 AC2 8 HIS A 78 ? HIS A 201 . ? 1_555 ? 11 AC2 8 VAL A 83 ? VAL A 206 . ? 1_555 ? 12 AC3 21 LEU A 16 ? LEU A 139 . ? 1_555 ? 13 AC3 21 GLY A 17 ? GLY A 140 . ? 1_555 ? 14 AC3 21 LYS A 18 ? LYS A 141 . ? 1_555 ? 15 AC3 21 GLY A 19 ? GLY A 142 . ? 1_555 ? 16 AC3 21 LYS A 20 ? LYS A 143 . ? 1_555 ? 17 AC3 21 PHE A 21 ? PHE A 144 . ? 1_555 ? 18 AC3 21 VAL A 24 ? VAL A 147 . ? 1_555 ? 19 AC3 21 ALA A 37 ? ALA A 160 . ? 1_555 ? 20 AC3 21 LYS A 39 ? LYS A 162 . ? 1_555 ? 21 AC3 21 GLU A 58 ? GLU A 181 . ? 1_555 ? 22 AC3 21 LEU A 71 ? LEU A 194 . ? 1_555 ? 23 AC3 21 GLU A 88 ? GLU A 211 . ? 1_555 ? 24 AC3 21 ALA A 90 ? ALA A 213 . ? 1_555 ? 25 AC3 21 THR A 94 ? THR A 217 . ? 1_555 ? 26 AC3 21 ASP A 133 ? ASP A 256 . ? 1_555 ? 27 AC3 21 GLU A 137 ? GLU A 260 . ? 1_555 ? 28 AC3 21 ASN A 138 ? ASN A 261 . ? 1_555 ? 29 AC3 21 LEU A 140 ? LEU A 263 . ? 1_555 ? 30 AC3 21 ASP A 151 ? ASP A 274 . ? 1_555 ? 31 AC3 21 GLY A 153 ? GLY A 276 . ? 1_555 ? 32 AC3 21 MG B . ? MG A 401 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 MG A MG 401 ? ? O1A A ATP 403 ? ? 1.69 2 1 O A VAL 174 ? ? O A GLU 175 ? ? 1.79 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLU _pdbx_validate_rmsd_angle.auth_seq_id_1 175 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLU _pdbx_validate_rmsd_angle.auth_seq_id_2 175 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 175 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 88.27 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -22.73 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 171 ? ? -56.84 -2.24 2 1 GLU A 175 ? ? -50.26 -80.30 3 1 HIS A 176 ? ? 23.78 -90.28 4 1 ASP A 202 ? ? -135.36 -149.11 5 1 ALA A 203 ? ? -49.52 -72.59 6 1 SER A 226 ? ? 70.17 -53.13 7 1 ARG A 255 ? ? 66.74 -14.36 8 1 ASP A 274 ? ? 56.58 87.02 9 1 ARG A 304 ? ? -55.55 177.77 10 1 ASP A 307 ? ? -128.94 -150.61 11 1 PHE A 351 ? ? -64.92 2.59 12 1 LEU A 364 ? ? -94.39 57.70 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 124 ? A MET 1 2 1 Y 1 A GLY 125 ? A GLY 2 3 1 Y 1 A ARG 126 ? A ARG 3 4 1 Y 1 A ARG 285 ? A ARG 162 5 1 Y 1 A ARG 286 ? A ARG 163 6 1 Y 1 A THR 287 ? A THR 164 7 1 Y 1 A THR 288 ? A THR 165 8 1 Y 1 A LEU 289 ? A LEU 166 9 1 Y 1 A HIS 391 ? A HIS 268 10 1 Y 1 A HIS 392 ? A HIS 269 11 1 Y 1 A HIS 393 ? A HIS 270 12 1 Y 1 A HIS 394 ? A HIS 271 13 1 Y 1 A HIS 395 ? A HIS 272 14 1 Y 1 A HIS 396 ? A HIS 273 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 5DN O01 O N N 1 5DN C02 C N N 2 5DN O03 O N N 3 5DN C04 C Y N 4 5DN C05 C Y N 5 5DN C06 C Y N 6 5DN C07 C Y N 7 5DN C08 C Y N 8 5DN C09 C Y N 9 5DN C10 C Y N 10 5DN C11 C Y N 11 5DN BR BR N N 12 5DN C13 C Y N 13 5DN N14 N Y N 14 5DN C15 C Y N 15 5DN C16 C Y N 16 5DN F17 F N N 17 5DN