data_5E10 # _entry.id 5E10 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5E10 pdb_00005e10 10.2210/pdb5e10/pdb WWPDB D_1000214034 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-09-14 2 'Structure model' 1 1 2016-09-21 3 'Structure model' 1 2 2016-11-09 4 'Structure model' 1 3 2017-09-13 5 'Structure model' 1 4 2019-12-25 6 'Structure model' 1 5 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Author supporting evidence' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' pdbx_audit_support 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' pdbx_audit_support 5 6 'Structure model' chem_comp_atom 6 6 'Structure model' chem_comp_bond 7 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 5 'Structure model' '_pdbx_audit_support.funding_organization' 5 6 'Structure model' '_database_2.pdbx_DOI' 6 6 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5E10 _pdbx_database_status.recvd_initial_deposition_date 2015-09-29 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 3ouv unspecified PDB . 5E0Y unspecified PDB . 5E0Z unspecified PDB . 5E12 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Prigozhin, D.M.' 1 'TB Structural Genomics Consortium (TBSGC)' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 291 _citation.language ? _citation.page_first 22961 _citation.page_last 22969 _citation.title ;Structural and Genetic Analyses of the Mycobacterium tuberculosis Protein Kinase B Sensor Domain Identify a Potential Ligand-binding Site. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M116.731760 _citation.pdbx_database_id_PubMed 27601474 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Prigozhin, D.M.' 1 ? primary 'Papavinasasundaram, K.G.' 2 ? primary 'Baer, C.E.' 3 ? primary 'Murphy, K.C.' 4 ? primary 'Moskaleva, A.' 5 ? primary 'Chen, T.Y.' 6 ? primary 'Alber, T.' 7 ? primary 'Sassetti, C.M.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase PknB' 13717.271 1 2.7.11.1 ? 'UNP residues 360-491' ? 2 water nat water 18.015 135 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GVQVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHVIGTDPAANTSVSAGDEITVNVSTGPEQREIPDVSTLTYA EAVKKLTAAGFGRFKQANSPSTPELVGKVIGTNPPANQTSAITNVVIIIVGSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GVQVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHVIGTDPAANTSVSAGDEITVNVSTGPEQREIPDVSTLTYA EAVKKLTAAGFGRFKQANSPSTPELVGKVIGTNPPANQTSAITNVVIIIVGSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 VAL n 1 3 GLN n 1 4 VAL n 1 5 PRO n 1 6 ASP n 1 7 VAL n 1 8 ARG n 1 9 GLY n 1 10 GLN n 1 11 SER n 1 12 SER n 1 13 ALA n 1 14 ASP n 1 15 ALA n 1 16 ILE n 1 17 ALA n 1 18 THR n 1 19 LEU n 1 20 GLN n 1 21 ASN n 1 22 ARG n 1 23 GLY n 1 24 PHE n 1 25 LYS n 1 26 ILE n 1 27 ARG n 1 28 THR n 1 29 LEU n 1 30 GLN n 1 31 LYS n 1 32 PRO n 1 33 ASP n 1 34 SER n 1 35 THR n 1 36 ILE n 1 37 PRO n 1 38 PRO n 1 39 ASP n 1 40 HIS n 1 41 VAL n 1 42 ILE n 1 43 GLY n 1 44 THR n 1 45 ASP n 1 46 PRO n 1 47 ALA n 1 48 ALA n 1 49 ASN n 1 50 THR n 1 51 SER n 1 52 VAL