data_5E0Y # _entry.id 5E0Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5E0Y pdb_00005e0y 10.2210/pdb5e0y/pdb WWPDB D_1000214028 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-09-14 2 'Structure model' 1 1 2016-09-21 3 'Structure model' 1 2 2016-11-09 4 'Structure model' 1 3 2017-09-13 5 'Structure model' 1 4 2019-12-25 6 'Structure model' 1 5 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Author supporting evidence' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' 9 6 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' pdbx_audit_support 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' pdbx_audit_support 5 6 'Structure model' chem_comp_atom 6 6 'Structure model' chem_comp_bond 7 6 'Structure model' database_2 8 6 'Structure model' pdbx_struct_conn_angle 9 6 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 5 'Structure model' '_pdbx_audit_support.funding_organization' 5 6 'Structure model' '_database_2.pdbx_DOI' 6 6 'Structure model' '_database_2.pdbx_database_accession' 7 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 8 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 9 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_alt_id' 10 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 11 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 12 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 13 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 14 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 15 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 16 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 17 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_alt_id' 18 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 19 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 20 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 21 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 22 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 23 6 'Structure model' '_pdbx_struct_conn_angle.value' 24 6 'Structure model' '_struct_conn.pdbx_dist_value' 25 6 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id' 26 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 27 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 6 'Structure model' '_struct_conn.ptnr1_label_asym_id' 29 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 30 6 'Structure model' '_struct_conn.ptnr1_label_comp_id' 31 6 'Structure model' '_struct_conn.ptnr1_label_seq_id' 32 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 33 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 34 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' 35 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 36 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' 37 6 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5E0Y _pdbx_database_status.recvd_initial_deposition_date 2015-09-29 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '3OUV contains a related structure to be published together with this deposition' 3OUV unspecified PDB . 5E0Z unspecified PDB . 5E10 unspecified PDB . 5E12 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Prigozhin, D.M.' 1 'TB Structural Genomics Consortium (TBSGC)' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 291 _citation.language ? _citation.page_first 22961 _citation.page_last 22969 _citation.title ;Structural and Genetic Analyses of the Mycobacterium tuberculosis Protein Kinase B Sensor Domain Identify a Potential Ligand-binding Site. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M116.731760 _citation.pdbx_database_id_PubMed 27601474 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Prigozhin, D.M.' 1 ? primary 'Papavinasasundaram, K.G.' 2 ? primary 'Baer, C.E.' 3 ? primary 'Murphy, K.C.' 4 ? primary 'Moskaleva, A.' 5 ? primary 'Chen, T.Y.' 6 ? primary 'Alber, T.' 7 ? primary 'Sassetti, C.M.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase PknB' 7792.748 1 2.7.11.1 ? 'UNP residues 558-626' ? 2 non-polymer nat 'ZINC ION' 65.409 8 ? ? ? ? 3 water nat water 18.015 50 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GHMGNQFVMPDLSGMFWVDAEPRLRALGWTGMLDKGADVDAGGSQHNRVVYQNPPAGTGVNRDGIITLRFGQ _entity_poly.pdbx_seq_one_letter_code_can GHMGNQFVMPDLSGMFWVDAEPRLRALGWTGMLDKGADVDAGGSQHNRVVYQNPPAGTGVNRDGIITLRFGQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 GLY n 1 5 ASN n 1 6 GLN n 1 7 PHE n 1 8 VAL n 1 9 MET n 1 10 PRO n 1 11 ASP n 1 12 LEU n 1 13 SER n 1 14 GLY n 1 15 MET n 1 16 PHE n 1 17 TRP n 1 18 VAL n 1 19 ASP n 1 20 ALA n 1 21 GLU n 1 22 PRO n 1 23 ARG n 1 24 LEU n 1 25 ARG n 1 26 ALA n 1 27 LEU n 1 28 GLY n 1 29 TRP n 1 30 THR n 1 31 GLY n 1 32 MET n 1 33 LEU n 1 34 ASP n 1 35 LYS n 1 36 GLY n 1 37 ALA n 1 38 ASP n 1 39 VAL n 1 40 ASP n 1 41 ALA n 1 42 GLY n 1 43 GLY n 1 44 SER n 1 45 GLN n 1 46 HIS n 1 47 ASN n 1 48 ARG n 1 49 VAL n 1 50 VAL n 1 51 TYR n 1 52 GLN n 1 53 ASN n 1 54 PRO n 1 55 PRO n 1 56 ALA n 1 57 GLY n 1 58 THR n 1 59 GLY n 1 60 VAL n 1 61 ASN n 1 62 ARG n 1 63 ASP n 1 64 GLY n 1 65 ILE n 1 66 ILE n 1 67 THR n 1 68 LEU n 1 69 ARG n 1 70 PHE n 1 71 GLY n 1 72 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 72 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pknB, Rv0014c, MTCY10H4.14c' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 25618 / H37Rv' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 555 ? ? ? A . n A 1 2 HIS 2 556 ? ? ? A . n A 1 3 MET 3 557 ? ? ? A . n A 1 4 GLY 4 558 ? ? ? A . n A 1 5 ASN 5 559 559 ASN ASN A . n A 1 6 GLN 6 560 560 GLN GLN A . n A 1 7 PHE 7 561 561 PHE PHE A . n A 1 8 VAL 8 562 562 VAL VAL A . n A 1 9 MET 9 563 563 MET MET A . n A 1 10 PRO 10 564 564 PRO PRO A . n A 1 11 ASP 11 565 565 ASP ASP A . n A 1 12 LEU 12 566 566 LEU LEU A . n A 1 13 SER 13 567 567 SER SER A . n A 1 14 GLY 14 568 568 GLY GLY A . n A 1 15 MET 15 569 569 MET MET A . n A 1 16 PHE 16 570 570 PHE PHE A . n A 1 17 TRP 17 571 571 TRP TRP A . n A 1 18 VAL 18 572 572 VAL VAL A . n A 1 19 ASP 19 573 573 ASP ASP A . n A 1 20 ALA 20 574 574 ALA ALA A . n A 1 21 GLU 21 575 575 GLU GLU A . n A 1 22 PRO 22 576 576 PRO PRO A . n A 1 23 ARG 23 577 577 ARG ARG A . n A 1 24 LEU 24 578 578 LEU LEU A . n A 1 25 ARG 25 579 579 ARG ARG A . n A 1 26 ALA 26 580 580 ALA ALA A . n A 1 27 LEU 27 581 581 LEU LEU A . n A 1 28 GLY 28 582 582 GLY GLY A . n A 1 29 TRP 29 583 583 TRP TRP A . n A 1 30 THR 30 584 584 THR THR A . n A 1 31 GLY 31 585 585 GLY GLY A . n A 1 32 MET 32 586 586 MET MET A . n A 1 33 LEU 33 587 587 LEU LEU A . n A 1 34 ASP 34 588 588 ASP ASP A . n A 1 35 LYS 35 589 589 LYS LYS A . n A 1 36 GLY 36 590 590 GLY GLY A . n A 1 37 ALA 37 591 591 ALA ALA A . n A 1 38 ASP 38 592 592 ASP ASP A . n A 1 39 VAL 39 593 593 VAL VAL A . n A 1 40 ASP 40 594 594 ASP ASP A . n A 1 41 ALA 41 595 595 ALA ALA A . n A 1 42 GLY 42 596 