C18 C Y N 18 5DN C19 C Y N 19 5DN C20 C Y N 20 5DN C21 C Y N 21 5DN H1 H N N 22 5DN H2 H N N 23 5DN H3 H N N 24 5DN H4 H N N 25 5DN H5 H N N 26 5DN H6 H N N 27 5DN H7 H N N 28 5DN H8 H N N 29 5DN H9 H N N 30 ALA N N N N 31 ALA CA C N S 32 ALA C C N N 33 ALA O O N N 34 ALA CB C N N 35 ALA OXT O N N 36 ALA H H N N 37 ALA H2 H N N 38 ALA HA H N N 39 ALA HB1 H N N 40 ALA HB2 H N N 41 ALA HB3 H N N 42 ALA HXT H N N 43 ARG N N N N 44 ARG CA C N S 45 ARG C C N N 46 ARG O O N N 47 ARG CB C N N 48 ARG CG C N N 49 ARG CD C N N 50 ARG NE N N N 51 ARG CZ C N N 52 ARG NH1 N N N 53 ARG NH2 N N N 54 ARG OXT O N N 55 ARG H H N N 56 ARG H2 H N N 57 ARG HA H N N 58 ARG HB2 H N N 59 ARG HB3 H N N 60 ARG HG2 H N N 61 ARG HG3 H N N 62 ARG HD2 H N N 63 ARG HD3 H N N 64 ARG HE H N N 65 ARG HH11 H N N 66 ARG HH12 H N N 67 ARG HH21 H N N 68 ARG HH22 H N N 69 ARG HXT H N N 70 ASN N N N N 71 ASN CA C N S 72 ASN C C N N 73 ASN O O N N 74 ASN CB C N N 75 ASN CG C N N 76 ASN OD1 O N N 77 ASN ND2 N N N 78 ASN OXT O N N 79 ASN H H N N 80 ASN H2 H N N 81 ASN HA H N N 82 ASN HB2 H N N 83 ASN HB3 H N N 84 ASN HD21 H N N 85 ASN HD22 H N N 86 ASN HXT H N N 87 ASP N N N N 88 ASP CA C N S 89 ASP C C N N 90 ASP O O N N 91 ASP CB C N N 92 ASP CG C N N 93 ASP OD1 O N N 94 ASP OD2 O N N 95 ASP OXT O N N 96 ASP H H N N 97 ASP H2 H N N 98 ASP HA H N N 99 ASP HB2 H N N 100 ASP HB3 H N N 101 ASP HD2 H N N 102 ASP HXT H N N 103 ATP PG P N N 104 ATP O1G O N N 105 ATP O2G O N N 106 ATP O3G O N N 107 ATP PB P N R 108 ATP O1B O N N 109 ATP O2B O N N 110 ATP O3B O N N 111 ATP PA P N R 112 ATP O1A O N N 113 ATP O2A O N N 114 ATP O3A O N N 115 ATP "O5'" O N N 116 ATP "C5'" C N N 117 ATP "C4'" C N R 118 ATP "O4'" O N N 119 ATP "C3'" C N S 120 ATP "O3'" O N N 121 ATP "C2'" C N R 122 ATP "O2'" O N N 123 ATP "C1'" C N R 124 ATP N9 N Y N 125 ATP C8 C Y N 126 ATP N7 N Y N 127 ATP C5 C Y N 128 ATP C6 C Y N 129 ATP N6 N N N 130 ATP N1 N Y N 131 ATP C2 C Y N 132 ATP N3 N Y N 133 ATP C4 C Y N 134 ATP HOG2 H N N 135 ATP HOG3 H N N 136 ATP HOB2 H N N 137 ATP HOA2 H N N 138 ATP "H5'1" H N N 139 ATP "H5'2" H N N 140 ATP "H4'" H N N 141 ATP "H3'" H N N 142 ATP "HO3'" H N N 143 ATP "H2'" H N N 144 ATP "HO2'" H N N 145 ATP "H1'" H N N 146 ATP H8 H N N 147 ATP HN61 H N N 148 ATP HN62 H N N 149 ATP H2 H N N 150 CYS N N N N 151 CYS CA C N R 152 CYS C C N N 153 CYS O O N N 154 CYS CB C N N 155 CYS SG S N N 156 CYS OXT O N N 157 CYS H H N N 158 CYS H2 H N N 159 CYS HA H N N 160 CYS HB2 H N N 161 CYS HB3 H N N 162 CYS HG H N N 163 CYS HXT H N N 164 GLN N N N N 165 GLN CA C N S 166 GLN C C N N 167 GLN O O N N 168 GLN CB C N N 169 GLN CG C N N 170 GLN CD C N N 171 GLN OE1 O N N 172 GLN NE2 N N N 173 GLN OXT O N N 174 GLN H H N N 175 GLN H2 H N