data_5EDK # _entry.id 5EDK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5EDK pdb_00005edk 10.2210/pdb5edk/pdb WWPDB D_1000214484 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Crystal structure of Ca2+ bound prothrombin deletion mutant residues 146-167' _pdbx_database_related.db_id 4O03 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5EDK _pdbx_database_status.recvd_initial_deposition_date 2015-10-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pozzi, N.' 1 ? 'Chen, Z.' 2 ? 'Di Cera, E.' 3 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary J.Biol.Chem. JBCHA3 0071 1083-351X ? ? 291 ? 6071 6082 'How the Linker Connecting the Two Kringles Influences Activation and Conformational Plasticity of Prothrombin.' 2016 ? 10.1074/jbc.M115.700401 26763231 ? ? ? ? ? ? ? ? US ? ? 1 Proc.Natl.Acad.Sci.USA PNASA6 0040 1091-6490 ? ? 111 ? 7630 7635 'The linker connecting the two kringles plays a key role in prothrombin activation.' 2014 ? 10.1073/pnas.1403779111 24821807 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pozzi, N.' 1 ? primary 'Chen, Z.' 2 ? primary 'Di Cera, E.' 3 ? 1 'Pozzi, N.' 4 ? 1 'Chen, Z.' 5 ? 1 'Pelc, L.A.' 6 ? 1 'Shropshire, D.B.' 7 ? 1 'Di Cera, E.' 8 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5EDK _cell.details ? _cell.formula_units_Z ? _cell.length_a 84.192 _cell.length_a_esd ? _cell.length_b 84.192 _cell.length_b_esd ? _cell.length_c 346.427 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5EDK _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Prothrombin 63993.207 1 3.4.21.5 'Deletion mutant residues 146-167' ? ? 2 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Coagulation factor II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;ANTFL(CGU)(CGU)VRKGNL(CGU)R(CGU)CV(CGU)(CGU)TCSY(CGU)(CGU)AF(CGU)AL(CGU)SSTATDVF WAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSS TMGPWCYTTDPTVRRQECSIPVCGQEQCVPDRGQQYQGRLAVTTHGLPCLAWASAQAKALSKHQDFNSAVQLVENFCRNP DGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKK SLEDKTERELLESYIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVR IGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWG NLKETWTANVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQM GIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGEYLE ; _entity_poly.pdbx_seq_one_letter_code_can ;ANTFLEEVRKGNLERECVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHVNIT RSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTMGPWCYTTDPTVRRQECSIPVCGQEQCVPDRGQQYQGRL AVTTHGLPCLAWASAQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDE DSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYIDGRIVEGSDAEIGMSPWQVMLFRKS PQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIAL MKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDSTRIRIT DNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGEYLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASN n 1 3 THR n 1 4 PHE n 1 5 LEU n 1 6 CGU n 1 7 CGU n 1 8 VAL n 1 9 ARG n 1 10 LYS n 1 11 GLY n 1 12 ASN n 1 13 LEU n 1 14 CGU n 1 15 ARG n 1 16 CGU n 1 17 CYS n 1 18 VAL n 1 19 CGU n 1 20 CGU n 1 21 THR n 1 22 CYS n 1 23 SER n 1 24 TYR n 1 25 CGU n 1 26 CGU n 1 27 ALA n 1 28 PHE n 1 29 CGU n 1 30 ALA n 1 31 LEU n 1 32 CGU n 1 33 SER n 1 34 SER n 1 35 THR n 1 36 ALA n 1 37 THR n 1 38 ASP n 1 39 VAL n 1 40 PHE n 1 41 TRP n 1 42 ALA n 1 43 LYS n 1 44 TYR n 1 45 THR n 1 46 ALA n 1 47 CYS n 1 48 GLU n 1 49 THR n 1 50 ALA n 1 51 ARG n 1 52 THR n 1 53 PRO n 1 54 ARG n 1 55 ASP n 1 56 LYS n 1 57 LEU n 1 58 ALA n 1 59 ALA n 1 60 CYS n 1 61 LEU n 1 62 GLU n 1 63 GLY n 1 64 ASN n 1 65 CYS n 1 66 ALA n 1 67 GLU n 1 68 GLY n 1 69 LEU n 1 70 GLY n 1 71 THR n 1 72 ASN n 1 73 TYR n 1 74 ARG n 1 75 GLY n 1 76 HIS n 1 77 VAL n 1 78 ASN n 1 79 ILE n 1 80 THR n 1 81 ARG n 1 82 SER n 1 83 GLY n 1 84 ILE n 1 85 GLU n 1 86 CYS n 1 87 GLN n 1 88 LEU n 1 89 TRP n 1 90 ARG n 1 91 SER n 1 92 ARG n 1 93 TYR n 1 94 PRO n 1 95 HIS n 1 96 LYS n 1 97 PRO n 1 98 GLU n 1 99 ILE n 1 100 ASN n 1 101 SER n 1 102 THR n 1 103 THR n 1 104 HIS n 1 105 PRO n 1 106 GLY n 1 107 ALA n 1 108 ASP n 1 109 LEU n 1 110 GLN n 1 111 GLU n 1 112 ASN n 1 113 PHE n 1 114 CYS n 1 115 ARG n 1 116 ASN n 1 117 PRO n 1 118 ASP n 1 119 SER n 1 120 SER n 1 121 THR n 1 122 MET n 1 123 GLY n 1 124 PRO n 1 125 TRP n 1 126 CYS n 1 127 TYR n 1 128 THR n 1 129 THR n 1 130 ASP n 1 131 PRO n 1 132 THR n 1 133 VAL n 1 134 ARG n 1 135 ARG n 1 136 GLN n 1 137 GLU n 1 138 CYS n 1 139 SER n 1 140 ILE n 1 141 PRO n 1 142 VAL n 1 143 CYS n 1 144 GLY n 1 145 GLN n 1 146 GLU n 1 147 GLN n 1 148 CYS n 1 149 VAL n 1 150 PRO n 1 151 ASP n 1 152 ARG n 1 153 GLY n 1 154 GLN n 1 155 GLN n 1 156 TYR n 1 157 GLN n 1 158 GLY n 1 159 ARG n 1 160 LEU n 1 161 ALA n 1 162 VAL n 1 163 THR n 1 164 THR n 1 165 HIS n 1 166 GLY n 1 167 LEU n 1 168 PRO n 1 169 CYS n 1 170 LEU n 1 171 ALA n 1 172 TRP n 1 173 ALA n 1 174 SER n 1 175 ALA n 1 176 GLN n 1 177 ALA n 1 178 LYS n 1 179 ALA n 1 180 LEU n 1 181 SER n 1 182 LYS n 1 183 HIS n 1 184 GLN n 1 185 ASP n 1 186 PHE n 1 187 ASN n 1 188 SER n 1 189 ALA n 1 190 VAL n 1 191 GLN n 1 192 LEU n 1 193 VAL n 1 194 GLU n 1 195 ASN n 1 196 PHE n 1 197 CYS n 1 198 ARG n 1 199 ASN n 1 200 PRO n 1 201 ASP n 1 202 GLY n 1 203 ASP n 1 204 GLU n 1 205 GLU n 1 206 GLY n 1 207 VAL n 1 208 TRP n 1 209 CYS n 1 210 TYR n 1 211 VAL n 1 212 ALA n 1 213 GLY n 1 214 LYS n 1 215 PRO n 1 216 GLY n 1 217 ASP n 1 218 PHE n 1 219 GLY n 1 220 TYR n 1 221 CYS n 1 222 ASP n 1 223 LEU n 1 224 ASN n 1 225 TYR n 1 226 CYS n 1 227 GLU n 1 228 GLU n 1 229 ALA n 1 230 VAL n 1 231 GLU n 1 232 GLU n 1 233 GLU n 1 234 THR n 1 235 GLY n 1 236 ASP n 1 237 GLY n 1 238 LEU n 1 239 ASP n 1 240 GLU n 1 241 ASP n 1 242 SER n 1 243 ASP n 1 244 ARG n 1 245 ALA n 1 246 ILE n 1 247 GLU n 1 248 GLY n 1 249 ARG n 1 250 THR n 1 251 ALA n 1 252 THR n 1 253 SER n 1 254 GLU n 1 255 TYR n 1 256 GLN n 1 257 THR n 1 258 PHE n 1 259 PHE n 1 260 ASN n 1 261 PRO n 1 262 ARG n 1 263 THR n 1 264 PHE n 1 265 GLY n 1 266 SER n 1 267 GLY n 1 268 GLU n 1 269 ALA n 1 270 ASP n 1 271 CYS n 1 272 GLY n 1 273 LEU n 1 274 ARG n 1 275 PRO n 1 276 LEU n 1 277 PHE n 1 278 GLU n 1 279 LYS n 1 280 LYS n 1 281 SER n 1 282 LEU n 1 283 GLU n 1 284 ASP n 1 285 LYS n 1 286 THR n 1 287 GLU n 1 288 ARG n 1 289 GLU n 1 290 LEU n 1 291 LEU n 1 292 GLU n 1 293 SER n 1 294 TYR n 1 295 ILE n 1 296 ASP n 1 297 GLY n 1 298 ARG n 1 299 ILE n 1 300 VAL n 1 301 GLU n 1 302 GLY n 1 303 SER n 1 304 ASP n 1 305 ALA n 1 306 GLU n 1 307 ILE n 1 308 GLY n 1 309 MET n 1 310 SER n 1 311 PRO n 1 312 TRP n 1 313 GLN n 1 314 VAL n 1 315 MET n 1 316 LEU n 1 317 PHE n 1 318 ARG n 1 319 LYS n 1 320 SER n 1 321 PRO n 1 322 GLN n 1 323 GLU n 1 324 LEU n 1 325 LEU n 1 326 CYS n 1 327 GLY n 1 328 ALA n 1 329 SER n 1 330 LEU n 1 331 ILE n 1 332 SER n 1 333 ASP n 1 334 ARG n 1 335 TRP n 1 336 VAL n 1 337 LEU n 1 338 THR n 1 339 ALA n 1 340 ALA n 1 341 HIS n 1 342 CYS n 1 343 LEU n 1 344 LEU n 1 345 TYR n 1 346 PRO n 1 347 PRO n 1 348 TRP n 1 349 ASP n 1 350 LYS n 1 351 ASN n 1 352 PHE n 1 353 THR n 1 354 GLU n 1 355 ASN n 1 356 ASP n 1 357 LEU n 1 358 LEU n 1 359 VAL n 1 360 ARG n 1 361 ILE n 1 362 GLY n 1 363 LYS n 1 364 HIS n 1 365 SER n 1 366 ARG n 1 367 THR n 1 368 ARG n 1 369 TYR n 1 370 GLU n 1 371 ARG n 1 372 ASN n 1 373 ILE n 1 374 GLU n 1 375 LYS n 1 376 ILE n 1 377 SER n 1 378 MET n 1 379 LEU n 1 380 GLU n 1 381 LYS n 1 382 ILE n 1 383 TYR n 1 384 ILE n 1 385 HIS n 1 386 PRO n 1 387 ARG n 1 388 TYR n 1 389 ASN n 1 390 TRP n 1 391 ARG n 1 392 GLU n 1 393 ASN n 1 394 LEU n 1 395 ASP n 1 396 ARG n 1 397 ASP n 1 398 ILE n 1 399 ALA n 1 400 LEU n 1 401 MET n 1 402 LYS n 1 403 LEU n 1 404 LYS n 1 405 LYS n 1 406 PRO n 1 407 VAL n 1 408 ALA n 1 409 PHE n 1 410 SER n 1 411 ASP n 1 412 TYR n 1 413 ILE n 1 414 HIS n 1 415 PRO n 1 416 VAL n 1 417 CYS n 1 418 LEU n 1 419 PRO n 1 420 ASP n 1 421 ARG n 1 422 GLU n 1 423 THR n 1 424 ALA n 1 425 ALA n 1 426 SER n 1 427 LEU n 1 428 LEU n 1 429 GLN n 1 430 ALA n 1 431 GLY n 1 432 TYR n 1 433 LYS n 1 434 GLY n 1 435 ARG n 1 436 VAL n 1 437 THR n 1 438 GLY n 1 439 TRP n 1 440 GLY n 1 441 ASN n 1 442 LEU n 1 443 LYS n 1 444 GLU