n 1 53 SER n 1 54 ALA n 1 55 GLY n 1 56 ASP n 1 57 GLU n 1 58 ILE n 1 59 THR n 1 60 VAL n 1 61 ASN n 1 62 VAL n 1 63 SER n 1 64 THR n 1 65 GLY n 1 66 PRO n 1 67 GLU n 1 68 GLN n 1 69 ARG n 1 70 GLU n 1 71 ILE n 1 72 PRO n 1 73 ASP n 1 74 VAL n 1 75 SER n 1 76 THR n 1 77 LEU n 1 78 THR n 1 79 TYR n 1 80 ALA n 1 81 GLU n 1 82 ALA n 1 83 VAL n 1 84 LYS n 1 85 LYS n 1 86 LEU n 1 87 THR n 1 88 ALA n 1 89 ALA n 1 90 GLY n 1 91 PHE n 1 92 GLY n 1 93 ARG n 1 94 PHE n 1 95 LYS n 1 96 GLN n 1 97 ALA n 1 98 ASN n 1 99 SER n 1 100 PRO n 1 101 SER n 1 102 THR n 1 103 PRO n 1 104 GLU n 1 105 LEU n 1 106 VAL n 1 107 GLY n 1 108 LYS n 1 109 VAL n 1 110 ILE n 1 111 GLY n 1 112 THR n 1 113 ASN n 1 114 PRO n 1 115 PRO n 1 116 ALA n 1 117 ASN n 1 118 GLN n 1 119 THR n 1 120 SER n 1 121 ALA n 1 122 ILE n 1 123 THR n 1 124 ASN n 1 125 VAL n 1 126 VAL n 1 127 ILE n 1 128 ILE n 1 129 ILE n 1 130 VAL n 1 131 GLY n 1 132 SER n 1 133 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 133 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pknB, Rv0014c, MTCY10H4.14c' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 25618 / H37Rv' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 359 359 GLY GLY A . n A 1 2 VAL 2 360 360 VAL VAL A . n A 1 3 GLN 3 361 361 GLN GLN A . n A 1 4 VAL 4 362 362 VAL VAL A . n A 1 5 PRO 5 363 363 PRO PRO A . n A 1 6 ASP 6 364 364 ASP ASP A . n A 1 7 VAL 7 365 365 VAL VAL A . n A 1 8 ARG 8 366 366 ARG ARG A . n A 1 9 GLY 9 367 367 GLY GLY A . n A 1 10 GLN 10 368 368 GLN GLN A . n A 1 11 SER 11 369 369 SER SER A . n A 1 12 SER 12 370 370 SER SER A . n A 1 13 ALA 13 371 371 ALA ALA A . n A 1 14 ASP 14 372 372 ASP ASP A . n A 1 15 ALA 15 373 373 ALA ALA A . n A 1 16 ILE 16 374 374 ILE ILE A . n A 1 17 ALA 17 375 375 ALA ALA A . n A 1 18 THR 18 376 376 THR THR A . n A 1 19 LEU 19 377 377 LEU LEU A . n A 1 20 GLN 20 378 378 GLN GLN A . n A 1 21 ASN 21 379 379 ASN ASN A . n A 1 22 ARG 22 380 380 ARG ARG A . n A 1 23 GLY 23 381 381 GLY GLY A . n A 1 24 PHE 24 382 382 PHE PHE A . n A 1 25 LYS 25 383 383 LYS LYS A . n A 1 26 ILE 26 384 384 ILE ILE A . n A 1 27 ARG 27 385 385 ARG ARG A . n A 1 28 THR 28 386 386 THR THR A . n A 1 29 LEU 29 387 387 LEU LEU A . n A 1 30 GLN 30 388 388 GLN GLN A . n A 1 31 LYS 31 389 389 LYS LYS A . n A 1 32 PRO 32 390 390 PRO PRO A . n A 1 33 ASP 33 391 391 ASP ASP A . n A 1 34 SER 34 392 392 SER SER A . n A 1 35 THR 35 393 393 THR THR A . n A 1 36 ILE 36 394 394 ILE ILE A . n A 1 37 PRO 37 395 395 PRO PRO A . n A 1 38 PRO 38 396 396 PRO PRO A . n A 1 39 ASP 39 397 397 ASP ASP A . n A 1 40 HIS 40 398 398 HIS HIS A . n A 1 41 VAL 41 399 399 VAL VAL A . n A 1 42 ILE 42 400 400 ILE ILE A . n A 1 43 GLY 43 401 401 GLY GLY A . n A 1 44 THR 44 402 402 THR THR A . n A 1 45 ASP 45 403 403 ASP ASP A . n A 1 46 PRO 46 404 404 PRO PRO A . n A 1 47 ALA 47 405 405 ALA ALA A . n A 1 48 ALA 48 406 406 ALA ALA A . n A 1 49 ASN 49 407 407 ASN ASN A . n A 1 50 THR 50 408 408 THR THR A . n A 1 51 SER 51 409 409 SER SER A . n A 1 52 VAL 52 