N 176 GLN HA H N N 177 GLN HB2 H N N 178 GLN HB3 H N N 179 GLN HG2 H N N 180 GLN HG3 H N N 181 GLN HE21 H N N 182 GLN HE22 H N N 183 GLN HXT H N N 184 GLU N N N N 185 GLU CA C N S 186 GLU C C N N 187 GLU O O N N 188 GLU CB C N N 189 GLU CG C N N 190 GLU CD C N N 191 GLU OE1 O N N 192 GLU OE2 O N N 193 GLU OXT O N N 194 GLU H H N N 195 GLU H2 H N N 196 GLU HA H N N 197 GLU HB2 H N N 198 GLU HB3 H N N 199 GLU HG2 H N N 200 GLU HG3 H N N 201 GLU HE2 H N N 202 GLU HXT H N N 203 GLY N N N N 204 GLY CA C N N 205 GLY C C N N 206 GLY O O N N 207 GLY OXT O N N 208 GLY H H N N 209 GLY H2 H N N 210 GLY HA2 H N N 211 GLY HA3 H N N 212 GLY HXT H N N 213 HIS N N N N 214 HIS CA C N S 215 HIS C C N N 216 HIS O O N N 217 HIS CB C N N 218 HIS CG C Y N 219 HIS ND1 N Y N 220 HIS CD2 C Y N 221 HIS CE1 C Y N 222 HIS NE2 N Y N 223 HIS OXT O N N 224 HIS H H N N 225 HIS H2 H N N 226 HIS HA H N N 227 HIS HB2 H N N 228 HIS HB3 H N N 229 HIS HD1 H N N 230 HIS HD2 H N N 231 HIS HE1 H N N 232 HIS HE2 H N N 233 HIS HXT H N N 234 ILE N N N N 235 ILE CA C N S 236 ILE C C N N 237 ILE O O N N 238 ILE CB C N S 239 ILE CG1 C N N 240 ILE CG2 C N N 241 ILE CD1 C N N 242 ILE OXT O N N 243 ILE H H N N 244 ILE H2 H N N 245 ILE HA H N N 246 ILE HB H N N 247 ILE HG12 H N N 248 ILE HG13 H N N 249 ILE HG21 H N N 250 ILE HG22 H N N 251 ILE HG23 H N N 252 ILE HD11 H N N 253 ILE HD12 H N N 254 ILE HD13 H N N 255 ILE HXT H N N 256 LEU N N N N 257 LEU CA C N S 258 LEU C C N N 259 LEU O O N N 260 LEU CB C N N 261 LEU CG C N N 262 LEU CD1 C N N 263 LEU CD2 C N N 264 LEU OXT O N N 265 LEU H H N N 266 LEU H2 H N N 267 LEU HA H N N 268 LEU HB2 H N N 269 LEU HB3 H N N 270 LEU HG H N N 271 LEU HD11 H N N 272 LEU HD12 H N N 273 LEU HD13 H N N 274 LEU HD21 H N N 275 LEU HD22 H N N 276 LEU HD23 H N N 277 LEU HXT H N N 278 LYS N N N N 279 LYS CA C N S 280 LYS C C N N 281 LYS O O N N 282 LYS CB C N N 283 LYS CG C N N 284 LYS CD C N N 285 LYS CE C N N 286 LYS NZ N N N 287 LYS OXT O N N 288 LYS H H N N 289 LYS H2 H N N 290 LYS HA H N N 291 LYS HB2 H N N 292 LYS HB3 H N N 293 LYS HG2 H N N 294 LYS HG3 H N N 295 LYS HD2 H N N 296 LYS HD3 H N N 297 LYS HE2 H N N 298 LYS HE3 H N N 299 LYS HZ1 H N N 300 LYS HZ2 H N N 301 LYS HZ3 H N N 302 LYS HXT H N N 303 MET N N N N 304 MET CA C N S 305 MET C C N N 306 MET O O N N 307 MET CB C N N 308 MET CG C N N 309 MET SD S N N 310 MET CE C N N 311 MET OXT O N N 312 MET H H N N 313 MET H2 H N N 314 MET HA H N N 315 MET HB2 H N N 316 MET HB3 H N N 317 MET HG2 H N N 318 MET HG3 H N N 319 MET HE1 H N N 320 MET HE2 H N N 321 MET HE3 H N N 322 MET HXT H N N 323 MG MG MG N N 324 PHE N N N N 325 PHE CA C N S 326 PHE C C N N 327 PHE O O N N 328 PHE CB C N N 329 PHE CG C Y N 330 PHE CD1 C Y N 331 PHE CD2 