596 GLY GLY A . n A 1 43 GLY 43 597 597 GLY GLY A . n A 1 44 SER 44 598 598 SER SER A . n A 1 45 GLN 45 599 599 GLN GLN A . n A 1 46 HIS 46 600 600 HIS HIS A . n A 1 47 ASN 47 601 601 ASN ASN A . n A 1 48 ARG 48 602 602 ARG ARG A . n A 1 49 VAL 49 603 603 VAL VAL A . n A 1 50 VAL 50 604 604 VAL VAL A . n A 1 51 TYR 51 605 605 TYR TYR A . n A 1 52 GLN 52 606 606 GLN GLN A . n A 1 53 ASN 53 607 607 ASN ASN A . n A 1 54 PRO 54 608 608 PRO PRO A . n A 1 55 PRO 55 609 609 PRO PRO A . n A 1 56 ALA 56 610 610 ALA ALA A . n A 1 57 GLY 57 611 611 GLY GLY A . n A 1 58 THR 58 612 612 THR THR A . n A 1 59 GLY 59 613 613 GLY GLY A . n A 1 60 VAL 60 614 614 VAL VAL A . n A 1 61 ASN 61 615 615 ASN ASN A . n A 1 62 ARG 62 616 616 ARG ARG A . n A 1 63 ASP 63 617 617 ASP ASP A . n A 1 64 GLY 64 618 618 GLY GLY A . n A 1 65 ILE 65 619 619 ILE ILE A . n A 1 66 ILE 66 620 620 ILE ILE A . n A 1 67 THR 67 621 621 THR THR A . n A 1 68 LEU 68 622 622 LEU LEU A . n A 1 69 ARG 69 623 623 ARG ARG A . n A 1 70 PHE 70 624 624 PHE PHE A . n A 1 71 GLY 71 625 625 GLY GLY A . n A 1 72 GLN 72 626 626 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 701 1 ZN ZN A . C 2 ZN 1 702 2 ZN ZN A . D 2 ZN 1 703 4 ZN ZN A . E 2 ZN 1 704 5 ZN ZN A . F 2 ZN 1 705 6 ZN ZN A . G 2 ZN 1 706 7 ZN ZN A . H 2 ZN 1 707 8 ZN ZN A . I 2 ZN 1 708 9 ZN ZN A . J 3 HOH 1 801 9 HOH HOH A . J 3 HOH 2 802 18 HOH HOH A . J 3 HOH 3 803 2 HOH HOH A . J 3 HOH 4 804 1 HOH HOH A . J 3 HOH 5 805 25 HOH HOH A . J 3 HOH 6 806 31 HOH HOH A . J 3 HOH 7 807 44 HOH HOH A . J 3 HOH 8 808 24 HOH HOH A . J 3 HOH 9 809 33 HOH HOH A . J 3 HOH 10 810 39 HOH HOH A . J 3 HOH 11 811 14 HOH HOH A . J 3 HOH 12 812 47 HOH HOH A . J 3 HOH 13 813 46 HOH HOH A . J 3 HOH 14 814 22 HOH HOH A . J 3 HOH 15 815 23 HOH HOH A . J 3 HOH 16 816 5 HOH HOH A . J 3 HOH 17 817 19 HOH HOH A . J 3 HOH 18 818 6 HOH HOH A . J 3 HOH 19 819 12 HOH HOH A . J 3 HOH 20 820 11 HOH HOH A . J 3 HOH 21 821 16 HOH HOH A . J 3 HOH 22 822 13 HOH HOH A . J 3 HOH 23 823 50 HOH HOH A . J 3 HOH 24 824 27 HOH HOH A . J 3 HOH 25 825 36 HOH HOH A . J 3 HOH 26 826 8 HOH HOH A . J 3 HOH 27 827 45 HOH HOH A . J 3 HOH 28 828 26 HOH HOH A . J 3 HOH 29 829 20 HOH HOH A . J 3 HOH 30 830 17 HOH HOH A . J 3 HOH 31 831 10 HOH HOH A . J 3 HOH 32 832 4 HOH HOH A . J 3 HOH 33 833 7 HOH HOH A . J 3 HOH 34 834 32 HOH HOH A . J 3 HOH 35 835 34 HOH HOH A . J 3 HOH 36 836 41 HOH HOH A . J 3 HOH 37 837 40 HOH HOH A . J 3 HOH 38 838 49 HOH HOH A . J 3 HOH 39 839 30 HOH HOH A . J 3 HOH 40 840 21 HOH HOH A . J 3 HOH 41 841 3 HOH HOH A . J 3 HOH 42 842 43 HOH HOH A . J 3 HOH 43 843 38 HOH HOH A . J 3 HOH 44 844 15 HOH HOH A . J 3 HOH 45 845 37 HOH HOH A . J 3 HOH 46 846 35 HOH HOH A . J 3 HOH 47 847 29 HOH HOH A . J 3 HOH 48 848 48 HOH HOH A . J 3 HOH 49 849 42 HOH HOH A . J 3 HOH 50 850 28 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SOLVE ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5E0Y _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.658 _cell.length_a_esd ? _cell.length_b 41.658 _cell.length_b_esd ? _cell.length_c 122.517 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5E0Y _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5E0Y _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M zinc acetate, 0.1 M imidazole pH 8, and 20% PEG 3000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2009-10-18 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double