n 1 445 THR n 1 446 TRP n 1 447 THR n 1 448 ALA n 1 449 ASN n 1 450 VAL n 1 451 GLY n 1 452 LYS n 1 453 GLY n 1 454 GLN n 1 455 PRO n 1 456 SER n 1 457 VAL n 1 458 LEU n 1 459 GLN n 1 460 VAL n 1 461 VAL n 1 462 ASN n 1 463 LEU n 1 464 PRO n 1 465 ILE n 1 466 VAL n 1 467 GLU n 1 468 ARG n 1 469 PRO n 1 470 VAL n 1 471 CYS n 1 472 LYS n 1 473 ASP n 1 474 SER n 1 475 THR n 1 476 ARG n 1 477 ILE n 1 478 ARG n 1 479 ILE n 1 480 THR n 1 481 ASP n 1 482 ASN n 1 483 MET n 1 484 PHE n 1 485 CYS n 1 486 ALA n 1 487 GLY n 1 488 TYR n 1 489 LYS n 1 490 PRO n 1 491 ASP n 1 492 GLU n 1 493 GLY n 1 494 LYS n 1 495 ARG n 1 496 GLY n 1 497 ASP n 1 498 ALA n 1 499 CYS n 1 500 GLU n 1 501 GLY n 1 502 ASP n 1 503 SER n 1 504 GLY n 1 505 GLY n 1 506 PRO n 1 507 PHE n 1 508 VAL n 1 509 MET n 1 510 LYS n 1 511 SER n 1 512 PRO n 1 513 PHE n 1 514 ASN n 1 515 ASN n 1 516 ARG n 1 517 TRP n 1 518 TYR n 1 519 GLN n 1 520 MET n 1 521 GLY n 1 522 ILE n 1 523 VAL n 1 524 SER n 1 525 TRP n 1 526 GLY n 1 527 GLU n 1 528 GLY n 1 529 CYS n 1 530 ASP n 1 531 ARG n 1 532 ASP n 1 533 GLY n 1 534 LYS n 1 535 TYR n 1 536 GLY n 1 537 PHE n 1 538 TYR n 1 539 THR n 1 540 HIS n 1 541 VAL n 1 542 PHE n 1 543 ARG n 1 544 LEU n 1 545 LYS n 1 546 LYS n 1 547 TRP n 1 548 ILE n 1 549 GLN n 1 550 LYS n 1 551 VAL n 1 552 ILE n 1 553 ASP n 1 554 GLN n 1 555 PHE n 1 556 GLY n 1 557 GLU n 1 558 TYR n 1 559 LEU n 1 560 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 560 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene F2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Mesocricetus auratus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10036 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'Baby Hamster Kidney (BHK)' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THRB_HUMAN _struct_ref.pdbx_db_accession P00734 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ANTFLEEVRKGNLERECVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHVNIT RSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQECSIPVCGQDQVTVAMTPRSEGSS VNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASAQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDF GYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYIDGR IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISM LEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVL QVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFY THVFRLKKWIQKVIDQFGE ; _struct_ref.pdbx_align_begin 44 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5EDK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 557 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00734 _struct_ref_seq.db_align_beg 44 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 622 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 557 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5EDK MET A 122 ? UNP P00734 THR 165 variant 122 1 1 5EDK ? A ? ? UNP P00734 ASP 189 deletion ? 2 1 5EDK ? A ? ? UNP P00734 GLN 190 deletion ? 3 1 5EDK ? A ? ? UNP P00734 VAL 191 deletion ? 4 1 5EDK ? A ? ? UNP P00734 THR 192 deletion ? 5 1 5EDK ? A ? ? UNP P00734 VAL 193 deletion ? 6 1 5EDK ? A ? ? UNP P00734 ALA 194 deletion ? 7 1 5EDK ? A ? ? UNP P00734 MET 195 deletion ? 8 1 5EDK ? A ? ? UNP P00734 THR 196 deletion ? 9 1 5EDK ? A ? ? UNP P00734 PRO 197 deletion ? 10 1 5EDK ? A ? ? UNP P00734 ARG 198 deletion ? 11 1 5EDK ? A ? ? UNP P00734 SER 199 deletion ? 12 1 5EDK ? A ? ? UNP P00734 GLU 200 deletion ? 13 1 5EDK ? A ? ? UNP P00734 GLY 201 deletion ? 14 1 5EDK ? A ? ? UNP P00734 SER 202 deletion ? 15 1 5EDK ? A ? ? UNP P00734 SER 203 deletion ? 16 1 5EDK ? A ? ? UNP P00734 VAL 204 deletion ? 17 1 5EDK ? A ? ? UNP P00734 ASN 205 deletion ? 18 1 5EDK ? A ? ? UNP P00734 LEU 206 deletion ? 19 1 5EDK ? A ? ? UNP P00734 SER 207 deletion ? 20 1 5EDK ? A ? ? UNP P00734 PRO 208 deletion ? 21 1 5EDK ? A ? ? UNP P00734 PRO 209 deletion ? 22 1 5EDK ? A ? ? UNP P00734 LEU 210 deletion ? 23 1 5EDK TYR A 558 ? UNP P00734 ? ? 'expression tag' 558 24 1 5EDK LEU A 559 ? UNP P00734 ? ? 'expression tag' 559 25 1 5EDK GLU A 560 ? UNP P00734 ? ? 'expression tag' 560 26 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CGU 'L-peptide linking' n 'GAMMA-CARBOXY-GLUTAMIC ACID' ? 'C6 H9 N O6' 191.139 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5EDK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.8 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 71.2 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.1 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M di-Na hydrogen phosphate and 20% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-06-27 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5EDK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.2 _reflns.d_resolution_low 86.61 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 20053 _reflns.number_obs 20053 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F -0.9 _reflns.observed_criterion_sigma_I -0.9 _reflns.percent_possible_obs 94.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.4 _reflns.pdbx_Rmerge_I_obs 0.155 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.2 _reflns_shell.d_res_low 3.26 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 94.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.441 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.0 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.10 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.10 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.21 _refine.B_iso_max ? _refine.B_iso_mean 86.358 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.839 _refine.correlation_coeff_Fo_to_Fc_free 0.779 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5EDK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.214 _refine.ls_d_res_low 86.61 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18675 _refine.ls_number_reflns_R_free 1009 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.20 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.29274 _refine.ls_R_factor_R_free 0.32266 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.29112 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F -0.9 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'pdb code 4O03' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 1.673 _refine.pdbx_overall_ESU_R_Free 0.520 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 33.369 _refine.overall_SU_ML 0.535 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 4242 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 60 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 4302 _refine_hist.d_res_high 3.214 _refine_hist.d_res_low 86.61 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.019 4416 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 3964 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.211 1.981 6003 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.784 3.000 9136 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.285 5.000 525 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.505 23.558 208 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.137 15.000 700 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.039 15.000 35 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.069 0.200 633 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.021 5012 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1025 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 3.078 8.669 2109 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.078 8.667 2108 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 5.305 12.988 2631 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 5.304 12.990 2632 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.359 8.761 2307 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.359 8.761 2307 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.248 13.067 3373 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.194 69.289 5071 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 8.193 69.289 5072 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.214 _refine_ls_shell.d_res_low 3.297 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 59 _refine_ls_shell.number_reflns_R_work 1175 _refine_ls_shell.percent_reflns_obs 80.50 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.451 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.415 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5EDK _struct.title 'Crystal structure of prothrombin deletion mutant residues 146-167 ( Form II ).' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5EDK _struct_keywords.text 'prothrombin, kringle, Protease, coagulation factor, enzyme mechanism, kinetics, structure-function, hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 12 ? CYS A 17 ? ASN A 12 CYS A 17 1 ? 6 HELX_P HELX_P2 AA2 SER A 33 ? CYS A 47 ? SER A 33 CYS A 47 1 ? 15 HELX_P HELX_P3 AA3 PRO A 53 ? GLU A 62 ? PRO A 53 GLU A 62 1 ? 10 HELX_P HELX_P4 AA4 PRO A 150 ? GLN A 154 ? PRO A 150 GLN A 154 5 ? 5 HELX_P HELX_P5 AA5 ALA A 175 ? LEU A 180 ? ALA A 175 LEU A 180 1 ? 6 HELX_P HELX_P6 AA6 ASN A 260 ? GLY A 265 ? ASN A 260 GLY A 265 1 ? 6 HELX_P HELX_P7 AA7 GLY A 267 ? CYS A 271 ? GLY A 267 CYS A 271 5 ? 5 HELX_P HELX_P8 AA8 THR A 286 ? GLU A 292 ? THR A 286 GLU A 292 1 ? 7 HELX_P HELX_P9 AA9 ALA A 339 ? CYS A 342 ? ALA A 339 CYS A 342 5 ? 4 HELX_P HELX_P10 AB1 THR A 353 ? ASN A 355 ? THR A 353 ASN A 355 5 ? 3 HELX_P HELX_P11 AB2 GLU A 422 ? ALA A 430 ? GLU A 422 ALA A 430 1 ? 9 HELX_P HELX_P12 AB3 GLU A 467 ? ASP A 473 ? GLU A 467 ASP A 473 1 ? 7 HELX_P HELX_P13 AB4 LEU A 544 ? GLY A 556 ? LEU A 544 GLY A 556 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 17 A CYS 22 1_555 ? ? ? ? ? ? ? 2.053 ? ? disulf2 disulf ? ? A CYS 47 SG ? ? ? 1_555 A CYS 60 SG ? ? A CYS 47 A CYS 60 1_555 ? ? ? ? ? ? ? 2.041 ? ? disulf3 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 143 SG ? ? A CYS 65 A CYS 143 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf4 disulf ? ? A CYS 86 SG ? ? ? 1_555 A CYS 126 SG ? ? A CYS 86 A CYS 126 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf5 disulf ? ? A CYS 114 SG ? ? ? 1_555 A CYS 138 SG ? ? A CYS 114 A CYS 138 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf6 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 226 SG ? ? A CYS 148 A CYS 226 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf7 disulf ? ? A CYS 169 SG ? ? ? 1_555 A CYS 209 SG ? ? A CYS 169 A CYS 209 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf8 disulf ? ? A CYS 197 SG ? ? ? 1_555 A CYS 221 SG ? ? A CYS 197 A CYS 221 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf9 disulf ? ? A CYS 271 SG ? ? ? 1_555 A CYS 417 SG ? ? A CYS 271 A CYS 417 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf10 disulf ? ? A CYS 326 SG ? ? ? 1_555 A CYS 342 SG ? ? A CYS 326 A CYS 342 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf11 disulf ? ? A CYS 471 SG ? ? ? 1_555 A CYS 485 SG ? ? A CYS 471 A CYS 485 1_555 ? ? ? ? ? ? ? 2.044 ? ? disulf12 disulf ? ? A CYS 499 SG ? ? ? 1_555 A CYS 529 SG ? ? A CYS 499 A CYS 529 1_555 ? ? ? ? ? ? ? 2.029 ? ? covale1 covale both ? A CGU 6 C ? ? ? 1_555 A CGU 7 N ? ? A CGU 6 A CGU 7 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? A CGU 7 C ? ? ? 1_555 A VAL 8 N ? ? A CGU 7 A VAL 8 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale3 covale both ? A LEU 13 C ? ? ? 1_555 A CGU 14 N ? ? A LEU 13 A CGU 14 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale4 covale both ? A CGU 14 C ? ? ? 1_555 A ARG 15 N ? ? A CGU 14 A ARG 15 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale5 covale both ? A ARG 15 C ? ? ? 1_555 A CGU 16 N ? ? A ARG 15 A CGU 16 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale6 covale both ? A CGU 16 C ? ? ? 1_555 A CYS 17 N ? ? A CGU 16 A CYS 17 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale7 covale both ? A VAL 18 C ? ? ? 1_555 A CGU 19 N ? ? A VAL 18 A CGU 19 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale8 covale both ? A CGU 19 C ? ? ? 1_555 A CGU 20 N ? ? A CGU 19 A CGU 20 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale9 covale both ? A CGU 20 C ? ? ? 1_555 A THR 21 N ? ? A CGU 20 A THR 21 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale10 covale both ? A TYR 24 C ? ? ? 1_555 A CGU 25 N ? ? A TYR 24 A CGU 25 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale11 covale both ? A CGU 25 C ? ? ? 1_555 A CGU 26 N ? ? A CGU 25 A CGU 26 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale12 covale both ? A CGU 26 C ? ? ? 1_555 A ALA 27 N ? ? A CGU 26 A ALA 27 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale13 covale both ? A PHE 28 C ? ? ? 1_555 A CGU 29 N ? ? A PHE 28 A CGU 29 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale14 covale both ? A CGU 29 C ? ? ? 1_555 A ALA 30 N ? ? A CGU 29 A ALA 30 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale15 covale both ? A LEU 31 C ? ? ? 1_555 A CGU 32 N ? ? A LEU 31 A CGU 32 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale16 covale both ? A CGU 32 C ? ? ? 1_555 A SER 33 N ? ? A CGU 32 A SER 33 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale17 covale one ? A ASN 78 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 78 B NAG 1 1_555 ? ? ? ? ? ? ? 1.433 ? N-Glycosylation covale18 covale one ? A ASN 100 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 100 A NAG 604 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation covale19 covale one ? A ASN 351 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 351 A NAG 601 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation covale20 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.443 ? ? metalc1 metalc ? ? A CGU 16 OE11 ? ? ? 1_555 F MG . MG ? ? A CGU 16 A MG 606 1_555 ? ? ? ? ? ? ? 2.480 ? ? metalc2 metalc ? ? A CGU 19 OE11 ? ? ? 1_555 E MG . MG ? ? A CGU 19 A MG 605 1_555 ? ? ? ? ? ? ? 2.132 ? ? metalc3 metalc ? ? A CGU 19 OE21 ? ? ? 1_555 E MG . MG ? ? A CGU 19 A MG 605 1_555 ? ? ? ? ? ? ? 2.266 ? ? metalc4 metalc ? ? A CGU 20 OE22 ? ? ? 1_555 H MG . MG ? ? A CGU 20 A MG 608 8_665 ? ? ? ? ? ? ? 1.925 ? ? metalc5 metalc ? ? A CGU 25 OE22 ? ? ? 1_555 G MG . MG ? ? A CGU 25 A MG 607 1_555 ? ? ? ? ? ? ? 2.512 ? ? metalc6 metalc ? ? A CGU 26 OE22 ? ? ? 1_555 F MG . MG ? ? A CGU 26 A MG 606 1_555 ? ? ? ? ? ? ? 2.292 ? ? metalc7 metalc ? ? A CGU 26 OE11 ? ? ? 1_555 H MG . MG ? ? A CGU 26 A MG 608 1_555 ? ? ? ? ? ? ? 2.633 ? ? metalc8 metalc ? ? A CGU 26 OE12 ? ? ? 1_555 H MG . MG ? ? A CGU 26 A MG 608 1_555 ? ? ? ? ? ? ? 2.984 ? ? metalc9 metalc ? ? A CGU 29 OE22 ? ? ? 1_555 G MG . MG ? ? A CGU 29 A MG 607 1_555 ? ? ? ? ? ? ? 2.103 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 THR 52 A . ? THR 52 A PRO 53 A ? PRO 53 A 1 6.04 2 TYR 93 A . ? TYR 93 A PRO 94 A ? PRO 94 A 1 -1.19 3 SER 320 A . ? SER 320 A PRO 321 A ? PRO 321 A 1 0.62 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 7 ? AA3 ? 7 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 86 ? GLN A 87 ? CYS A 86 GLN A 87 AA1 2 TRP A 125 ? THR A 128 ? TRP A 125 THR A 128 AA1 3 ARG A 135 ? GLU A 137 ? ARG A 135 GLU A 137 AA2 1 SER A 303 ? ASP A 304 ? SER A 303 ASP A 304 AA2 2 GLN A 459 ? VAL A 461 ? GLN A 459 VAL A 461 AA2 3 ARG A 435 ? GLY A 438 ? ARG A 435 GLY A 438 AA2 4 PRO A 506 ? LYS A 510 ? PRO A 506 LYS A 510 AA2 5 TRP A 517 ? VAL A 523 ? TRP A 517 VAL A 523 AA2 6 GLY A 536 ? THR A 539 ? GLY A 536 THR A 539 AA2 7 MET A 483 ? ALA A 486 ? MET A 483 ALA A 486 AA3 1 GLN A 313 ? ARG A 318 ? GLN A 313 ARG A 318 AA3 2 LEU A 324 ? LEU A 330 ? LEU A 324 LEU A 330 AA3 3 TRP A 335 ? THR A 338 ? TRP A 335 THR A 338 AA3 4 ALA A 399 ? LEU A 403 ? ALA A 399 LEU A 403 AA3 5 LYS A 375 ? ILE A 384 ? LYS A 375 ILE A 384 AA3 6 LEU A 357 ? ILE A 361 ? LEU A 357 ILE A 361 AA3 7 GLN A 313 ? ARG A 318 ? GLN A 313 ARG A 318 AA4 1 LEU A 344 ? TYR A 345 ? LEU A 344 TYR A 345 AA4 2 LYS A 350 ? ASN A 351 ? LYS A 350 ASN A 351 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 87 ? N GLN A 87 O TYR A 127 ? O TYR A 127 AA1 2 3 N CYS A 126 ? N CYS A 126 O GLN A 136 ? O GLN A 136 AA2 1 2 N SER A 303 ? N SER A 303 O VAL A 460 ? O VAL A 460 AA2 2 3 O VAL A 461 ? O VAL A 461 N VAL A 436 ? N VAL A 436 AA2 3 4 N ARG A 435 ? N ARG A 435 O VAL A 508 ? O