C Y N 332 PHE CE1 C Y N 333 PHE CE2 C Y N 334 PHE CZ C Y N 335 PHE OXT O N N 336 PHE H H N N 337 PHE H2 H N N 338 PHE HA H N N 339 PHE HB2 H N N 340 PHE HB3 H N N 341 PHE HD1 H N N 342 PHE HD2 H N N 343 PHE HE1 H N N 344 PHE HE2 H N N 345 PHE HZ H N N 346 PHE HXT H N N 347 PRO N N N N 348 PRO CA C N S 349 PRO C C N N 350 PRO O O N N 351 PRO CB C N N 352 PRO CG C N N 353 PRO CD C N N 354 PRO OXT O N N 355 PRO H H N N 356 PRO HA H N N 357 PRO HB2 H N N 358 PRO HB3 H N N 359 PRO HG2 H N N 360 PRO HG3 H N N 361 PRO HD2 H N N 362 PRO HD3 H N N 363 PRO HXT H N N 364 SER N N N N 365 SER CA C N S 366 SER C C N N 367 SER O O N N 368 SER CB C N N 369 SER OG O N N 370 SER OXT O N N 371 SER H H N N 372 SER H2 H N N 373 SER HA H N N 374 SER HB2 H N N 375 SER HB3 H N N 376 SER HG H N N 377 SER HXT H N N 378 THR N N N N 379 THR CA C N S 380 THR C C N N 381 THR O O N N 382 THR CB C N R 383 THR OG1 O N N 384 THR CG2 C N N 385 THR OXT O N N 386 THR H H N N 387 THR H2 H N N 388 THR HA H N N 389 THR HB H N N 390 THR HG1 H N N 391 THR HG21 H N N 392 THR HG22 H N N 393 THR HG23 H N N 394 THR HXT H N N 395 TRP N N N N 396 TRP CA C N S 397 TRP C C N N 398 TRP O O N N 399 TRP CB C N N 400 TRP CG C Y N 401 TRP CD1 C Y N 402 TRP CD2 C Y N 403 TRP NE1 N Y N 404 TRP CE2 C Y N 405 TRP CE3 C Y N 406 TRP CZ2 C Y N 407 TRP CZ3 C Y N 408 TRP CH2 C Y N 409 TRP OXT O N N 410 TRP H H N N 411 TRP H2 H N N 412 TRP HA H N N 413 TRP HB2 H N N 414 TRP HB3 H N N 415 TRP HD1 H N N 416 TRP HE1 H N N 417 TRP HE3 H N N 418 TRP HZ2 H N N 419 TRP HZ3 H N N 420 TRP HH2 H N N 421 TRP HXT H N N 422 TYR N N N N 423 TYR CA C N S 424 TYR C C N N 425 TYR O O N N 426 TYR CB C N N 427 TYR CG C Y N 428 TYR CD1 C Y N 429 TYR CD2 C Y N 430 TYR CE1 C Y N 431 TYR CE2 C Y N 432 TYR CZ C Y N 433 TYR OH O N N 434 TYR OXT O N N 435 TYR H H N N 436 TYR H2 H N N 437 TYR HA H N N 438 TYR HB2 H N N 439 TYR HB3 H N N 440 TYR HD1 H N N 441 TYR HD2 H N N 442 TYR HE1 H N N 443 TYR HE2 H N N 444 TYR HH H N N 445 TYR HXT H N N 446 VAL N N N N 447 VAL CA C N S 448 VAL C C N N 449 VAL O O N N 450 VAL CB C N N 451 VAL CG1 C N N 452 VAL CG2 C N N 453 VAL OXT O N N 454 VAL H H N N 455 VAL H2 H N N 456 VAL HA H N N 457 VAL HB H N N 458 VAL HG11 H N N 459 VAL HG12 H N N 460 VAL HG13 H N N 461 VAL HG21 H N N 462 VAL HG22 H N N 463 VAL HG23 H N N 464 VAL HXT H N N 465 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 5DN O03 C02 doub N N 1 5DN C02 O01 sing N N 2 5DN C02 C04 sing N N 3 5DN C20 C19 doub Y N 4 5DN C20 C21 sing Y N 5 5DN C19 C18 sing Y N 6 5DN C04 C21 doub Y N 7 5DN C04 C05 sing Y N 8 5DN C21 C15 sing Y N 9 5DN C05 C06 doub Y N 10 5DN C18 C16 doub Y N 11 5DN C15 C16 sing Y N 12 5DN C15 N14 doub Y N 13 5DN C16 F17 sing N N 14 5DN