flat crystal, Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.2824 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.2824 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5E0Y _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.000 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4409 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.300 _reflns.pdbx_Rmerge_I_obs 0.097 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 21.110 _reflns.pdbx_netI_over_sigmaI 21.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.123 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 67586 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.000 2.030 ? ? ? ? ? 98 ? 44.300 ? ? ? ? 0.362 ? ? ? ? ? ? ? ? 3.600 ? 0.960 ? ? ? ? 0 1 1 ? ? 2.030 2.070 ? ? ? ? ? 142 ? 63.700 ? ? ? ? 0.287 ? ? ? ? ? ? ? ? 4.100 ? 1.119 ? ? ? ? 0 2 1 ? ? 2.070 2.110 ? ? ? ? ? 168 ? 71.500 ? ? ? ? 0.277 ? ? ? ? ? ? ? ? 4.400 ? 1.372 ? ? ? ? 0 3 1 ? ? 2.110 2.150 ? ? ? ? ? 177 ? 79.700 ? ? ? ? 0.250 ? ? ? ? ? ? ? ? 5.600 ? 1.131 ? ? ? ? 0 4 1 ? ? 2.150 2.200 ? ? ? ? ? 212 ? 89.500 ? ? ? ? 0.203 ? ? ? ? ? ? ? ? 6.600 ? 1.293 ? ? ? ? 0 5 1 ? ? 2.200 2.250 ? ? ? ? ? 205 ? 92.800 ? ? ? ? 0.212 ? ? ? ? ? ? ? ? 7.300 ? 1.221 ? ? ? ? 0 6 1 ? ? 2.250 2.310 ? ? ? ? ? 234 ? 98.300 ? ? ? ? 0.174 ? ? ? ? ? ? ? ? 9.000 ? 1.187 ? ? ? ? 0 7 1 ? ? 2.310 2.370 ? ? ? ? ? 214 ? 100.000 ? ? ? ? 0.205 ? ? ? ? ? ? ? ? 10.000 ? 1.158 ? ? ? ? 0 8 1 ? ? 2.370 2.440 ? ? ? ? ? 241 ? 100.000 ? ? ? ? 0.208 ? ? ? ? ? ? ? ? 13.000 ? 1.257 ? ? ? ? 0 9 1 ? ? 2.440 2.520 ? ? ? ? ? 223 ? 100.000 ? ? ? ? 0.170 ? ? ? ? ? ? ? ? 16.200 ? 1.142 ? ? ? ? 0 10 1 ? ? 2.520 2.610 ? ? ? ? ? 248 ? 100.000 ? ? ? ? 0.145 ? ? ? ? ? ? ? ? 20.700 ? 1.105 ? ? ? ? 0 11 1 ? ? 2.610 2.710 ? ? ? ? ? 215 ? 100.000 ? ? ? ? 0.141 ? ? ? ? ? ? ? ? 22.200 ? 1.108 ? ? ? ? 0 12 1 ? ? 2.710 2.840 ? ? ? ? ? 243 ? 100.000 ? ? ? ? 0.125 ? ? ? ? ? ? ? ? 21.700 ? 1.107 ? ? ? ? 0 13 1 ? ? 2.840 2.990 ? ? ? ? ? 249 ? 100.000 ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 21.300 ? 1.273 ? ? ? ? 0 14 1 ? ? 2.990 3.170 ? ? ? ? ? 230 ? 100.000 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 21.900 ? 1.072 ? ? ? ? 0 15 1 ? ? 3.170 3.420 ? ? ? ? ? 242 ? 100.000 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 21.200 ? 1.156 ? ? ? ? 0 16 1 ? ? 3.420 3.760 ? ? ? ? ? 247 ? 100.000 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 20.800 ? 1.045 ? ? ? ? 0 17 1 ? ? 3.760 4.310 ? ? ? ? ? 251 ? 100.000 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 20.200 ? 1.037 ? ? ? ? 0 18 1 ? ? 4.310 5.430 ? ? ? ? ? 260 ? 100.000 ? ? ? ? 0.089 ? ? ? ? ? ? ? ? 19.500 ? 1.059 ? ? ? ? 0 19 1 ? ? 5.430 50.000 ? ? ? ? ? 310 ? 99.700 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 16.500 ? 1.038 ? ? ? ? 0 20 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 60.150 _refine.B_iso_mean 24.1152 _refine.B_iso_min 3.860 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5E0Y _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0010 _refine.ls_d_res_low 34.6080 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4342 _refine.ls_number_reflns_R_free 436 _refine.ls_number_reflns_R_work 3906 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.0300 _refine.ls_percent_reflns_R_free 10.0400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2201 _refine.ls_R_factor_R_free 0.2639 