VAL A 508 AA2 4 5 N MET A 509 ? N MET A 509 O TYR A 518 ? O TYR A 518 AA2 5 6 N ILE A 522 ? N ILE A 522 O THR A 539 ? O THR A 539 AA2 6 7 O GLY A 536 ? O GLY A 536 N ALA A 486 ? N ALA A 486 AA3 1 2 N LEU A 316 ? N LEU A 316 O CYS A 326 ? O CYS A 326 AA3 2 3 N SER A 329 ? N SER A 329 O LEU A 337 ? O LEU A 337 AA3 3 4 N VAL A 336 ? N VAL A 336 O MET A 401 ? O MET A 401 AA3 4 5 O LYS A 402 ? O LYS A 402 N GLU A 380 ? N GLU A 380 AA3 5 6 O SER A 377 ? O SER A 377 N VAL A 359 ? N VAL A 359 AA3 6 7 O ARG A 360 ? O ARG A 360 N MET A 315 ? N MET A 315 AA4 1 2 N TYR A 345 ? N TYR A 345 O LYS A 350 ? O LYS A 350 # _atom_sites.entry_id 5EDK _atom_sites.fract_transf_matrix[1][1] 0.011878 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011878 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002887 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 PHE 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 CGU 6 6 6 CGU CGU A . n A 1 7 CGU 7 7 7 CGU CGU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 CGU 14 14 14 CGU CGU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 CGU 16 16 16 CGU CGU A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 CGU 19 19 19 CGU CGU A . n A 1 20 CGU 20 20 20 CGU CGU A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 CGU 25 25 25 CGU CGU A . n A 1 26 CGU 26 26 26 CGU CGU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 CGU 29 29 29 CGU CGU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 CGU 32 32 32 CGU CGU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 CYS 114 114 114 CYS CYS A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 CYS 126 126 126 CYS CYS A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 CYS 138 138 138 CYS CYS A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 CYS 143 143 143 CYS CYS A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 CYS 148 148 148 CYS CYS A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 TYR 156 156 156 TYR TYR A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 PRO 168 168 168 PRO PRO A . n A 1 169 CYS 169 169 169 CYS CYS A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 TRP 172 172 172 TRP TRP A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 HIS 183 183 183 HIS HIS A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 GLN 191 191 191 GLN GLN A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 CYS 197 197 197 CYS CYS A . n A 1 198 ARG 198 198 198 ARG ARG A . n A 1 199 ASN 199 199 199 ASN ASN A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 TRP 208 208 208 TRP TRP A . n A 1 209 CYS 209 209 209 CYS CYS A . n A 1 210 TYR 210 210 210 TYR TYR A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 PRO 215 215 215 PRO PRO A . n A 1 216 GLY 216 216 216 GLY GLY A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 PHE 218 218 218 PHE PHE A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 TYR 220 220 220 TYR TYR A . n A 1 221 CYS 221 221 221 CYS CYS A . n A 1 222 ASP 222 222 222 ASP ASP A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 TYR 225 225 225 TYR TYR A . n A 1 226 CYS 226 226 226 CYS CYS A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 GLU 233 233 ? ? ? A . n A 1 234 THR 234 234 ? ? ? A . n A 1 235 GLY 235 235 ? ? ? A . n A 1 236 ASP 236 236 ? ? ? A . n A 1 237 GLY 237 237 ? ? ? A . n A 1 238 LEU 238 238 ? ? ? A . n A 1 239 ASP 239 239 ? ? ? A . n A 1 240 GLU 240 240 ? ? ? A . n A 1 241 ASP 241 241 ? ? ? A . n A 1 242 SER 242 242 ? ? ? A . n A 1 243 ASP 243 243 ? ? ? A . n A 1 244 ARG 244 244 ? ? ? A . n A 1 245 ALA 245 245 ? ? ? A . n A 1 246 ILE 246 246 ? ? ? A . n A 1 247 GLU 247 247 ? ? ? A . n A 1 248 GLY 248 248 ? ? ? A . n A 1 249 ARG 249 249 ? ? ? A . n A 1 250 THR 250 250 ? ? ? A . n A 1 251 ALA 251 251 ? ? ? A . n A 1 252 THR 252 252 252 THR THR A . n A 1 253 SER 253 253 253 SER SER A . n A 1 254 GLU 254 254 254 GLU GLU A . n A 1 255 TYR 255 255 255 TYR TYR A . n A 1 256 GLN 256 256 256 GLN GLN A . n A 1 257 THR 257 257 257 THR THR A . n A 1 258 PHE 258 258 258 PHE PHE A . n A 1 259 PHE 259 259 259 PHE PHE A . n A 1 260 ASN 260 260 260 ASN ASN A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 ARG 262 262 262 ARG ALA A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 PHE 264 264 264 PHE PHE A . n A 1 265 GLY 265 265 265 GLY GLY A . n A 1 266 SER 266 266 266 SER SER A . n A 1 267 GLY 267 267 267 GLY GLY A . n A 1 268 GLU 268 268 268 GLU GLU A . n A 1 269 ALA 269 269 269 ALA ALA A . n A 1 270 ASP 270 270 270 ASP ASP A . n A 1 271 CYS 271 271 271 CYS CYS A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 ARG 274 274 274 ARG ARG A . n A 1 275 PRO 275 275 275 PRO PRO A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 PHE 277 277 277 PHE PHE A . n A 1 278 GLU 278 278 278 GLU GLU A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 LYS 280 280 280 LYS LYS A . n A 1 281 SER 281 281 281 SER SER A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 GLU 283 283 283 GLU GLU A . n A 1 284 ASP 284 284 284 ASP ASP A . n A 1 285 LYS 285 285 285 LYS LYS A . n A 1 286 THR 286 286 286 THR THR A . n A 1 287 GLU 287 287 287 GLU GLU A . n A 1 288 ARG 288 288 288 ARG ARG A . n A 1 289 GLU 289 289 289 GLU GLU A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 GLU 292 292 292 GLU GLU A . n A 1 293 SER 293 293 293 SER SER A . n A 1 294 TYR 294 294 294 TYR TYR A . n A 1 295 ILE 295 295 295 ILE ILE A . n A 1 296 ASP 296 296 296 ASP ASP A . n A 1 297 GLY 297 297 297 GLY GLY A . n A 1 298 ARG 298 298 298 ARG ARG A . n A 1 299 ILE 299 299 299 ILE ILE A . n A 1 300 VAL 300 300 300 VAL VAL A . n A 1 301 GLU 301 301 301 GLU GLU A . n A 1 302 GLY 302 302 302 GLY GLY A . n A 1 303 SER 303 303 303 SER SER A . n A 1 304 ASP 304 304 304 ASP ASP A . n A 1 305 ALA 305 305 305 ALA ALA A . n A 1 306 GLU 306 306 306 GLU GLU A . n A 1 307 ILE 307 307 307 ILE ILE A . n A 1 308 GLY 308 308 308 GLY GLY A . n A 1 309 MET 309 309 309 MET MET A . n A 1 310 SER 310 310 310 SER SER A . n A 1 311 PRO 311 311 311 PRO PRO A . n A 1 312 TRP 312 312 312 TRP TRP A . n A 1 313 GLN 313 313 313 GLN GLN A . n A 1 314 VAL 314 314 314 VAL VAL A . n A 1 315 MET 315 315 315 MET MET A . n A 1 316 LEU 316 316 316 LEU LEU A . n A 1 317 PHE 317 317 317 PHE PHE A . n A 1 318 ARG 318 318 318 ARG ARG A . n A 1 319 LYS 319 319 319 LYS LYS A . n A 1 320 SER 320 320 320 SER SER A . n A 1 321 PRO 321 321 321 PRO PRO A . n A 1 322 GLN 322 322 322 GLN GLN A . n A 1 323 GLU 323 323 323 GLU GLU A . n A 1 324 LEU 324 324 324 LEU LEU A . n A 1 325 LEU 325 325 325 LEU LEU A . n A 1 326 CYS 326 326 326 CYS CYS A . n A 1 327 GLY 327 327 327 GLY GLY A . n A 1 328 ALA 328 328 328 ALA ALA A . n A 1 329 SER 329 329 329 SER SER A . n A 1 330 LEU 330 330 330 LEU LEU A . n A 1 331 ILE 331 331 331 ILE ILE A . n A 1 332 SER 332 332 332 SER SER A . n A 1 333 ASP 333 333 333 ASP ASP A . n A 1 334 ARG 334 334 334 ARG ARG A . n A 1 335 TRP 335 335 335 TRP TRP A . n A 1 336 VAL 336 336 336 VAL VAL A . n A 1 337 LEU 337 337 337 LEU LEU A . n A 1 338 THR 338 338 338 THR THR A . n A 1 339 ALA 339 339 339 ALA ALA A . n A 1 340 ALA 340 340 340 ALA ALA A . n A 1 341 HIS 341 341 341 HIS HIS A . n A 1 342 CYS 342 342 342 CYS CYS A . n A 1 343 LEU 343 343 343 LEU LEU A . n A 1 344 LEU 344 344 344 LEU LEU A . n A 1 345 TYR 345 345 345 TYR TYR A . n A 1 346 PRO 346 346 346 PRO PRO A . n A 1 347 PRO 347 347 347 PRO PRO A . n A 1 348 TRP 348 348 348 TRP TRP A . n A 1 349 ASP 349 349 349 ASP ASP A . n A 1 350 LYS 350 350 350 LYS LYS A . n A 1 351 ASN 351 351 351 ASN ASN A . n A 1 352 PHE 352 352 352 PHE PHE A . n A 1 353 THR 353 353 353 THR THR A . n A 1 354 GLU 354 354 354 GLU GLU A . n A 1 355 ASN 355 355 355 ASN ASN A . n A 1 356 ASP 356 356 356 ASP ASP A . n A 1 357 LEU 357 357 357 LEU LEU A . n A 1 358 LEU 358 358 358 LEU LEU A . n A 1 359 VAL 359 359 359 VAL VAL A . n A 1 360 ARG 360 360 360 ARG ARG A . n A 1 361 ILE 361 361 361 ILE ILE A . n A 1 362 GLY 362 362 362 GLY GLY A . n A 1 363 LYS 363 363 363 LYS LYS A . n A 1 364 HIS 364 364 364 HIS HIS A . n A 1 365 SER 365 365 365 SER SER A . n A 1 366 ARG 366 366 366 ARG ARG A . n A 1 367 THR 367 367 