410 410 VAL VAL A . n A 1 53 SER 53 411 411 SER SER A . n A 1 54 ALA 54 412 412 ALA ALA A . n A 1 55 GLY 55 413 413 GLY GLY A . n A 1 56 ASP 56 414 414 ASP ASP A . n A 1 57 GLU 57 415 415 GLU GLU A . n A 1 58 ILE 58 416 416 ILE ILE A . n A 1 59 THR 59 417 417 THR THR A . n A 1 60 VAL 60 418 418 VAL VAL A . n A 1 61 ASN 61 419 419 ASN ASN A . n A 1 62 VAL 62 420 420 VAL VAL A . n A 1 63 SER 63 421 421 SER SER A . n A 1 64 THR 64 422 422 THR THR A . n A 1 65 GLY 65 423 423 GLY GLY A . n A 1 66 PRO 66 424 424 PRO PRO A . n A 1 67 GLU 67 425 425 GLU GLU A . n A 1 68 GLN 68 426 426 GLN GLN A . n A 1 69 ARG 69 427 427 ARG ARG A . n A 1 70 GLU 70 428 428 GLU GLU A . n A 1 71 ILE 71 429 429 ILE ILE A . n A 1 72 PRO 72 430 430 PRO PRO A . n A 1 73 ASP 73 431 431 ASP ASP A . n A 1 74 VAL 74 432 432 VAL VAL A . n A 1 75 SER 75 433 433 SER SER A . n A 1 76 THR 76 434 434 THR THR A . n A 1 77 LEU 77 435 435 LEU LEU A . n A 1 78 THR 78 436 436 THR THR A . n A 1 79 TYR 79 437 437 TYR TYR A . n A 1 80 ALA 80 438 438 ALA ALA A . n A 1 81 GLU 81 439 439 GLU GLU A . n A 1 82 ALA 82 440 440 ALA ALA A . n A 1 83 VAL 83 441 441 VAL VAL A . n A 1 84 LYS 84 442 442 LYS LYS A . n A 1 85 LYS 85 443 443 LYS LYS A . n A 1 86 LEU 86 444 444 LEU LEU A . n A 1 87 THR 87 445 445 THR THR A . n A 1 88 ALA 88 446 446 ALA ALA A . n A 1 89 ALA 89 447 447 ALA ALA A . n A 1 90 GLY 90 448 448 GLY GLY A . n A 1 91 PHE 91 449 449 PHE PHE A . n A 1 92 GLY 92 450 450 GLY GLY A . n A 1 93 ARG 93 451 451 ARG ARG A . n A 1 94 PHE 94 452 452 PHE PHE A . n A 1 95 LYS 95 453 453 LYS LYS A . n A 1 96 GLN 96 454 454 GLN GLN A . n A 1 97 ALA 97 455 455 ALA ALA A . n A 1 98 ASN 98 456 456 ASN ASN A . n A 1 99 SER 99 457 457 SER SER A . n A 1 100 PRO 100 458 458 PRO PRO A . n A 1 101 SER 101 459 459 SER SER A . n A 1 102 THR 102 460 460 THR THR A . n A 1 103 PRO 103 461 461 PRO PRO A . n A 1 104 GLU 104 462 462 GLU GLU A . n A 1 105 LEU 105 463 463 LEU LEU A . n A 1 106 VAL 106 464 464 VAL VAL A . n A 1 107 GLY 107 465 465 GLY GLY A . n A 1 108 LYS 108 466 466 LYS LYS A . n A 1 109 VAL 109 467 467 VAL VAL A . n A 1 110 ILE 110 468 468 ILE ILE A . n A 1 111 GLY 111 469 469 GLY GLY A . n A 1 112 THR 112 470 470 THR THR A . n A 1 113 ASN 113 471 471 ASN ASN A . n A 1 114 PRO 114 472 472 PRO PRO A . n A 1 115 PRO 115 473 473 PRO PRO A . n A 1 116 ALA 116 474 474 ALA ALA A . n A 1 117 ASN 117 475 475 ASN ASN A . n A 1 118 GLN 118 476 476 GLN GLN A . n A 1 119 THR 119 477 477 THR THR A . n A 1 120 SER 120 478 478 SER SER A . n A 1 121 ALA 121 479 479 ALA ALA A . n A 1 122 ILE 122 480 480 ILE ILE A . n A 1 123 THR 123 481 481 THR THR A . n A 1 124 ASN 124 482 482 ASN ASN A . n A 1 125 VAL 125 483 483 VAL VAL A . n A 1 126 VAL 126 484 484 VAL VAL A . n A 1 127 ILE 127 485 485 ILE ILE A . n A 1 128 ILE 128 486 486 ILE ILE A . n A 1 129 ILE 129 487 487 ILE ILE A . n A 1 130 VAL 130 488 488 VAL VAL A . n A 1 131 GLY 131 489 489 GLY GLY A . n A 1 132 SER 132 490 490 SER SER A . n A 1 133 GLY 133 491 491 