C06 N14 sing Y N 15 5DN C06 C07 sing N N 16 5DN C08 C07 doub Y N 17 5DN C08 C09 sing Y N 18 5DN C07 C13 sing Y N 19 5DN C09 C10 doub Y N 20 5DN C13 C11 doub Y N 21 5DN C10 C11 sing Y N 22 5DN C11 BR sing N N 23 5DN O01 H1 sing N N 24 5DN C05 H2 sing N N 25 5DN C08 H3 sing N N 26 5DN C09 H4 sing N N 27 5DN C10 H5 sing N N 28 5DN C13 H6 sing N N 29 5DN C18 H7 sing N N 30 5DN C19 H8 sing N N 31 5DN C20 H9 sing N N 32 ALA N CA sing N N 33 ALA N H sing N N 34 ALA N H2 sing N N 35 ALA CA C sing N N 36 ALA CA CB sing N N 37 ALA CA HA sing N N 38 ALA C O doub N N 39 ALA C OXT sing N N 40 ALA CB HB1 sing N N 41 ALA CB HB2 sing N N 42 ALA CB HB3 sing N N 43 ALA OXT HXT sing N N 44 ARG N CA sing N N 45 ARG N H sing N N 46 ARG N H2 sing N N 47 ARG CA C sing N N 48 ARG CA CB sing N N 49 ARG CA HA sing N N 50 ARG C O doub N N 51 ARG C OXT sing N N 52 ARG CB CG sing N N 53 ARG CB HB2 sing N N 54 ARG CB HB3 sing N N 55 ARG CG CD sing N N 56 ARG CG HG2 sing N N 57 ARG CG HG3 sing N N 58 ARG CD NE sing N N 59 ARG CD HD2 sing N N 60 ARG CD HD3 sing N N 61 ARG NE CZ sing N N 62 ARG NE HE sing N N 63 ARG CZ NH1 sing N N 64 ARG CZ NH2 doub N N 65 ARG NH1 HH11 sing N N 66 ARG NH1 HH12 sing N N 67 ARG NH2 HH21 sing N N 68 ARG NH2 HH22 sing N N 69 ARG OXT HXT sing N N 70 ASN N CA sing N N 71 ASN N H sing N N 72 ASN N H2 sing N N 73 ASN CA C sing N N 74 ASN CA CB sing N N 75 ASN CA HA sing N N 76 ASN C O doub N N 77 ASN C OXT sing N N 78 ASN CB CG sing N N 79 ASN CB HB2 sing N N 80 ASN CB HB3 sing N N 81 ASN CG OD1 doub N N 82 ASN CG ND2 sing N N 83 ASN ND2 HD21 sing N N 84 ASN ND2 HD22 sing N N 85 ASN OXT HXT sing N N 86 ASP N CA sing N N 87 ASP N H sing N N 88 ASP N H2 sing N N 89 ASP CA C sing N N 90 ASP CA CB sing N N 91 ASP CA HA sing N N 92 ASP C O doub N N 93 ASP C OXT sing N N 94 ASP CB CG sing N N 95 ASP CB HB2 sing N N 96 ASP CB HB3 sing N N 97 ASP CG OD1 doub N N 98 ASP CG OD2 sing N N 99 ASP OD2 HD2 sing N N 100 ASP OXT HXT sing N N 101 ATP PG O1G doub N N 102 ATP PG O2G sing N N 103 ATP PG O3G sing N N 104 ATP PG O3B sing N N 105 ATP O2G HOG2 sing N N 106 ATP O3G HOG3 sing N N 107 ATP PB O1B doub N N 108 ATP PB O2B sing N N 109 ATP PB O3B sing N N 110 ATP PB O3A sing N N 111 ATP O2B HOB2 sing N N 112 ATP PA O1A doub N N 113 ATP PA O2A sing N N 114 ATP PA O3A sing N N 115 ATP PA "O5'" sing N N 116 ATP O2A HOA2 sing N N 117 ATP "O5'" "C5'" sing N N 118 ATP "C5'" "C4'" sing N N 119 ATP "C5'" "H5'1" sing N N 120 ATP "C5'" "H5'2" sing N N 121 ATP "C4'" "O4'" sing N N 122 ATP "C4'" "C3'" sing N N 123 ATP "C4'" "H4'" sing N N 124 ATP "O4'" "C1'" sing N N 125 ATP "C3'" "O3'" sing N N 126 ATP "C3'" "C2'" sing N N 127 ATP "C3'" "H3'" sing N N 128 ATP "O3'" "HO3'" sing N N 129 ATP "C2'" "O2'" sing N N 130 ATP "C2'" "C1'" sing N N 131 ATP "C2'" "H2'" sing N N 132 ATP "O2'" "HO2'" sing N N 133 ATP "C1'" N9 sing N N 134 ATP "C1'" "H1'" sing N N 135 ATP N9 C8 sing Y N 136 ATP N9 C4 sing Y N 137 ATP C8 N7 doub Y N 138 ATP C8 H8 sing N N 139 ATP N7 C5 sing Y N 140 ATP C5 C6 sing Y N 141 ATP C5 C4 doub Y N 142 ATP C6 N6 sing N N 143 ATP C6 N1 doub Y N 144 ATP N6 HN61 sing N N 145 ATP N6 HN62 sing N N 146 ATP N1 C2 sing Y N 147 ATP C2 N3 doub Y N 148 ATP C2 H2 sing N N 149 ATP N3 C4 sing Y N 150 CYS N CA sing N N 151 CYS N H sing N N 152 CYS N H2 sing N N 153 CYS CA C sing N N 154 CYS CA CB sing N N 155 CYS CA HA sing N N 156 CYS C O doub N N 157 CYS C OXT sing N N 158 CYS CB SG sing N N 159 CYS CB HB2 sing N N 160 CYS CB HB3 sing N N 161 CYS SG HG sing N N 162 CYS OXT HXT sing N N 163 GLN N CA sing N N 164 GLN N H sing N N 165 GLN N H2 sing N N 166 GLN CA C sing N N 167 GLN CA CB sing N N 168 GLN CA HA sing N N 169 GLN C O doub N N 170 GLN C OXT sing N N 171 GLN CB CG sing N N 172 GLN CB HB2 sing N N 173 GLN CB HB3 sing N N 174 GLN CG CD sing N N 175 GLN CG HG2 sing N N 176 GLN CG HG3 sing N N 177 GLN CD OE1 doub N N 178 GLN CD NE2 sing N N 179 GLN NE2 HE21 sing N N 180 GLN NE2 HE22 sing N N 181 GLN OXT HXT sing N N 182 GLU N CA sing N N 183 GLU N H sing N N 184 GLU N H2 sing N N 185 GLU CA C sing N N 186 GLU CA CB sing N N 187 GLU CA HA sing N N 188 GLU C O doub N N 189 GLU C OXT sing N N 190 GLU CB CG sing N N 191 GLU CB HB2 sing N N 192 GLU CB HB3 sing N N 193 GLU CG CD sing N N 194 GLU CG HG2 sing N N 195 GLU CG HG3 sing N N 196 GLU CD OE1 doub N N 197 GLU CD OE2 sing N N 198 GLU OE2 HE2 sing N N 199 GLU OXT HXT sing N N 200 GLY N CA sing N N 201 GLY N H sing N N 202 GLY N H2 sing N N 203 GLY CA C sing N N 204 GLY CA HA2 sing N N 205 GLY CA HA3 sing N N 206 GLY C O doub N N 207 GLY C OXT sing N N 208 GLY OXT HXT sing N N 209 HIS N CA sing N N 210 HIS N H sing N N 211 HIS N H2 sing N N 212 HIS CA C sing N N 213 HIS CA CB sing N N 214 HIS CA HA sing N N 215 HIS C O doub N N 216 HIS C OXT sing N N 217 HIS CB CG sing N N 218 HIS CB HB2 sing N N 219 HIS CB HB3 sing N N 220 HIS CG ND1 sing Y N 221 HIS CG CD2 doub Y N 222 HIS ND1 CE1 doub Y N 223 HIS ND1 HD1 sing N N 224 HIS CD2 NE2 sing Y N 225 HIS CD2 HD2 sing N N 226 HIS CE1 NE2 sing Y N 227 HIS CE1 HE1 sing N N 228 HIS NE2 HE2 sing N N 229 HIS OXT HXT sing N N 230 ILE N CA sing N N 231 ILE N H sing N N 232 ILE N H2 sing N N 233 ILE CA C sing N N 234 ILE CA CB sing N N 235 ILE CA HA sing N N 236 ILE C O doub N N 237 ILE C OXT sing N N 238 ILE CB CG1 sing N N 239 ILE CB CG2 sing N N 240 ILE CB HB sing N N 241 ILE CG1 CD1 sing N N 242 ILE CG1 HG12 sing N N 243 ILE CG1 HG13 sing N N 244 ILE CG2 HG21 sing N N 