367 THR THR A . n A 1 368 ARG 368 368 368 ARG ARG A . n A 1 369 TYR 369 369 369 TYR TYR A . n A 1 370 GLU 370 370 370 GLU GLU A . n A 1 371 ARG 371 371 371 ARG ARG A . n A 1 372 ASN 372 372 372 ASN ASN A . n A 1 373 ILE 373 373 373 ILE ILE A . n A 1 374 GLU 374 374 374 GLU GLU A . n A 1 375 LYS 375 375 375 LYS LYS A . n A 1 376 ILE 376 376 376 ILE ILE A . n A 1 377 SER 377 377 377 SER SER A . n A 1 378 MET 378 378 378 MET MET A . n A 1 379 LEU 379 379 379 LEU LEU A . n A 1 380 GLU 380 380 380 GLU GLU A . n A 1 381 LYS 381 381 381 LYS LYS A . n A 1 382 ILE 382 382 382 ILE ILE A . n A 1 383 TYR 383 383 383 TYR TYR A . n A 1 384 ILE 384 384 384 ILE ILE A . n A 1 385 HIS 385 385 385 HIS HIS A . n A 1 386 PRO 386 386 386 PRO PRO A . n A 1 387 ARG 387 387 387 ARG ARG A . n A 1 388 TYR 388 388 388 TYR TYR A . n A 1 389 ASN 389 389 389 ASN ASN A . n A 1 390 TRP 390 390 390 TRP TRP A . n A 1 391 ARG 391 391 391 ARG ARG A . n A 1 392 GLU 392 392 392 GLU GLU A . n A 1 393 ASN 393 393 393 ASN ASN A . n A 1 394 LEU 394 394 394 LEU LEU A . n A 1 395 ASP 395 395 395 ASP ASP A . n A 1 396 ARG 396 396 396 ARG ARG A . n A 1 397 ASP 397 397 397 ASP ASP A . n A 1 398 ILE 398 398 398 ILE ILE A . n A 1 399 ALA 399 399 399 ALA ALA A . n A 1 400 LEU 400 400 400 LEU LEU A . n A 1 401 MET 401 401 401 MET MET A . n A 1 402 LYS 402 402 402 LYS LYS A . n A 1 403 LEU 403 403 403 LEU LEU A . n A 1 404 LYS 404 404 404 LYS LYS A . n A 1 405 LYS 405 405 405 LYS LYS A . n A 1 406 PRO 406 406 406 PRO PRO A . n A 1 407 VAL 407 407 407 VAL VAL A . n A 1 408 ALA 408 408 408 ALA ALA A . n A 1 409 PHE 409 409 409 PHE PHE A . n A 1 410 SER 410 410 410 SER SER A . n A 1 411 ASP 411 411 411 ASP ASP A . n A 1 412 TYR 412 412 412 TYR TYR A . n A 1 413 ILE 413 413 413 ILE ILE A . n A 1 414 HIS 414 414 414 HIS HIS A . n A 1 415 PRO 415 415 415 PRO PRO A . n A 1 416 VAL 416 416 416 VAL VAL A . n A 1 417 CYS 417 417 417 CYS CYS A . n A 1 418 LEU 418 418 418 LEU LEU A . n A 1 419 PRO 419 419 419 PRO PRO A . n A 1 420 ASP 420 420 420 ASP ASP A . n A 1 421 ARG 421 421 421 ARG ARG A . n A 1 422 GLU 422 422 422 GLU GLU A . n A 1 423 THR 423 423 423 THR THR A . n A 1 424 ALA 424 424 424 ALA ALA A . n A 1 425 ALA 425 425 425 ALA ALA A . n A 1 426 SER 426 426 426 SER SER A . n A 1 427 LEU 427 427 427 LEU LEU A . n A 1 428 LEU 428 428 428 LEU LEU A . n A 1 429 GLN 429 429 429 GLN GLN A . n A 1 430 ALA 430 430 430 ALA ALA A . n A 1 431 GLY 431 431 431 GLY GLY A . n A 1 432 TYR 432 432 432 TYR TYR A . n A 1 433 LYS 433 433 433 LYS LYS A . n A 1 434 GLY 434 434 434 GLY GLY A . n A 1 435 ARG 435 435 435 ARG ARG A . n A 1 436 VAL 436 436 436 VAL VAL A . n A 1 437 THR 437 437 437 THR THR A . n A 1 438 GLY 438 438 438 GLY GLY A . n A 1 439 TRP 439 439 439 TRP TRP A . n A 1 440 GLY 440 440 440 GLY GLY A . n A 1 441 ASN 441 441 441 ASN ASN A . n A 1 442 LEU 442 442 442 LEU LEU A . n A 1 443 LYS 443 443 443 LYS LYS A . n A 1 444 GLU 444 444 444 GLU GLU A . n A 1 445 THR 445 445 445 THR THR A . n A 1 446 TRP 446 446 446 TRP TRP A . n A 1 447 THR 447 447 447 THR THR A . n A 1 448 ALA 448 448 448 ALA ALA A . n A 1 449 ASN 449 449 ? ? ? A . n A 1 450 VAL 450 450 ? ? ? A . n A 1 451 GLY 451 451 ? ? ? A . n A 1 452 LYS 452 452 ? ? ? A . n A 1 453 GLY 453 453 ? ? ? A . n A 1 454 GLN 454 454 454 GLN GLN A . n A 1 455 PRO 455 455 455 PRO PRO A . n A 1 456 SER 456 456 456 SER SER A . n A 1 457 VAL 457 457 457 VAL VAL A . n A 1 458 LEU 458 458 458 LEU LEU A . n A 1 459 GLN 459 459 459 GLN GLN A . n A 1 460 VAL 460 460 460 VAL VAL A . n A 1 461 VAL 461 461 461 VAL VAL A . n A 1 462 ASN 462 462 462 ASN ASN A . n A 1 463 LEU 463 463 463 LEU LEU A . n A 1 464 PRO 464 464 464 PRO PRO A . n A 1 465 ILE 465 465 465 ILE ILE A . n A 1 466 VAL 466 466 466 VAL VAL A . n A 1 467 GLU 467 467 467 GLU GLU A . n A 1 468 ARG 468 468 468 ARG ARG A . n A 1 469 PRO 469 469 469 PRO PRO A . n A 1 470 VAL 470 470 470 VAL VAL A . n A 1 471 CYS 471 471 471 CYS CYS A . n A 1 472 LYS 472 472 472 LYS LYS A . n A 1 473 ASP 473 473 473 ASP ASP A . n A 1 474 SER 474 474 474 SER SER A . n A 1 475 THR 475 475 475 THR THR A . n A 1 476 ARG 476 476 476 ARG ARG A . n A 1 477 ILE 477 477 477 ILE ILE A . n A 1 478 ARG 478 478 478 ARG ARG A . n A 1 479 ILE 479 479 479 ILE ILE A . n A 1 480 THR 480 480 480 THR THR A . n A 1 481 ASP 481 481 481 ASP ASP A . n A 1 482 ASN 482 482 482 ASN ASN A . n A 1 483 MET 483 483 483 MET MET A . n A 1 484 PHE 484 484 484 PHE PHE A . n A 1 485 CYS 485 485 485 CYS CYS A . n A 1 486 ALA 486 486 486 ALA ALA A . n A 1 487 GLY 487 487 487 GLY GLY A . n A 1 488 TYR 488 488 488 TYR TYR A . n A 1 489 LYS 489 489 489 LYS LYS A . n A 1 490 PRO 490 490 490 PRO PRO A . n A 1 491 ASP 491 491 491 ASP ASP A . n A 1 492 GLU 492 492 492 GLU GLU A . n A 1 493 GLY 493 493 493 GLY GLY A . n A 1 494 LYS 494 494 494 LYS LYS A . n A 1 495 ARG 495 495 495 ARG ARG A . n A 1 496 GLY 496 496 496 GLY GLY A . n A 1 497 ASP 497 497 497 ASP ASP A . n A 1 498 ALA 498 498 498 ALA ALA A . n A 1 499 CYS 499 499 499 CYS CYS A . n A 1 500 GLU 500 500 500 GLU GLU A . n A 1 501 GLY 501 501 501 GLY GLY A . n A 1 502 ASP 502 502 502 ASP ASP A . n A 1 503 SER 503 503 503 SER SER A . n A 1 504 GLY 504 504 504 GLY GLY A . n A 1 505 GLY 505 505 505 GLY GLY A . n A 1 506 PRO 506 506 506 PRO PRO A . n A 1 507 PHE 507 507 507 PHE PHE A . n A 1 508 VAL 508 508 508 VAL VAL A . n A 1 509 MET 509 509 509 MET MET A . n A 1 510 LYS 510 510 510 LYS LYS A . n A 1 511 SER 511 511 511 SER SER A . n A 1 512 PRO 512 512 512 PRO PRO A . n A 1 513 PHE 513 513 513 PHE PHE A . n A 1 514 ASN 514 514 514 ASN ASN A . n A 1 515 ASN 515 515 515 ASN ASN A . n A 1 516 ARG 516 516 516 ARG ARG A . n A 1 517 TRP 517 517 517 TRP TRP A . n A 1 518 TYR 518 518 518 TYR TYR A . n A 1 519 GLN 519 519 519 GLN GLN A . n A 1 520 MET 520 520 520 MET MET A . n A 1 521 GLY 521 521 521 GLY GLY A . n A 1 522 ILE 522 522 522 ILE ILE A . n A 1 523 VAL 523 523 523 VAL VAL A . n A 1 524 SER 524 524 524 SER SER A . n A 1 525 TRP 525 525 525 TRP TRP A . n A 1 526 GLY 526 526 526 GLY GLY A . n A 1 527 GLU 527 527 527 GLU GLU A . n A 1 528 GLY 528 528 528 GLY GLY A . n A 1 529 CYS 529 529 529 CYS CYS A . n A 1 530 ASP 530 530 530 ASP ASP A . n A 1 531 ARG 531 531 531 ARG ARG A . n A 1 532 ASP 532 532 532 ASP ASP A . n A 1 533 GLY 533 533 533 GLY GLY A . n A 1 534 LYS 534 534 534 LYS LYS A . n A 1 535 TYR 535 535 535 TYR TYR A . n A 1 536 GLY 536 536 536 GLY GLY A . n A 1 537 PHE 537 537 537 PHE PHE A . n A 1 538 TYR 538 538 538 TYR TYR A . n A 1 539 THR 539 539 539 THR THR A . n A 1 540 HIS 540 540 540 HIS HIS A . n A 1 541 VAL 541 541 541 VAL VAL A . n A 1 542 PHE 542 542 542 PHE PHE A . n A 1 543 ARG 543 543 543 ARG ARG A . n A 1 544 LEU 544 544 544 LEU LEU A . n A 1 545 LYS 545 545 545 LYS LYS A . n A 1 546 LYS 546 546 546 LYS LYS A . n A 1 547 TRP 547 547 547 TRP TRP A . n A 1 548 ILE 548 548 548 ILE ILE A . n A 1 549 GLN 549 549 549 GLN GLN A . n A 1 550 LYS 550 550 550 LYS LYS A . n A 1 551 VAL 551 551 551 VAL VAL A . n A 1 552 ILE 552 552 552 ILE ILE A . n A 1 553 ASP 553 553 553 ASP ASP A . n A 1 554 GLN 554 554 554 GLN GLN A . n A 1 555 PHE 555 555 555 PHE PHE A . n A 1 556 GLY 556 556 556 GLY GLY A . n A 1 557 GLU 557 557 557 GLU GLU A . n A 1 558 TYR 558 558 ? ? ? A . n A 1 559 LEU 559 559 ? ? ? A . n A 1 560 GLU 560 560 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 NAG 1 601 601 NAG NAG A . D 3 NAG 1 604 604 NAG NAG A . E 4 MG 1 605 701 MG MG A . F 4 MG 1 606 702 MG MG A . G 4 MG 1 607 703 MG MG A . H 4 MG 1 608 704 MG MG A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CGU 6 A CGU 6 ? GLU 'modified residue' 2 A CGU 7 A CGU 7 ? GLU 'modified residue' 3 A CGU 14 A CGU 14 ? GLU 'modified residue' 4 A CGU 16 A CGU 16 ? GLU 'modified residue' 5 A CGU 19 A CGU 19 ? GLU 'modified residue' 6 A CGU 20 A CGU 20 ? GLU 'modified residue' 7 A CGU 25 A CGU 25 ? GLU 'modified residue' 8 A CGU 26 A CGU 26 ? GLU 'modified residue' 9 A CGU 29 A CGU 29 ? GLU 'modified residue' 10 A CGU 32 A CGU 32 ? GLU 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 26220 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE11 ? A CGU 16 ? A CGU 16 ? 