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 501 62 HOH HOH A . B 2 HOH 2 502 77 HOH HOH A . B 2 HOH 3 503 81 HOH HOH A . B 2 HOH 4 504 1 HOH HOH A . B 2 HOH 5 505 10 HOH HOH A . B 2 HOH 6 506 61 HOH HOH A . B 2 HOH 7 507 42 HOH HOH A . B 2 HOH 8 508 39 HOH HOH A . B 2 HOH 9 509 7 HOH HOH A . B 2 HOH 10 510 57 HOH HOH A . B 2 HOH 11 511 59 HOH HOH A . B 2 HOH 12 512 102 HOH HOH A . B 2 HOH 13 513 22 HOH HOH A . B 2 HOH 14 514 38 HOH HOH A . B 2 HOH 15 515 26 HOH HOH A . B 2 HOH 16 516 8 HOH HOH A . B 2 HOH 17 517 27 HOH HOH A . B 2 HOH 18 518 36 HOH HOH A . B 2 HOH 19 519 93 HOH HOH A . B 2 HOH 20 520 30 HOH HOH A . B 2 HOH 21 521 88 HOH HOH A . B 2 HOH 22 522 46 HOH HOH A . B 2 HOH 23 523 3 HOH HOH A . B 2 HOH 24 524 23 HOH HOH A . B 2 HOH 25 525 33 HOH HOH A . B 2 HOH 26 526 51 HOH HOH A . B 2 HOH 27 527 21 HOH HOH A . B 2 HOH 28 528 17 HOH HOH A . B 2 HOH 29 529 25 HOH HOH A . B 2 HOH 30 530 2 HOH HOH A . B 2 HOH 31 531 31 HOH HOH A . B 2 HOH 32 532 4 HOH HOH A . B 2 HOH 33 533 53 HOH HOH A . B 2 HOH 34 534 37 HOH HOH A . B 2 HOH 35 535 40 HOH HOH A . B 2 HOH 36 536 86 HOH HOH A . B 2 HOH 37 537 11 HOH HOH A . B 2 HOH 38 538 131 HOH HOH A . B 2 HOH 39 539 103 HOH HOH A . B 2 HOH 40 540 13 HOH HOH A . B 2 HOH 41 541 91 HOH HOH A . B 2 HOH 42 542 65 HOH HOH A . B 2 HOH 43 543 19 HOH HOH A . B 2 HOH 44 544 55 HOH HOH A . B 2 HOH 45 545 15 HOH HOH A . B 2 HOH 46 546 50 HOH HOH A . B 2 HOH 47 547 69 HOH HOH A . B 2 HOH 48 548 127 HOH HOH A . B 2 HOH 49 549 94 HOH HOH A . B 2 HOH 50 550 85 HOH HOH A . B 2 HOH 51 551 110 HOH HOH A . B 2 HOH 52 552 122 HOH HOH A . B 2 HOH 53 553 90 HOH HOH A . B 2 HOH 54 554 67 HOH HOH A . B 2 HOH 55 555 29 HOH HOH A . B 2 HOH 56 556 52 HOH HOH A . B 2 HOH 57 557 14 HOH HOH A . B 2 HOH 58 558 49 HOH HOH A . B 2 HOH 59 559 100 HOH HOH A . B 2 HOH 60 560 73 HOH HOH A . B 2 HOH 61 561 12 HOH HOH A . B 2 HOH 62 562 121 HOH HOH A . B 2 HOH 63 563 66 HOH HOH A . B 2 HOH 64 564 70 HOH HOH A . B 2 HOH 65 565 24 HOH HOH A . B 2 HOH 66 566 9 HOH HOH A . B 2 HOH 67 567 97 HOH HOH A . B 2 HOH 68 568 134 HOH HOH A . B 2 HOH 69 569 99 HOH HOH A . B 2 HOH 70 570 16 HOH HOH A . B 2 HOH 71 571 44 HOH HOH A . B 2 HOH 72 572 20 HOH HOH A . B 2 HOH 73 573 80 HOH HOH A . B 2 HOH 74 574 28 HOH HOH A . B 2 HOH 75 575 47 HOH HOH A . B 2 HOH 76 576 32 HOH HOH A . B 2 HOH 77 577 41 HOH HOH A . B 2 HOH 78 578 95 HOH HOH A . B 2 HOH 79 579 75 HOH HOH A . B 2 HOH 80 580 112 HOH HOH A . B 2 HOH 81 581 60 HOH HOH A . B 2 HOH 82 582 133 HOH HOH A . B 2 HOH 83 583 125 HOH HOH A . B 2 HOH 84 584 68 HOH HOH A . B 2 HOH 85 585 35 HOH HOH A . B 2 HOH 86 586 34 HOH HOH A . B 2 HOH 87 587 18 HOH HOH A . B 2 HOH 88 588 56 HOH HOH A . B 2 HOH 89 589 123 HOH HOH A . B 2 HOH 90 590 114 HOH HOH A . B 2 HOH 91 591 117 HOH HOH A . B 2 HOH 92 592 63 HOH HOH A . B 2 HOH 93 593 48 HOH HOH A . B 2 HOH 94 594 5 HOH HOH A . B 2 HOH 95 595 126 HOH HOH A . B 2 HOH 96 596 6 HOH HOH A . B 2 HOH 97 597 106 HOH HOH A . B 2 HOH 98 598 58 HOH HOH A . B 2 HOH 99 599 45 HOH HOH A . B 2 