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2153 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.1900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.0010 _refine_hist.d_res_low 34.6080 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 580 _refine_hist.pdbx_number_residues_total 68 _refine_hist.pdbx_B_iso_mean_ligand 37.14 _refine_hist.pdbx_B_iso_mean_solvent 31.80 _refine_hist.pdbx_number_atoms_protein 521 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 565 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.908 ? 772 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.034 ? 78 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 107 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.037 ? 206 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0012 2.2907 1126 . 114 1012 75.0000 . . . 0.3013 . 0.2359 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 2.2907 2.8858 1538 . 154 1384 100.0000 . . . 0.2822 . 0.2305 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 2.8858 34.6128 1678 . 168 1510 100.0000 . . . 0.2463 . 0.2034 . . . . . . 3 . . . # _struct.entry_id 5E0Y _struct.title 'Crystal Structure of PASTA Domain 4 of Mycobacterium tuberculosis Protein Kinase B' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5E0Y _struct_keywords.text ;kinase, extracellular sensor domain, peptidoglycan binding, Structural Genomics, TB Structural Genomics Consortium, TBSGC, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PKNB_MYCTU _struct_ref.pdbx_db_accession P9WI81 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GNQFVMPDLSGMFWVDAEPRLRALGWTGMLDKGADVDAGGSQHNRVVYQNPPAGTGVNRDGIITLRFGQ _struct_ref.pdbx_align_begin 558 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5E0Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WI81 _struct_ref_seq.db_align_beg 558 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 626 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 558 _struct_ref_seq.pdbx_auth_seq_align_end 626 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5E0Y GLY A 1 ? UNP P9WI81 ? ? 'expression tag' 555 1 1 5E0Y HIS A 2 ? UNP P9WI81 ? ? 'expression tag' 556 2 1 5E0Y MET A 3 ? UNP P9WI81 ? ? 'expression tag' 557 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 560 ? 1 MORE -147 ? 1 'SSA (A^2)' 4200 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 16 ? LEU A 27 ? PHE A 570 LEU A 581 1 ? 12 HELX_P HELX_P2 AA2 GLY A 42 ? HIS A 46 ? GLY A 596 HIS A 600 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 19 OD1 ? ? ? 1_555 D ZN . ZN ? ? A ASP 573 A ZN 703 1_555 ? ? ? ? ? ? ? 2.237 ? ? metalc2 metalc ? ? A GLU 21 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 575 A ZN 702 1_555 ? ? ? ? ? ? ? 2.013 ? ? metalc3 metalc ? ? A GLU 21 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 575 A ZN 702 10_666 ? ? ? ? ? ? ? 2.659 ? ? metalc4 metalc ? ? A GLU 21 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 575 A ZN 702 10_666 ? ? ? ? ? ? ? 2.019 ? ? metalc5 metalc ? ? A LYS 35 NZ ? ? ? 1_555 H ZN . ZN ? ? A LYS 589 A ZN 707 1_555 ? ? ? ? ? ? ? 2.528 ? ? metalc6 metalc ? ? A ASP 40 OD1 ? ? ? 1_555 E ZN . ZN ? ? A ASP 594 A ZN 704 1_555 ? ? ? ? ? ? ? 2.101 ? ? metalc7 metalc ? ? A ASP 40 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 594 A ZN 704 1_555 ? ? ? ? ? ? ? 2.176 ? ? metalc8 metalc ? ? A HIS 46 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 600 A ZN 701 1_555 ? ? ? ? ? ? ? 