1_555 MG ? F MG . ? A MG 606 ? 1_555 OE22 ? A CGU 26 ? A CGU 26 ? 1_555 73.1 ? 2 OE11 ? A CGU 19 ? A CGU 19 ? 1_555 MG ? E MG . ? A MG 605 ? 1_555 OE21 ? A CGU 19 ? A CGU 19 ? 1_555 74.8 ? 3 OE22 ? A CGU 20 ? A CGU 20 ? 1_555 MG ? H MG . ? A MG 608 ? 8_665 OE11 ? A CGU 26 ? A CGU 26 ? 1_555 123.0 ? 4 OE22 ? A CGU 20 ? A CGU 20 ? 1_555 MG ? H MG . ? A MG 608 ? 8_665 OE12 ? A CGU 26 ? A CGU 26 ? 1_555 118.7 ? 5 OE11 ? A CGU 26 ? A CGU 26 ? 1_555 MG ? H MG . ? A MG 608 ? 8_665 OE12 ? A CGU 26 ? A CGU 26 ? 1_555 7.9 ? 6 OE22 ? A CGU 25 ? A CGU 25 ? 1_555 MG ? G MG . ? A MG 607 ? 1_555 OE22 ? A CGU 29 ? A CGU 29 ? 1_555 80.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-01-20 2 'Structure model' 1 1 2016-01-27 3 'Structure model' 1 2 2016-03-30 4 'Structure model' 1 3 2017-08-09 5 'Structure model' 1 4 2017-09-06 6 'Structure model' 1 5 2019-12-04 7 'Structure model' 2 0 2020-07-29 8 'Structure model' 2 1 2023-09-27 9 'Structure model' 2 2 2023-11-15 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 7 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Author supporting evidence' 6 6 'Structure model' 'Author supporting evidence' 7 7 'Structure model' 'Atomic model' 8 7 'Structure model' 'Data collection' 9 7 'Structure model' 'Derived calculations' 10 7 'Structure model' 'Structure summary' 11 8 'Structure model' 'Data collection' 12 8 'Structure model' 'Database references' 13 8 'Structure model' 'Refinement description' 14 8 'Structure model' 'Structure summary' 15 9 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' pdbx_related_exp_data_set 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' pdbx_audit_support 5 6 'Structure model' pdbx_audit_support 6 7 'Structure model' atom_site 7 7 'Structure model' chem_comp 8 7 'Structure model' entity 9 7 'Structure model' pdbx_branch_scheme 10 7 'Structure model' pdbx_chem_comp_identifier 11 7 'Structure model' pdbx_entity_branch 12 7 'Structure model' pdbx_entity_branch_descriptor 13 7 'Structure model' pdbx_entity_branch_link 14 7 'Structure model' pdbx_entity_branch_list 15 7 'Structure model' pdbx_entity_nonpoly 16 7 'Structure model' pdbx_nonpoly_scheme 17 7 'Structure model' pdbx_struct_assembly_gen 18 7 'Structure model' pdbx_struct_conn_angle 19 7 'Structure model' struct_asym 20 7 'Structure model' struct_conn 21 7 'Structure model' struct_site 22 7 'Structure model' struct_site_gen 23 8 'Structure model' chem_comp 24 8 'Structure model' chem_comp_atom 25 8 'Structure model' chem_comp_bond 26 8 'Structure model' database_2 27 8 'Structure model' pdbx_initial_refinement_model 28 9 'Structure model' chem_comp_atom 29 9 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 5 'Structure model' '_pdbx_audit_support.funding_organization' 4 6 'Structure model' '_pdbx_audit_support.funding_organization' 5 7 'Structure model' '_atom_site.B_iso_or_equiv' 6 7 'Structure model' '_atom_site.Cartn_x' 7 7 'Structure model' '_atom_site.Cartn_y' 8 7 'Structure model' '_atom_site.Cartn_z' 9 7 'Structure model' '_atom_site.auth_asym_id' 10 7 'Structure model' '_atom_site.auth_seq_id' 11 7 'Structure model' '_atom_site.label_asym_id' 12 7 'Structure model' '_atom_site.label_entity_id' 13 7 'Structure model' '_chem_comp.name' 14 7 'Structure model' '_chem_comp.type' 15 7 'Structure model' '_pdbx_entity_nonpoly.entity_id' 16 7 'Structure model' '_pdbx_entity_nonpoly.name' 17 7 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 18 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 19 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 20 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 21 7 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 22 7 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 23 7 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 24 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 25 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 26 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 27 7 'Structure model' '_pdbx_struct_conn_angle.value' 28 7 'Structure model' '_struct_conn.conn_type_id' 29 7 'Structure model' '_struct_conn.id' 30 7 'Structure model' '_struct_conn.pdbx_dist_value' 31 7 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 32 7 'Structure model' '_struct_conn.pdbx_role' 33 7 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 34 7 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 35 7 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 36 7 'Structure model' '_struct_conn.ptnr1_label_asym_id' 37 7 'Structure model' '_struct_conn.ptnr1_label_atom_id' 38 7 'Structure model' '_struct_conn.ptnr1_label_comp_id' 39 7 'Structure model' '_struct_conn.ptnr1_label_seq_id' 40 7 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 41 7 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 42 7 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 43 7 'Structure model' '_struct_conn.ptnr2_label_asym_id' 44 7 'Structure model' '_struct_conn.ptnr2_label_atom_id' 45 7 'Structure model' '_struct_conn.ptnr2_label_comp_id' 46 7 'Structure model' '_struct_conn.ptnr2_label_seq_id' 47 7 'Structure model' '_struct_conn.ptnr2_symmetry' 48 8 'Structure model' '_chem_comp.pdbx_synonyms' 49 8 'Structure model' '_database_2.pdbx_DOI' 50 8 'Structure model' '_database_2.pdbx_database_accession' 51 9 'Structure model' '_chem_comp_atom.atom_id' 52 9 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0073 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 9 ? ? -72.93 -90.44 2 1 ASN A 12 ? ? -51.01 103.39 3 1 LEU A 13 ? ? 1.86 -53.09 4 1 CYS A 22 ? ? -144.34 -63.52 5 1 TYR A 24 ? ? 73.71 -154.90 6 1 CGU A 25 ? ? 26.07 -98.13 7 1 CGU A 26 ? ? -4.41 -41.84 8 1 ALA A 27 ? ? -68.72 39.73 9 1 PHE A 28 ? ? -134.74 -68.39 10 1 ALA A 30 ? ? 56.09 82.27 11 1 LEU A 31 ? ? -178.71 111.72 12 1 SER A 33 ? ? 67.44 71.58 13 1 GLU A 48 ? ? -25.82 -67.33 14 1 ALA A 50 ? ? -103.37 57.37 15 1 GLU A 111 ? ? 49.32 -117.76 16 1 ASN A 116 ? ? -151.13 71.23 17 1 GLN A 147 ? ? 75.98 -141.47 18 1 CYS A 148 ? ? 63.12 82.31 19 1 GLN A 155 ? ? -105.54 41.23 20 1 ARG A 159 ? ? -142.44 18.33 21 1 SER A 174 ? ? 20.78 53.22 22 1 ALA A 175 ? ? 59.29 -66.17 23 1 SER A 181 ? ? -62.36 -82.26 24 1 LYS A 182 ? ? -63.39 5.54 25 1 GLN A 184 ? ? 116.11 150.66 26 1 PHE A 186 ? ? -122.55 -156.32 27 1 ALA A 189 ? ? -74.51 35.03 28 1 GLU A 194 ? ? 36.85 -105.16 29 1 ASN A 199 ? ? -109.69 79.33 30 1 ASP A 201 ? ? -85.10 41.62 31 1 GLU A 227 ? ? -69.79 95.97 32 1 GLU A 228 ? ? -65.26 99.72 33 1 PRO A 261 ? ? -27.05 -47.95 34 1 PHE A 277 ? ? -125.41 -72.41 35 1 TYR A 294 ? ? -41.16 86.75 36 1 ILE A 295 ? ? -47.53 90.81 37 1 ASP A 296 ? ? -35.67 85.10 38 1 SER A 310 ? ? -140.51 58.21 39 1 SER A 332 ? ? -163.12 -146.11 40 1 ARG A 334 ? ? -157.57 -50.34 41 1 TRP A 348 ? ? -97.61 -137.52 42 1 ASN A 351 ? ? -150.33 89.55 43 1 HIS A 364 ? ? -143.87 -50.31 44 1 HIS A 385 ? ? -36.16 125.30 45 1 ARG A 391 ? ? -78.31 33.93 46 1 GLU A 392 ? ? -167.36 -69.20 47 1 ASN A 393 ? ? -146.48 25.76 48 1 SER A 410 ? ? -163.44 -158.83 49 1 ALA A 425 ? ? 89.13 -56.51 50 1 GLN A 429 ? ? -99.28 -72.12 51 1 GLU A 444 ? ? -93.11 38.54 52 1 TRP A 446 ? ? -147.55 -54.03 53 1 THR A 447 ? ? -59.06 -72.71 54 1 ASP A 473 ? ? -84.14 45.71 55 1 GLU A 492 ? ? 74.80 -22.58 56 1 CYS A 499 ? ? 88.31 22.50 57 1 PHE A 513 ? ? -127.68 -60.87 58 1 VAL A 523 ? ? -35.36 125.68 59 1 GLU A 527 ? ? 67.26 -113.25 60 1 CYS A 529 ? ? 166.95 -48.90 61 1 LYS A 534 ? ? -165.11 -122.62 62 1 LYS A 545 ? ? 7.39 -65.13 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ASN A 12 ? ? LEU A 13 ? ? 148.14 2 1 TYR A 24 ? ? CGU A 25 ? ? -143.60 3 1 ASP A 532 ? ? GLY A 533 ? ? 