HOH 100 600 118 HOH HOH A . B 2 HOH 101 601 129 HOH HOH A . B 2 HOH 102 602 101 HOH HOH A . B 2 HOH 103 603 83 HOH HOH A . B 2 HOH 104 604 98 HOH HOH A . B 2 HOH 105 605 89 HOH HOH A . B 2 HOH 106 606 78 HOH HOH A . B 2 HOH 107 607 136 HOH HOH A . B 2 HOH 108 608 124 HOH HOH A . B 2 HOH 109 609 79 HOH HOH A . B 2 HOH 110 610 104 HOH HOH A . B 2 HOH 111 611 119 HOH HOH A . B 2 HOH 112 612 92 HOH HOH A . B 2 HOH 113 613 107 HOH HOH A . B 2 HOH 114 614 76 HOH HOH A . B 2 HOH 115 615 115 HOH HOH A . B 2 HOH 116 616 130 HOH HOH A . B 2 HOH 117 617 43 HOH HOH A . B 2 HOH 118 618 64 HOH HOH A . B 2 HOH 119 619 116 HOH HOH A . B 2 HOH 120 620 105 HOH HOH A . B 2 HOH 121 621 132 HOH HOH A . B 2 HOH 122 622 109 HOH HOH A . B 2 HOH 123 623 74 HOH HOH A . B 2 HOH 124 624 71 HOH HOH A . B 2 HOH 125 625 54 HOH HOH A . B 2 HOH 126 626 96 HOH HOH A . B 2 HOH 127 627 113 HOH HOH A . B 2 HOH 128 628 135 HOH HOH A . B 2 HOH 129 629 87 HOH HOH A . B 2 HOH 130 630 108 HOH HOH A . B 2 HOH 131 631 82 HOH HOH A . B 2 HOH 132 632 128 HOH HOH A . B 2 HOH 133 633 84 HOH HOH A . B 2 HOH 134 634 111 HOH HOH A . B 2 HOH 135 635 120 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 106.280 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5E10 _cell.details ? _cell.formula_units_Z ? _cell.length_a 80.721 _cell.length_a_esd ? _cell.length_b 43.163 _cell.length_b_esd ? _cell.length_c 43.749 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5E10 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5E10 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M CHES pH 9.5, 30% isopropanol, 30% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-08-27 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double flat crystal, Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.116 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.116 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 20.280 _reflns.entry_id 5E10 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.800 _reflns.d_resolution_low 41.995 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13502 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.900 _reflns.pdbx_Rmerge_I_obs 0.090 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 14.797 _reflns.pdbx_netI_over_sigmaI 7.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.980 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 52681 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.800 1.860 ? ? ? ? ? 1345 ? 100.000 ? ? ? ? 0.571 ? ? ? ? ? ? ? ? 3.900 ? 0.763 ? ? ? ? 0 1 1 ? ? 1.860 1.940 ? ? ? ? ? 1328 ? 100.000 ? ? ? ? 0.437 ? ? ? ? ? ? ? ? 3.900 ? 0.905 ? ? ? ? 0 2 1 ? ? 1.940 2.030 ? ? ? ? ? 1341 ? 100.000 ? ? ? ? 0.323 ? ? ? ? ? ? ? ? 3.900 ? 1.037 ? ? ? ? 0 3 1 ? ? 2.030 2.130 ? ? ? ? ? 1328 ? 100.000 ? ? ? ? 0.238 ? ? ? ? ? ? ? ? 3.900 ? 1.020 ? ? ? ? 0 4 1 ? ? 2.130 2.270 ? ? ? ? ? 1373 ? 100.000 ? ? ? ? 0.179 ? ? ? ? ? ? ? ? 3.900 ? 0.937 ? ? ? ? 0 5 1 ? ? 2.270 2.440 ? ? ? ? ? 1339 ? 100.000 ? ? ? ? 0.149 ? ? ? ? ? ? ? ? 3.900 ? 1.138 ? ? ? ? 