2.116 ? ? metalc9 metalc ? ? A HIS 46 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 600 A ZN 701 10_776 ? ? ? ? ? ? ? 2.336 ? ? metalc10 metalc ? ? A TYR 51 OH B ? ? 1_555 E ZN . ZN ? ? A TYR 605 A ZN 704 8_676 ? ? ? ? ? ? ? 1.998 ? ? metalc11 metalc ? ? A GLN 72 O ? ? ? 1_555 B ZN . ZN ? ? A GLN 626 A ZN 701 1_555 ? ? ? ? ? ? ? 2.586 ? ? metalc12 metalc ? ? A GLN 72 OXT ? ? ? 1_555 B ZN . ZN ? ? A GLN 626 A ZN 701 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc13 metalc ? ? A GLN 72 O ? ? ? 1_555 B ZN . ZN ? ? A GLN 626 A ZN 701 10_776 ? ? ? ? ? ? ? 2.675 ? ? metalc14 metalc ? ? A GLN 72 OXT ? ? ? 1_555 B ZN . ZN ? ? A GLN 626 A ZN 701 10_776 ? ? ? ? ? ? ? 2.106 ? ? metalc15 metalc ? ? C ZN . ZN ? ? ? 1_555 J HOH . O ? ? A ZN 702 A HOH 837 1_555 ? ? ? ? ? ? ? 2.067 ? ? metalc16 metalc ? ? C ZN . ZN ? ? ? 1_555 J HOH . O ? ? A ZN 702 A HOH 837 10_666 ? ? ? ? ? ? ? 2.216 ? ? metalc17 metalc ? ? D ZN . ZN ? ? ? 1_555 J HOH . O ? ? A ZN 703 A HOH 845 5_565 ? ? ? ? ? ? ? 2.141 ? ? metalc18 metalc ? ? E ZN . ZN ? ? ? 1_555 J HOH . O ? ? A ZN 704 A HOH 836 8_676 ? ? ? ? ? ? ? 2.444 ? ? metalc19 metalc ? ? E ZN . ZN ? ? ? 1_555 J HOH . O ? ? A ZN 704 A HOH 844 1_555 ? ? ? ? ? ? ? 2.569 ? ? metalc20 metalc ? ? H ZN . ZN ? ? ? 1_555 J HOH . O ? ? A ZN 707 A HOH 810 1_555 ? ? ? ? ? ? ? 2.069 ? ? metalc21 metalc ? ? I ZN . ZN ? ? ? 1_555 J HOH . O ? ? A ZN 708 A HOH 810 1_555 ? ? ? ? ? ? ? 2.115 ? ? metalc22 metalc ? ? I ZN . ZN ? ? ? 1_555 J HOH . O ? ? A ZN 708 A HOH 844 10_776 ? ? ? ? ? ? ? 2.186 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 19 ? A ASP 573 ? 1_555 ZN ? D ZN . ? A ZN 703 ? 1_555 O ? J HOH . ? A HOH 845 ? 5_565 100.0 ? 2 OE2 ? A GLU 21 ? A GLU 575 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 OE1 ? A GLU 21 ? A GLU 575 ? 1_555 52.2 ? 3 OE2 ? A GLU 21 ? A GLU 575 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 OE2 ? A GLU 21 ? A GLU 575 ? 1_555 0.0 ? 4 OE1 ? A GLU 21 ? A GLU 575 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 OE2 ? A GLU 21 ? A GLU 575 ? 1_555 52.2 ? 5 OE2 ? A GLU 21 ? A GLU 575 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 O ? J HOH . ? A HOH 837 ? 1_555 101.6 ? 6 OE1 ? A GLU 21 ? A GLU 575 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 O ? J HOH . ? A HOH 837 ? 1_555 153.1 ? 7 OE2 ? A GLU 21 ? A GLU 575 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 O ? J HOH . ? A HOH 837 ? 1_555 101.6 ? 8 OE2 ? A GLU 21 ? A GLU 575 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 O ? J HOH . ? A HOH 837 ? 10_666 113.5 ? 9 OE1 ? A GLU 21 ? A GLU 575 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 O ? J HOH . ? A HOH 837 ? 10_666 105.9 ? 10 OE2 ? A GLU 21 ? A GLU 575 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 O ? J HOH . ? A HOH 837 ? 10_666 113.5 ? 11 O ? J HOH . ? A HOH 837 ? 1_555 ZN ? C ZN . ? A ZN 702 ? 1_555 O ? J HOH . ? A HOH 837 ? 10_666 89.5 ? 12 NZ ? A LYS 35 ? A LYS 589 ? 1_555 ZN ? H ZN . ? A ZN 707 ? 1_555 O ? J HOH . ? A HOH 810 ? 1_555 166.2 ? 13 OD1 ? A ASP 40 ? A ASP 594 ? 1_555 ZN ? E ZN . ? A ZN 704 ? 1_555 OD2 ? A ASP 40 ? A ASP 594 ? 1_555 61.9 ? 14 OD1 ? A ASP 40 ? A ASP 594 ? 1_555 ZN ? E ZN . ? A ZN 704 ? 1_555 OH B A TYR 51 ? A TYR 605 ? 1_555 30.4 ? 15 OD2 ? A ASP 40 ? A ASP 594 ? 1_555 ZN ? E ZN . ? A ZN 704 ? 1_555 OH B A TYR 51 ? A TYR 605 ? 1_555 53.7 ? 16 OD1 ? A ASP 40 ? A ASP 594 ? 