245 ILE CG2 HG22 sing N N 246 ILE CG2 HG23 sing N N 247 ILE CD1 HD11 sing N N 248 ILE CD1 HD12 sing N N 249 ILE CD1 HD13 sing N N 250 ILE OXT HXT sing N N 251 LEU N CA sing N N 252 LEU N H sing N N 253 LEU N H2 sing N N 254 LEU CA C sing N N 255 LEU CA CB sing N N 256 LEU CA HA sing N N 257 LEU C O doub N N 258 LEU C OXT sing N N 259 LEU CB CG sing N N 260 LEU CB HB2 sing N N 261 LEU CB HB3 sing N N 262 LEU CG CD1 sing N N 263 LEU CG CD2 sing N N 264 LEU CG HG sing N N 265 LEU CD1 HD11 sing N N 266 LEU CD1 HD12 sing N N 267 LEU CD1 HD13 sing N N 268 LEU CD2 HD21 sing N N 269 LEU CD2 HD22 sing N N 270 LEU CD2 HD23 sing N N 271 LEU OXT HXT sing N N 272 LYS N CA sing N N 273 LYS N H sing N N 274 LYS N H2 sing N N 275 LYS CA C sing N N 276 LYS CA CB sing N N 277 LYS CA HA sing N N 278 LYS C O doub N N 279 LYS C OXT sing N N 280 LYS CB CG sing N N 281 LYS CB HB2 sing N N 282 LYS CB HB3 sing N N 283 LYS CG CD sing N N 284 LYS CG HG2 sing N N 285 LYS CG HG3 sing N N 286 LYS CD CE sing N N 287 LYS CD HD2 sing N N 288 LYS CD HD3 sing N N 289 LYS CE NZ sing N N 290 LYS CE HE2 sing N N 291 LYS CE HE3 sing N N 292 LYS NZ HZ1 sing N N 293 LYS NZ HZ2 sing N N 294 LYS NZ HZ3 sing N N 295 LYS OXT HXT sing N N 296 MET N CA sing N N 297 MET N H sing N N 298 MET N H2 sing N N 299 MET CA C sing N N 300 MET CA CB sing N N 301 MET CA HA sing N N 302 MET C O doub N N 303 MET C OXT sing N N 304 MET CB CG sing N N 305 MET CB HB2 sing N N 306 MET CB HB3 sing N N 307 MET CG SD sing N N 308 MET CG HG2 sing N N 309 MET CG HG3 sing N N 310 MET SD CE sing N N 311 MET CE HE1 sing N N 312 MET CE HE2 sing N N 313 MET CE HE3 sing N N 314 MET OXT HXT sing N N 315 PHE N CA sing N N 316 PHE N H sing N N 317 PHE N H2 sing N N 318 PHE CA C sing N N 319 PHE CA CB sing N N 320 PHE CA HA sing N N 321 PHE C O doub N N 322 PHE C OXT sing N N 323 PHE CB CG sing N N 324 PHE CB HB2 sing N N 325 PHE CB HB3 sing N N 326 PHE CG CD1 doub Y N 327 PHE CG CD2 sing Y N 328 PHE CD1 CE1 sing Y N 329 PHE CD1 HD1 sing N N 330 PHE CD2 CE2 doub Y N 331 PHE CD2 HD2 sing N N 332 PHE CE1 CZ doub Y N 333 PHE CE1 HE1 sing N N 334 PHE CE2 CZ sing Y N 335 PHE CE2 HE2 sing N N 336 PHE CZ HZ sing N N 337 PHE OXT HXT sing N N 338 PRO N CA sing N N 339 PRO N CD sing N N 340 PRO N H sing N N 341 PRO CA C sing N N 342 PRO CA CB sing N N 343 PRO CA HA sing N N 344 PRO C O doub N N 345 PRO C OXT sing N N 346 PRO CB CG sing N N 347 PRO CB HB2 sing N N 348 PRO CB HB3 sing N N 349 PRO CG CD sing N N 350 PRO CG HG2 sing N N 351 PRO CG HG3 sing N N 352 PRO CD HD2 sing N N 353 PRO CD HD3 sing N N 354 PRO OXT HXT sing N N 355 SER N CA sing N N 356 SER N H sing N N 357 SER N H2 sing N N 358 SER CA C sing N N 359 SER CA CB sing N N 360 SER CA HA