0 6 1 ? ? 2.440 2.690 ? ? ? ? ? 1349 ? 100.000 ? ? ? ? 0.115 ? ? ? ? ? ? ? ? 3.900 ? 1.024 ? ? ? ? 0 7 1 ? ? 2.690 3.080 ? ? ? ? ? 1344 ? 99.900 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 3.900 ? 1.038 ? ? ? ? 0 8 1 ? ? 3.080 3.880 ? ? ? ? ? 1356 ? 99.900 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 3.900 ? 0.971 ? ? ? ? 0 9 1 ? ? 3.880 50.000 ? ? ? ? ? 1399 ? 99.900 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 3.800 ? 0.969 ? ? ? ? 0 10 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 70.600 _refine.B_iso_mean 22.9223 _refine.B_iso_min 9.930 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5E10 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8010 _refine.ls_d_res_low 41.9950 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13498 _refine.ls_number_reflns_R_free 673 _refine.ls_number_reflns_R_work 12825 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7500 _refine.ls_percent_reflns_R_free 4.9900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1712 _refine.ls_R_factor_R_free 0.2073 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1693 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.0000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.7000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.7500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.8010 _refine_hist.d_res_low 41.9950 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 135 _refine_hist.number_atoms_total 1100 _refine_hist.pdbx_number_residues_total 133 _refine_hist.pdbx_B_iso_mean_solvent 33.45 _refine_hist.pdbx_number_atoms_protein 965 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1052 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.212 ? 1454 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.049 ? 175 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 202 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.178 ? 393 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8010 1.9401 2643 . 132 2511 99.0000 . . . 0.2640 . 0.2095 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 1.9401 2.1353 2679 . 134 2545 100.0000 . . . 0.2376 . 0.1744 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.1353 2.4443 2712 . 135 2577 100.0000 . . . 0.2092 . 0.1606 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.4443 3.0794 2708 . 135 2573 100.0000 . . . 0.1942 . 0.1722 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.0794 42.0062 2756 . 137 2619 100.0000 . . . 0.1949 . 0.1624 . . . . . . 5 . . . # _struct.entry_id 5E10 _struct.title 'Crystal Structure of PASTA Domains 1 and 2 of Mycobacterium tuberculosis Protein Kinase B' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5E10 _struct_keywords.text ;kinase, extracellular sensor domain, peptidoglycan binding, Structural Genomics, TB Structural Genomics Consortium, TBSGC, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PKNB_MYCTU _struct_ref.pdbx_db_accession P9WI81 