1_555 ZN ? E ZN . ? A ZN 704 ? 1_555 O ? J HOH . ? A HOH 836 ? 8_676 135.1 ? 17 OD2 ? A ASP 40 ? A ASP 594 ? 1_555 ZN ? E ZN . ? A ZN 704 ? 1_555 O ? J HOH . ? A HOH 836 ? 8_676 88.9 ? 18 OH B A TYR 51 ? A TYR 605 ? 1_555 ZN ? E ZN . ? A ZN 704 ? 1_555 O ? J HOH . ? A HOH 836 ? 8_676 105.0 ? 19 OD1 ? A ASP 40 ? A ASP 594 ? 1_555 ZN ? E ZN . ? A ZN 704 ? 1_555 O ? J HOH . ? A HOH 844 ? 1_555 99.1 ? 20 OD2 ? A ASP 40 ? A ASP 594 ? 1_555 ZN ? E ZN . ? A ZN 704 ? 1_555 O ? J HOH . ? A HOH 844 ? 1_555 89.2 ? 21 OH B A TYR 51 ? A TYR 605 ? 1_555 ZN ? E ZN . ? A ZN 704 ? 1_555 O ? J HOH . ? A HOH 844 ? 1_555 124.6 ? 22 O ? J HOH . ? A HOH 836 ? 8_676 ZN ? E ZN . ? A ZN 704 ? 1_555 O ? J HOH . ? A HOH 844 ? 1_555 114.9 ? 23 ND1 ? A HIS 46 ? A HIS 600 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 ND1 ? A HIS 46 ? A HIS 600 ? 1_555 0.0 ? 24 ND1 ? A HIS 46 ? A HIS 600 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O ? A GLN 72 ? A GLN 626 ? 1_555 90.6 ? 25 ND1 ? A HIS 46 ? A HIS 600 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O ? A GLN 72 ? A GLN 626 ? 1_555 90.6 ? 26 ND1 ? A HIS 46 ? A HIS 600 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 OXT ? A GLN 72 ? A GLN 626 ? 1_555 104.8 ? 27 ND1 ? A HIS 46 ? A HIS 600 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 OXT ? A GLN 72 ? A GLN 626 ? 1_555 104.8 ? 28 O ? A GLN 72 ? A GLN 626 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 OXT ? A GLN 72 ? A GLN 626 ? 1_555 51.6 ? 29 ND1 ? A HIS 46 ? A HIS 600 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O ? A GLN 72 ? A GLN 626 ? 1_555 90.6 ? 30 ND1 ? A HIS 46 ? A HIS 600 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O ? A GLN 72 ? A GLN 626 ? 1_555 90.6 ? 31 O ? A GLN 72 ? A GLN 626 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O ? A GLN 72 ? A GLN 626 ? 1_555 0.0 ? 32 OXT ? A GLN 72 ? A GLN 626 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O ? A GLN 72 ? A GLN 626 ? 1_555 51.6 ? 33 ND1 ? A HIS 46 ? A HIS 600 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 OXT ? A GLN 72 ? A GLN 626 ? 1_555 104.8 ? 34 ND1 ? A HIS 46 ? A HIS 600 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 OXT ? A GLN 72 ? A GLN 626 ? 1_555 104.8 ? 35 O ? A GLN 72 ? A GLN 626 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 OXT ? A GLN 72 ? A GLN 626 ? 1_555 51.6 ? 36 OXT ? A GLN 72 ? A GLN 626 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 OXT ? A GLN 72 ? A GLN 626 ? 1_555 0.0 ? 37 O ? A GLN 72 ? A GLN 626 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 OXT ? A GLN 72 ? A GLN 626 ? 1_555 51.6 ? 38 O ? J HOH . ? A HOH 810 ? 1_555 ZN ? I ZN . ? A ZN 708 ? 1_555 O ? J HOH . ? A HOH 844 ? 10_776 89.3 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 53 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 607 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 54 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 608 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.81 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 7 ? VAL A 8 ? PHE A 561 VAL A 562 AA1 2 GLY A 59 ? VAL A 60 ? GLY A 613 VAL A 614 AA2 1 LEU A 33 ? LYS A 35 ? LEU A 587 LYS A 589 AA2 2 ILE A 66 ? PHE A 70 ? ILE A 620 PHE A 624 AA2 3 VAL A 49 ? ASN A 53 ? VAL A 603 ASN A 607 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 7 ? N PHE A 561 O VAL A 60 ? O VAL A 614 AA2 1 2 N ASP A 34 ? N ASP A 588 O ILE A 66 ? O ILE A 620 AA2 2 3 O ARG A 69 ? O ARG A 623 N VAL A 50 ? N VAL A 604 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 701 ? 