sing N N 361 SER C O doub N N 362 SER C OXT sing N N 363 SER CB OG sing N N 364 SER CB HB2 sing N N 365 SER CB HB3 sing N N 366 SER OG HG sing N N 367 SER OXT HXT sing N N 368 THR N CA sing N N 369 THR N H sing N N 370 THR N H2 sing N N 371 THR CA C sing N N 372 THR CA CB sing N N 373 THR CA HA sing N N 374 THR C O doub N N 375 THR C OXT sing N N 376 THR CB OG1 sing N N 377 THR CB CG2 sing N N 378 THR CB HB sing N N 379 THR OG1 HG1 sing N N 380 THR CG2 HG21 sing N N 381 THR CG2 HG22 sing N N 382 THR CG2 HG23 sing N N 383 THR OXT HXT sing N N 384 TRP N CA sing N N 385 TRP N H sing N N 386 TRP N H2 sing N N 387 TRP CA C sing N N 388 TRP CA CB sing N N 389 TRP CA HA sing N N 390 TRP C O doub N N 391 TRP C OXT sing N N 392 TRP CB CG sing N N 393 TRP CB HB2 sing N N 394 TRP CB HB3 sing N N 395 TRP CG CD1 doub Y N 396 TRP CG CD2 sing Y N 397 TRP CD1 NE1 sing Y N 398 TRP CD1 HD1 sing N N 399 TRP CD2 CE2 doub Y N 400 TRP CD2 CE3 sing Y N 401 TRP NE1 CE2 sing Y N 402 TRP NE1 HE1 sing N N 403 TRP CE2 CZ2 sing Y N 404 TRP CE3 CZ3 doub Y N 405 TRP CE3 HE3 sing N N 406 TRP CZ2 CH2 doub Y N 407 TRP CZ2 HZ2 sing N N 408 TRP CZ3 CH2 sing Y N 409 TRP CZ3 HZ3 sing N N 410 TRP CH2 HH2 sing N N 411 TRP OXT HXT sing N N 412 TYR N CA sing N N 413 TYR N H sing N N 414 TYR N H2 sing N N 415 TYR CA C sing N N 416 TYR CA CB sing N N 417 TYR CA HA sing N N 418 TYR C O doub N N 419 TYR C OXT sing N N 420 TYR CB CG sing N N 421 TYR CB HB2 sing N N 422 TYR CB HB3 sing N N 423 TYR CG CD1 doub Y N 424 TYR CG CD2 sing Y N 425 TYR CD1 CE1 sing Y N 426 TYR CD1 HD1 sing N N 427 TYR CD2 CE2 doub Y N 428 TYR CD2 HD2 sing N N 429 TYR CE1 CZ doub Y N 430 TYR CE1 HE1 sing N N 431 TYR CE2 CZ sing Y N 432 TYR CE2 HE2 sing N N 433 TYR CZ OH sing N N 434 TYR OH HH sing N N 435 TYR OXT HXT sing N N 436 VAL N CA sing N N 437 VAL N H sing N N 438 VAL N H2 sing N N 439 VAL CA C sing N N 440 VAL CA CB sing N N 441 VAL CA HA sing N N 442 VAL C O doub N N 443 VAL C OXT sing N N 444 VAL CB CG1 sing N N 445 VAL CB CG2 sing N N 446 VAL CB HB sing N N 447 VAL CG1 HG11 sing N N 448 VAL CG1 HG12 sing N N 449 VAL CG1 HG13 sing N N 450 VAL CG2 HG21 sing N N 451 VAL CG2 HG22 sing N N 452 VAL CG2 HG23 sing N N 453 VAL OXT HXT sing N N 454 # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 'Strategic Award 090340/Z/09/Z' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3FDN _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5DT4 _atom_sites.fract_transf_matrix[1][1] 0.012121 _atom_sites.fract_transf_matrix[1][2] 0.006998 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013996 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005882 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol BR C F MG N O P S # loop_