143.49 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 262 ? CG ? A ARG 262 CG 2 1 Y 1 A ARG 262 ? CD ? A ARG 262 CD 3 1 Y 1 A ARG 262 ? NE ? A ARG 262 NE 4 1 Y 1 A ARG 262 ? CZ ? A ARG 262 CZ 5 1 Y 1 A ARG 262 ? NH1 ? A ARG 262 NH1 6 1 Y 1 A ARG 262 ? NH2 ? A ARG 262 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A PHE 4 ? A PHE 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A GLU 233 ? A GLU 233 7 1 Y 1 A THR 234 ? A THR 234 8 1 Y 1 A GLY 235 ? A GLY 235 9 1 Y 1 A ASP 236 ? A ASP 236 10 1 Y 1 A GLY 237 ? A GLY 237 11 1 Y 1 A LEU 238 ? A LEU 238 12 1 Y 1 A ASP 239 ? A ASP 239 13 1 Y 1 A GLU 240 ? A GLU 240 14 1 Y 1 A ASP 241 ? A ASP 241 15 1 Y 1 A SER 242 ? A SER 242 16 1 Y 1 A ASP 243 ? A ASP 243 17 1 Y 1 A ARG 244 ? A ARG 244 18 1 Y 1 A ALA 245 ? A ALA 245 19 1 Y 1 A ILE 246 ? A ILE 246 20 1 Y 1 A GLU 247 ? A GLU 247 21 1 Y 1 A GLY 248 ? A GLY 248 22 1 Y 1 A ARG 249 ? A ARG 249 23 1 Y 1 A THR 250 ? A THR 250 24 1 Y 1 A ALA 251 ? A ALA 251 25 1 Y 1 A ASN 449 ? A ASN 449 26 1 Y 1 A VAL 450 ? A VAL 450 27 1 Y 1 A GLY 451 ? A GLY 451 28 1 Y 1 A LYS 452 ? A LYS 452 29 1 Y 1 A GLY 453 ? A GLY 453 30 1 Y 1 A TYR 558 ? A TYR 558 31 1 Y 1 A LEU 559 ? A LEU 559 32 1 Y 1 A GLU 560 ? A GLU 560 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CGU N N N N 74 CGU CA C N S 75 CGU C C N N 76 CGU O O N N 77 CGU OXT O N N 78 CGU CB C N N 79 CGU CG C N N 80 CGU CD1 C N N 81 CGU CD2 C N N 82 CGU OE11 O N N 83 CGU OE12 O N N 84 CGU OE21 O N N 85 CGU OE22 O N N 86 CGU H H N N 87 CGU H2 H N N 88 CGU HA H N N 89 CGU HXT H N N 90 CGU HB2 H N N 91 CGU HB3 H N N 92 CGU HG H N N 93 CGU HE12 H N N 94 CGU HE22 H N N 95 CYS N N N N 96 CYS CA C N R 97 CYS C C N N 98 CYS O O N N 99 CYS CB C N N 100 CYS SG S N N 101 CYS OXT O N N 102 CYS H H N N 103 CYS H2 H N N 104 CYS HA H N N 105 CYS HB2 H N N 106 CYS HB3 H N N 107 CYS HG H N N 108 CYS HXT H N N 109 GLN N N N N 110 GLN CA C N S 111 GLN C C N N 112 GLN O O N N 113 GLN CB C N N 114 GLN CG C N N 115 GLN CD C N N 116 GLN OE1 O N N 117 GLN NE2 N N N 118 GLN OXT O N N 119 GLN H H N N 120 GLN H2 H N N 121 GLN HA H N N 122 GLN HB2 H N N 123 GLN HB3 H N N 124 GLN HG2 H N N 125 GLN HG3 H N N 126 GLN HE21 H N N 127 GLN HE22 H N N 128 GLN HXT H N N 129 GLU N N N N 130 GLU CA C N S 131 GLU C C N N 132 GLU O O N N 133 GLU CB C N N 134 GLU CG C N N 135 GLU CD C N N 136 GLU OE1 O N N 137 GLU OE2 O N N 138 GLU OXT O N N 139 GLU H H N N 140 GLU H2 H N N 141 GLU HA H N N 142 GLU HB2 H N N 143 GLU HB3 H N N 144 GLU HG2 H N N 145 GLU HG3 H N N 146 GLU HE2 H N N 147 GLU HXT H N N 148 GLY N N N N 149 GLY CA C N N 150 GLY C C N N 151 GLY O O N N 152 GLY OXT O N N 153 GLY H H N N 154 GLY H2 H N N 155 GLY HA2 H N N 156 GLY HA3 H N N 157 GLY HXT H N N 158 HIS N N N N 159 HIS CA C N S 160 HIS C C N N 161 HIS O O N N 162 HIS CB C N N 163 HIS CG C Y N 164 HIS ND1 N Y N 165 HIS CD2 C Y N 166 HIS CE1 C Y N 167 HIS NE2 N Y N 168 HIS OXT O N N 169 HIS H H N N 170 HIS H2 H N N 171 HIS HA H N N 172 HIS HB2 H N N 173 HIS HB3 H N N 174 HIS HD1 H N N 175 HIS HD2 H N N 176 HIS HE1 H N N 177 HIS HE2 H N N 178 HIS HXT H N N 179 ILE N N N N 180 ILE CA C N S 181 ILE C C N N 182 ILE O O N N 183 ILE CB C N S 184 ILE CG1 C N N 185 ILE CG2 C N N 186 ILE CD1 C N N 187 ILE OXT O N N 188 ILE H H N N 189 ILE H2 H N N 190 ILE HA H N N 191 ILE HB H N N 192 ILE HG12 H N N 193 ILE HG13 H N N 194 ILE HG21 H N N 195 ILE HG22 H N N 196 ILE HG23 H N N 197 ILE HD11 H N N 198 ILE HD12 H N N 199 ILE HD13 H N N 200 ILE HXT H N N 201 LEU N N N N 202 LEU CA C N S 203 LEU C C N N 204 LEU O O N N 205 LEU CB C N N 206 LEU CG C N N 207 LEU CD1 C N N 208 LEU CD2 C N N 209 LEU OXT O N N 210 LEU H H N N 211 LEU H2 H N N 212 LEU HA H N N 213 LEU HB2 H N N 214 LEU HB3 H N N 215 LEU HG H N N 216 LEU HD11 H N N 217 LEU HD12 H N N 218 LEU HD13 H N N 219 LEU HD21 H N N 220 LEU HD22 H N N 221 LEU HD23 H N N 222 LEU HXT H N N 223 LYS N N N N 224 LYS CA C N S 225 LYS C C N N 226 LYS O O N N 227 LYS CB C N N 228 LYS CG C N N 229 LYS CD C N N 230 LYS CE C N N 231 LYS NZ N N N 232 LYS OXT O N N 233 LYS H H N N 234 LYS H2 H N N 235 LYS HA H N N 236 LYS HB2 H N N 237 LYS HB3 H N N 238 LYS HG2 H N N 239 LYS HG3 H N N 240 LYS HD2 H N N 241 LYS HD3 H N N 242 LYS HE2 H N N 243 LYS HE3 H N N 244 LYS HZ1 H N N 245 LYS HZ2 H N N 246 LYS HZ3 H N N 247 LYS HXT H N N 248 MET N N N N 249 MET CA C N S 250 MET C C N N 251 MET O O N N 252 MET CB C N N 253 MET CG C N N 254 MET SD S N N 255 MET CE C N N 256 MET OXT O N N 257 MET H H N N 258 MET H2 H N N 259 MET HA H N N 260 MET HB2 H N N 261 MET HB3 H N N 262 MET HG2 H N N 263 MET HG3 H N N 264 MET HE1 H N N 265 MET HE2 H N N 266 MET HE3 H N N 267 MET HXT H N N 268 MG MG MG N N 269 NAG C1 C N R 270 NAG C2 C N R 271 NAG C3 C N R 272 NAG C4 C N S 273 NAG C5 C N R 274 NAG C6 C N N 275 NAG C7 C N N 276 NAG C8 C N N 277 NAG N2 N N N 278 NAG O1 O N N 279 NAG O3 O N N 280 NAG O4 O N N 281 NAG O5 O N N 282 NAG O6 O N N 283 NAG O7 O N N 284 NAG H1 H N N 285 NAG H2 H N N 286 NAG H3 H N N 287 NAG H4 H N N 288 NAG H5 H N N 289 NAG H61 H N N 290 NAG H62 H N N 291 NAG H81 H N N 292 NAG H82 H N N 293 NAG H83 H N N 294 NAG HN2 H N N 295 NAG HO1 H N N 296 NAG HO3 H N N 297 NAG HO4 H N N 298 NAG HO6 H N N 299 PHE N N N N 300 PHE CA C N S 301 PHE C C N N 302 PHE O O N N 303 PHE CB C N N 304 PHE CG C Y N 305 PHE CD1 C Y N 306 PHE CD2 C Y N 307 PHE CE1 C Y N 308 PHE CE2 C Y N 309 PHE CZ C Y N 310 PHE OXT O N N 311 PHE H H N N 312 PHE H2 H N N 313 PHE HA H N N 314 PHE HB2 H N N 315 PHE HB3 H N N 316 PHE HD1 H N N 317 PHE HD2 H N N 318 PHE HE1 H N N 319 PHE HE2 H N N 320 PHE HZ H N N 321 PHE HXT H N N 322 PRO N N N N 323 PRO CA C N S 324 PRO C C N N 325 PRO O O N N 326 PRO CB C N N 327 PRO CG C N N 328 PRO CD C N N 329 PRO OXT O N N 330 PRO H H N N 331 PRO HA H N N 332 PRO HB2 H N N 333 PRO HB3 H N N 334 PRO HG2 H N N 335 PRO HG3 H N N 336 PRO HD2 H N N 337 PRO HD3 H N N 338 PRO HXT H N N 339 SER N N N N 340 SER CA C N S 341 SER C C N N 342 SER O O N N 343 SER CB C N N 344 SER OG O N N 345 SER OXT O N N 346 SER H H N N 347 SER H2 H N N 348 SER HA H N N 349 SER HB2 H N N 350 SER HB3 H N N 351 SER HG H N N 352 SER HXT H N N 353 THR N N N N 354 THR CA C N S 355 THR C C N N 356 THR O O N N 357 THR CB C N R 358 THR OG1 O N N 359 THR CG2 C N N 360 THR OXT O N N 361 THR H H N N 362 THR H2 H N N 363 THR HA H N N 364 THR HB H N N 365 THR HG1 H N N 366 THR HG21 H N N 367 THR HG22 H N N 368 THR HG23 H N N 369 THR HXT H N N 370 TRP N N N N 371 TRP CA C N S 372 TRP C C N N 373 TRP O O N N 374 TRP CB C N N 375 TRP CG C Y N 376 TRP CD1 C Y N 377 TRP CD2 C Y N 378 TRP NE1 N Y N 379 TRP CE2 C Y N 380 TRP CE3 C Y N 381 TRP CZ2 C Y N 382 TRP CZ3 C Y N 383 TRP CH2 C Y N 384 TRP OXT O N N 385 TRP H H N N 386 TRP H2 H N N 387 TRP HA H N N 388 TRP HB2 H N N 389 TRP HB3 H N N 390 TRP HD1 H N N 391 TRP HE1 H N N 392 TRP HE3 H N N 393 TRP HZ2 H N N 394 TRP HZ3 H N N 395 TRP HH2 H N N 396 TRP HXT H N N 397 TYR N N N N 398 TYR CA C N S 399 TYR C C N N 400 TYR O O N N 401 TYR CB C N N 402 TYR CG C Y N 403 TYR CD1 C Y N 404 TYR CD2 C Y N 405 TYR CE1 C Y N 406 TYR CE2 C Y N 407 TYR CZ C Y N 408 TYR OH O N N 409 TYR OXT O N N 410 TYR H H N N 411 TYR H2 H N N 412 TYR HA H N N 413 TYR HB2 H N N 414 TYR HB3 H N N 415 TYR HD1 H N N 416 TYR HD2 H N N 417 TYR HE1 H N N 418 TYR HE2 H N N 419 TYR HH H N N 420 TYR HXT H N N 421 VAL N N N N 422 VAL CA C N S 423 VAL C C N N 424 VAL O O N N 425 VAL CB C N N 426 VAL CG1 C N N 427 VAL CG2 C N N 428 VAL OXT O N N 429 VAL H H N N 430 VAL H2 H N N 431 VAL HA H N N 432 VAL HB H N N 433 VAL HG11 H N N 434 VAL HG12 H N N 435 VAL HG13 H N N 436 VAL HG21 H N N 437 VAL HG22 H N N 438 VAL HG23 H N N 439 VAL HXT H N N 440 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CGU N CA sing N N 70 CGU N H sing N N 71 CGU N H2 sing N N 72 CGU CA C sing N N 73 CGU CA CB sing N N 74 CGU CA HA sing N N 75 CGU C O doub N N 76 CGU C OXT sing N N 77 CGU OXT HXT sing N N 78 CGU CB CG sing N N 79 CGU CB HB2 sing N N 80 CGU CB HB3 sing N N 81 CGU CG CD1 sing N N 82 CGU CG CD2 sing N N 83 CGU CG HG sing N N 84 CGU CD1 OE11 doub N N 85 CGU CD1 OE12 sing N N 86 CGU CD2 OE21 doub N N 87 CGU CD2 OE22 sing N N 88 CGU OE12 HE12 sing N N 89 CGU OE22 HE22 sing N N 90 CYS N CA sing N N 91 CYS N H sing N N 92 CYS N H2 sing N N 93 CYS CA C sing N N 94 CYS CA CB sing N N 95 CYS CA HA sing N N 96 CYS C O doub N N 97 CYS C OXT sing N N 98 CYS CB SG sing N N 99 CYS CB HB2 sing N N 100 CYS CB HB3 sing N N 101 CYS SG HG sing N N 102 CYS OXT HXT sing N N 103 GLN N CA sing N N 104 GLN N H sing N N 105 