4 'binding site for residue ZN A 701' AC2 Software A ZN 702 ? 6 'binding site for residue ZN A 702' AC3 Software A ZN 703 ? 2 'binding site for residue ZN A 703' AC4 Software A ZN 704 ? 6 'binding site for residue ZN A 704' AC5 Software A ZN 705 ? 6 'binding site for residue ZN A 705' AC6 Software A ZN 706 ? 5 'binding site for residue ZN A 706' AC7 Software A ZN 707 ? 4 'binding site for residue ZN A 707' AC8 Software A ZN 708 ? 7 'binding site for residue ZN A 708' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 46 ? HIS A 600 . ? 1_555 ? 2 AC1 4 HIS A 46 ? HIS A 600 . ? 10_776 ? 3 AC1 4 GLN A 72 ? GLN A 626 . ? 10_776 ? 4 AC1 4 GLN A 72 ? GLN A 626 . ? 1_555 ? 5 AC2 6 GLU A 21 ? GLU A 575 . ? 1_555 ? 6 AC2 6 GLU A 21 ? GLU A 575 . ? 10_666 ? 7 AC2 6 HOH J . ? HOH A 837 . ? 1_555 ? 8 AC2 6 HOH J . ? HOH A 837 . ? 10_666 ? 9 AC2 6 HOH J . ? HOH A 841 . ? 10_666 ? 10 AC2 6 HOH J . ? HOH A 841 . ? 1_555 ? 11 AC3 2 ASP A 19 ? ASP A 573 . ? 1_555 ? 12 AC3 2 HOH J . ? HOH A 845 . ? 5_565 ? 13 AC4 6 ASP A 40 ? ASP A 594 . ? 1_555 ? 14 AC4 6 HIS A 46 ? HIS A 600 . ? 10_776 ? 15 AC4 6 TYR A 51 ? TYR A 605 . ? 8_676 ? 16 AC4 6 ZN F . ? ZN A 705 . ? 10_776 ? 17 AC4 6 HOH J . ? HOH A 836 . ? 8_676 ? 18 AC4 6 HOH J . ? HOH A 844 . ? 1_555 ? 19 AC5 6 VAL A 39 ? VAL A 593 . ? 5_565 ? 20 AC5 6 ASP A 40 ? ASP A 594 . ? 10_776 ? 21 AC5 6 HIS A 46 ? HIS A 600 . ? 1_555 ? 22 AC5 6 TYR A 51 ? TYR A 605 . ? 5_565 ? 23 AC5 6 ZN E . ? ZN A 704 . ? 10_776 ? 24 AC5 6 ZN G . ? ZN A 706 . ? 10_776 ? 25 AC6 5 GLY A 43 ? GLY A 597 . ? 1_555 ? 26 AC6 5 HIS A 46 ? HIS A 600 . ? 10_776 ? 27 AC6 5 TYR A 51 ? TYR A 605 . ? 8_676 ? 28 AC6 5 ZN F . ? ZN A 705 . ? 10_776 ? 29 AC6 5 HOH J . ? HOH A 820 . ? 1_555 ? 30 AC7 4 LYS A 35 ? LYS A 589 . ? 1_555 ? 31 AC7 4 ASP A 38 ? ASP A 592 . ? 1_555 ? 32 AC7 4 ZN I . ? ZN A 708 . ? 1_555 ? 33 AC7 4 HOH J . ? HOH A 810 . ? 1_555 ? 34 AC8 7 ASP A 38 ? ASP A 592 . ? 1_555 ? 35 AC8 7 ASN A 47 ? ASN A 601 . ? 1_555 ? 36 AC8 7 GLY A 71 ? GLY A 625 . ? 1_555 ? 37 AC8 7 GLN A 72 ? GLN A 626 . ? 10_776 ? 38 AC8 7 ZN H . ? ZN A 707 . ? 1_555 ? 39 AC8 7 HOH J . ? HOH A 810 . ? 1_555 ? 40 AC8 7 HOH J . ? HOH A 844 . ? 10_776 ? # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 808 ? ? 1_555 O A HOH 847 ? ? 8_566 1.94 2 1 O A HOH 837 ? ? 1_555 O A HOH 841 ? ? 10_666 2.13 3 1 O A HOH 837 ? ? 1_555 O A HOH 843 ? ? 10_666 2.13 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'TB Structural Genomics Consortium' _pdbx_SG_project.initial_of_center TBSGC # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A ZN 701 ? B ZN . 2 1 A ZN 702 ? C ZN . 3 1 A HOH 832 ? J HOH . # _phasing.method SAD # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 555 ? A GLY 1 2 1 Y 1 A HIS 556 ? A HIS 2 3 1 Y 1 A MET 557 ? A MET 3 4 1 Y 1 A GLY 558 ? A GLY 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 ZN ZN ZN N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM70962 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 5E0Y _atom_sites.fract_transf_matrix[1][1] 0.024005 _atom_sites.fract_transf_matrix[1][2] 0.013859 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027719 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008162 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S ZN # loop_