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VQVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHVIGTDPAANTSVSAGDEITVNVSTGPEQREIPDVSTLTYAE AVKKLTAAGFGRFKQANSPSTPELVGKVIGTNPPANQTSAITNVVIIIVGSG ; _struct_ref.pdbx_align_begin 360 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5E10 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 133 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WI81 _struct_ref_seq.db_align_beg 360 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 491 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 360 _struct_ref_seq.pdbx_auth_seq_align_end 491 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5E10 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P9WI81 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 359 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7400 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 11 ? ARG A 22 ? SER A 369 ARG A 380 1 ? 12 HELX_P HELX_P2 AA2 THR A 78 ? ALA A 89 ? THR A 436 ALA A 447 1 ? 12 HELX_P HELX_P3 AA3 THR A 102 ? VAL A 106 ? THR A 460 VAL A 464 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 45 A . ? ASP 403 A PRO 46 A ? PRO 404 A 1 0.88 2 ASP 45 A . ? ASP 403 A PRO 46 A ? PRO 404 A 1 -2.42 3 ASN 113 A . ? ASN 471 A PRO 114 A ? PRO 472 A 1 7.17 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? AA3 ? 2 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 2 ? GLN A 3 ? VAL A 360 GLN A 361 AA1 2 SER A 51 ? VAL A 52 ? SER A 409 VAL A 410 AA2 1 LYS A 25 ? LYS A 31 ? LYS A 383 LYS A 389 AA2 2 GLU A 57 ? SER A 63 ? GLU A 415 SER A 421 AA2 3 VAL A 41 ? ASP A 45 ? VAL A 399 ASP A 403 AA3 1 GLN A 68 ? GLU A 70 ? GLN A 426 GLU A 428 AA3 2 THR A 119 ? ALA A 121 ? THR A 477 ALA A 479 AA4 1 PHE A 94 ? PRO A 100 ? PHE A 452 PRO A 458 AA4 2 VAL A 126 ? SER A 132 ? VAL A 484 SER A 490 AA4 3 VAL A 109 ? ASN A 113 ? VAL A 467 ASN A 471 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 2 ? N VAL A 360 O VAL A 52 ? O VAL A 410 AA2 1 2 N LEU A 29 ? N LEU A 387 O VAL A 62 ? O VAL A 420 AA2 2 3 O ASN A 61 ? O ASN A 419 N ILE A 42 ? N ILE A 400 AA3 1 2 N ARG A 69 ? N ARG A 427 O SER A 120 ? O SER A 478 AA4 1 2 N ALA A 97 ? N ALA A 455 O VAL A 130 ? O VAL A 488 AA4 2 3 O ILE A 127 ? O ILE A 485 N ASN A 113 ? N ASN A 471 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 505 ? ? O A HOH 615 ? ? 2.08 2 1 O A HOH 570 ? ? O A HOH 630 ? ? 2.08 3 1 O A HOH 533 ? ? O A HOH 574 ? ? 2.15 4 1 OE1 A GLN 454 ? A O A HOH 501 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 407 ? ? 74.83 -5.55 2 1 THR A 434 ? ? 67.74 -4.19 3 1 ASN A 475 ? ? 72.97 -3.67 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'TB Structural Genomics Consortium' _pdbx_SG_project.initial_of_center TBSGC # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 631 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _phasing.method MR # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 TYR N N N N 287 TYR CA C N S 288 TYR C C N N 289 TYR O O N N 290 TYR CB C N N 291 TYR CG C Y N 292 TYR CD1 C Y N 293 TYR CD2 C Y N 294 TYR CE1 C Y N 295 TYR CE2 C Y N 296 