GLN N H2 sing N N 106 GLN CA C sing N N 107 GLN CA CB sing N N 108 GLN CA HA sing N N 109 GLN C O doub N N 110 GLN C OXT sing N N 111 GLN CB CG sing N N 112 GLN CB HB2 sing N N 113 GLN CB HB3 sing N N 114 GLN CG CD sing N N 115 GLN CG HG2 sing N N 116 GLN CG HG3 sing N N 117 GLN CD OE1 doub N N 118 GLN CD NE2 sing N N 119 GLN NE2 HE21 sing N N 120 GLN NE2 HE22 sing N N 121 GLN OXT HXT sing N N 122 GLU N CA sing N N 123 GLU N H sing N N 124 GLU N H2 sing N N 125 GLU CA C sing N N 126 GLU CA CB sing N N 127 GLU CA HA sing N N 128 GLU C O doub N N 129 GLU C OXT sing N N 130 GLU CB CG sing N N 131 GLU CB HB2 sing N N 132 GLU CB HB3 sing N N 133 GLU CG CD sing N N 134 GLU CG HG2 sing N N 135 GLU CG HG3 sing N N 136 GLU CD OE1 doub N N 137 GLU CD OE2 sing N N 138 GLU OE2 HE2 sing N N 139 GLU OXT HXT sing N N 140 GLY N CA sing N N 141 GLY N H sing N N 142 GLY N H2 sing N N 143 GLY CA C sing N N 144 GLY CA HA2 sing N N 145 GLY CA HA3 sing N N 146 GLY C O doub N N 147 GLY C OXT sing N N 148 GLY OXT HXT sing N N 149 HIS N CA sing N N 150 HIS N H sing N N 151 HIS N H2 sing N N 152 HIS CA C sing N N 153 HIS CA CB sing N N 154 HIS CA HA sing N N 155 HIS C O doub N N 156 HIS C OXT sing N N 157 HIS CB CG sing N N 158 HIS CB HB2 sing N N 159 HIS CB HB3 sing N N 160 HIS CG ND1 sing Y N 161 HIS CG CD2 doub Y N 162 HIS ND1 CE1 doub Y N 163 HIS ND1 HD1 sing N N 164 HIS CD2 NE2 sing Y N 165 HIS CD2 HD2 sing N N 166 HIS CE1 NE2 sing Y N 167 HIS CE1 HE1 sing N N 168 HIS NE2 HE2 sing N N 169 HIS OXT HXT sing N N 170 ILE N CA sing N N 171 ILE N H sing N N 172 ILE N H2 sing N N 173 ILE CA C sing N N 174 ILE CA CB sing N N 175 ILE CA HA sing N N 176 ILE C O doub N N 177 ILE C OXT sing N N 178 ILE CB CG1 sing N N 179 ILE CB CG2 sing N N 180 ILE CB HB sing N N 181 ILE CG1 CD1 sing N N 182 ILE CG1 HG12 sing N N 183 ILE CG1 HG13 sing N N 184 ILE CG2 HG21 sing N N 185 ILE CG2 HG22 sing N N 186 ILE CG2 HG23 sing N N 187 ILE CD1 HD11 sing N N 188 ILE CD1 HD12 sing N N 189 ILE CD1 HD13 sing N N 190 ILE OXT HXT sing N N 191 LEU N CA sing N N 192 LEU N H sing N N 193 LEU N H2 sing N N 194 LEU CA C sing N N 195 LEU CA CB sing N N 196 LEU CA HA sing N N 197 LEU C O doub N N 198 LEU C OXT sing N N 199 LEU CB CG sing N N 200 LEU CB HB2 sing N N 201 LEU CB HB3 sing N N 202 LEU CG CD1 sing N N 203 LEU CG CD2 sing N N 204 LEU CG HG sing N N 205 LEU CD1 HD11 sing N N 206 LEU CD1 HD12 sing N N 207 LEU CD1 HD13 sing N N 208 LEU CD2 HD21 sing N N 209 LEU CD2 HD22 sing N N 210 LEU CD2 HD23 sing N N 211 LEU OXT HXT sing N N 212 LYS N CA sing N N 213 LYS N H sing N N 214 LYS N H2 sing N N 215 LYS CA C sing N N 216 LYS CA CB sing N N 217 LYS CA HA sing N N 218 LYS C O doub N N 219 LYS C OXT sing N N 220 LYS CB CG sing N N 221 LYS CB HB2 sing N N 222 LYS CB HB3 sing N N 223 LYS CG CD sing N N 224 LYS CG HG2 sing N N 225 LYS CG HG3 sing N N 226 LYS CD CE sing N N 227 LYS CD HD2 sing N N 228 LYS CD HD3 sing N N 229 LYS CE NZ sing N N 230 LYS CE HE2 sing N N 231 LYS CE HE3 sing N N 232 LYS NZ HZ1 sing N N 233 LYS NZ HZ2 sing N N 234 LYS NZ HZ3 sing N N 235 LYS OXT HXT sing N N 236 MET N CA sing N N 237 MET N H sing N N 238 MET N H2 sing N N 239 MET CA C sing N N 240 MET CA CB sing N N 241 MET CA HA sing N N 242 MET C O doub N N 243 MET C OXT sing N N 244 MET CB CG sing N N 245 MET CB HB2 sing N N 246 MET CB HB3 sing N N 247 MET CG SD sing N N 248 MET CG HG2 sing N N 249 MET CG HG3 sing N N 250 MET SD CE sing N N 251 MET CE HE1 sing N N 252 MET CE HE2 sing N N 253 MET CE HE3 sing N N 254 MET OXT HXT sing N N 255 NAG C1 C2 sing N N 256 NAG C1 O1 sing N N 257 NAG C1 O5 sing N N 258 NAG C1 H1 sing N N 259 NAG C2 C3 sing N N 260 NAG C2 N2 sing N N 261 NAG C2 H2 sing N N 262 NAG C3 C4 sing N N 263 NAG C3 O3 sing N N 264 NAG C3 H3 sing N N 265 NAG C4 C5 sing N N 266 NAG C4 O4 sing N N 267 NAG C4 H4 sing N N 268 NAG C5 C6 sing N N 269 NAG C5 O5 sing N N 270 NAG C5 H5 sing N N 271 NAG C6 O6 sing N N 272 NAG C6 H61 sing N N 273 NAG C6 H62 sing N N 274 NAG C7 C8 sing N N 275 NAG C7 N2 sing N N 276 NAG C7 O7 doub N N 277 NAG C8 H81 sing N N 278 NAG C8 H82 sing N N 279 NAG C8 H83 sing N N 280 NAG N2 HN2 sing N N 281 NAG O1 HO1 sing N N 282 NAG O3 HO3 sing N N 283 NAG O4 HO4 sing N N 284 NAG O6 HO6 sing N N 285 PHE N CA sing N N 286 PHE N H sing N N 287 PHE N H2 sing N N 288 PHE CA C sing N N 289 PHE CA CB sing N N 290 PHE CA HA sing N N 291 PHE C O doub N N 292 PHE C OXT sing N N 293 PHE CB CG sing N N 294 PHE CB HB2 sing N N 295 PHE CB HB3 sing N N 296 PHE CG CD1 doub Y N 297 PHE CG CD2 sing Y N 298 PHE CD1 CE1 sing Y N 299 PHE CD1 HD1 sing N N 300 PHE CD2 CE2 doub Y N 301 PHE CD2 HD2 sing N N 302 PHE CE1 CZ doub Y N 303 PHE CE1 HE1 sing N N 304 PHE CE2 CZ sing Y N 305 PHE CE2 HE2 sing N N 306 PHE CZ HZ sing N N 307 PHE OXT HXT sing N N 308 PRO N CA sing N N 309 PRO N CD sing N N 310 PRO N H sing N N 311 PRO CA C sing N N 312 PRO CA CB sing N N 313 PRO CA HA sing N N 314 PRO C O doub N N 315 PRO C OXT sing N N 316 PRO CB CG sing N N 317 PRO CB HB2 sing N N 318 PRO CB HB3 sing N N 319 PRO CG CD sing N N 320 PRO CG HG2 sing N N 321 PRO CG HG3 sing N N 322 PRO CD HD2 sing N N 323 PRO CD HD3 sing N N 324 PRO OXT HXT sing N N 325 SER N CA sing N N 326 SER N H sing N N 327 SER N H2 sing N N 328 SER CA C sing N N 329 SER CA CB sing N N 330 SER CA HA sing N N 331 SER C O doub N N 332 SER C OXT sing N N 333 SER CB OG sing N N 334 SER CB HB2 sing N N 335 SER CB HB3 sing N N 336 SER OG HG sing N N 337 SER OXT HXT sing N N 338 THR N CA sing N N 339 THR N H sing N N 340 THR N H2 sing N N 341 THR CA C sing N N 342 THR CA CB sing N N 343 THR CA HA sing N N 344 THR C O doub N N 345 THR C OXT sing N N 346 THR CB OG1 sing N N 347 THR CB CG2 sing N N 348 THR CB HB sing N N 349 THR OG1 HG1 sing N N 350 THR CG2 HG21 sing N N 351 THR CG2 HG22 sing N N 352 THR CG2 HG23 sing N N 353 THR OXT HXT sing N N 354 TRP N CA sing N N 355 TRP N H sing N N 356 TRP N H2 sing N N 357 TRP CA C sing N N 358 TRP CA CB sing N N 359 TRP CA HA sing N N 360 TRP C O doub N N 361 TRP C OXT sing N N 362 TRP CB CG sing N N 363 TRP CB HB2 sing N N 364 TRP CB HB3 sing N N 365 TRP CG CD1 doub Y N 366 TRP CG CD2 sing Y N 367 TRP CD1 NE1 sing Y N 368 TRP CD1 HD1 sing N N 369 TRP CD2 CE2 doub Y N 370 TRP CD2 CE3 sing Y N 371 TRP NE1 CE2 sing Y N 372 TRP NE1 HE1 sing N N 373 TRP CE2 CZ2 sing Y N 374 TRP CE3 CZ3 doub Y N 375 TRP CE3 HE3 sing N N 376 TRP CZ2 CH2 doub Y N 377 TRP CZ2 HZ2 sing N N 378 TRP CZ3 CH2 sing Y N 379 TRP CZ3 HZ3 sing N N 380 TRP CH2 HH2 sing N N 381 TRP OXT HXT sing N N 382 TYR N CA sing N N 383 TYR N H sing N N 384 TYR N H2 sing N N 385 TYR CA C sing N N 386 TYR CA CB sing N N 387 TYR CA HA sing N N 388 TYR C O doub N N 389 TYR C OXT sing N N 390 TYR CB CG sing N N 391 TYR CB HB2 sing N N 392 TYR CB HB3 sing N N 393 TYR CG CD1 doub Y N 394 TYR CG CD2 sing Y N 395 TYR CD1 CE1 sing Y N 396 TYR CD1 HD1 sing N N 397 TYR CD2 CE2 doub Y N 398 TYR CD2 HD2 sing N N 399 TYR CE1 CZ doub Y N 400 TYR CE1 HE1 sing N N 401 TYR CE2 CZ sing Y N 402 TYR CE2 HE2 sing N N 403 TYR CZ OH sing N N 404 TYR OH HH sing N N 405 TYR OXT HXT sing N N 406 VAL N CA sing N N 407 VAL N H sing N N 408 VAL N H2 sing N N 409 VAL CA C sing N N 410 VAL CA CB sing N N 411 VAL CA HA sing N N 412 VAL C O doub N N 413 VAL C OXT sing N N 414 VAL CB CG1 sing N N 415 VAL CB CG2 sing N N 416 VAL CB HB sing N N 417 VAL CG1 HG11 sing N N 418 VAL CG1 HG12 sing N N 419 VAL CG1 HG13 sing N N 420 VAL CG2 HG21 sing N N 421 VAL CG2 HG22 sing N N 422 VAL CG2 HG23 sing N N 423 VAL OXT HXT sing N N 424 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Heart, Lung, and Blood Institute (NIH/NHLBI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'HL049413, HL073813 and HL112303 (EDC)' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 A NAG 602 n B 2 NAG 2 B NAG 2 A NAG 603 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 NAG _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NAG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 4 'MAGNESIUM ION' MG # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4O03 _pdbx_initial_refinement_model.details 'pdb code 4O03' #