TYR CZ C Y N 297 TYR OH O N N 298 TYR OXT O N N 299 TYR H H N N 300 TYR H2 H N N 301 TYR HA H N N 302 TYR HB2 H N N 303 TYR HB3 H N N 304 TYR HD1 H N N 305 TYR HD2 H N N 306 TYR HE1 H N N 307 TYR HE2 H N N 308 TYR HH H N N 309 TYR HXT H N N 310 VAL N N N N 311 VAL CA C N S 312 VAL C C N N 313 VAL O O N N 314 VAL CB C N N 315 VAL CG1 C N N 316 VAL CG2 C N N 317 VAL OXT O N N 318 VAL H H N N 319 VAL H2 H N N 320 VAL HA H N N 321 VAL HB H N N 322 VAL HG11 H N N 323 VAL HG12 H N N 324 VAL HG13 H N N 325 VAL HG21 H N N 326 VAL HG22 H N N 327 VAL HG23 H N N 328 VAL HXT H N N 329 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 PHE N CA sing N N 205 PHE N H sing N N 206 PHE N H2 sing N N 207 PHE CA C sing N N 208 PHE CA CB sing N N 209 PHE CA HA sing N N 210 PHE C O doub N N 211 PHE C OXT sing N N 212 PHE CB CG sing N N 213 PHE CB HB2 sing N N 214 PHE CB HB3 sing N N 215 PHE CG CD1 doub Y N 216 PHE CG CD2 sing Y N 217 PHE CD1 CE1 sing Y N 218 PHE CD1 HD1 sing N N 219 PHE CD2 CE2 doub Y N 220 PHE CD2 HD2 sing N N 221 PHE CE1 CZ doub Y N 222 PHE CE1 HE1 sing N N 223 PHE CE2 CZ sing Y N 224 PHE CE2 HE2 sing N N 225 PHE CZ HZ sing N N 226 PHE OXT HXT sing N N 227 PRO N CA sing N N 228 PRO N CD sing N N 229 PRO N H sing N N 230 PRO CA C sing N N 231 PRO CA CB sing N N 232 PRO CA HA sing N N 233 PRO C O doub N N 234 PRO C OXT sing N N 235 PRO CB CG sing N N 236 PRO CB HB2 sing N N 237 PRO CB HB3 sing N N 238 PRO CG CD sing N N 239 PRO CG HG2 sing N N 240 PRO CG HG3 sing N N 241 PRO CD HD2 sing N N 242 PRO CD HD3 sing N N 243 PRO OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 TYR N CA sing N N 274 TYR N H sing N N 275 TYR N H2 sing N N 276 TYR CA C sing N N 277 TYR CA CB sing N N 278 TYR CA HA sing N N 279 TYR C O doub N N 280 TYR C OXT sing N N 281 TYR CB CG sing N N 282 TYR CB HB2 sing N N 283 TYR CB HB3 sing N N 284 TYR CG CD1 doub Y N 285 TYR CG CD2 sing Y N 286 TYR CD1 CE1 sing Y N 287 TYR CD1 HD1 sing N N 288 TYR CD2 CE2 doub Y N 289 TYR CD2 HD2 sing N N 290 TYR CE1 CZ doub Y N 291 TYR CE1 HE1 sing N N 292 TYR CE2 CZ sing Y N 293 TYR CE2 HE2 sing N N 294 TYR CZ OH sing N N 295 TYR OH HH sing N N 296 TYR OXT HXT sing N N 297 VAL N CA sing N N 298 VAL N H sing N N 299 VAL N H2 sing N N 300 VAL CA C sing N N 301 VAL CA CB sing N N 302 VAL CA HA sing N N 303 VAL C O doub N N 304 VAL C OXT sing N N 305 VAL CB CG1 sing N N 306 VAL CB CG2 sing N N 307 VAL CB HB sing N N 308 VAL CG1 HG11 sing N N 309 VAL CG1 HG12 sing N N 310 VAL CG1 HG13 sing N N 311 VAL CG2 HG21 sing N N 312 VAL CG2 HG22 sing N N 313 VAL CG2 HG23 sing N N 314 VAL OXT HXT sing N N 315 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM70962 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 5E10 _atom_sites.fract_transf_matrix[1][1] 0.012388 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003618 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023168 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023812 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O # loop_