data_5EDR # _entry.id 5EDR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5EDR WWPDB D_1000214746 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5EDQ PDB . unspecified 5EDP PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5EDR _pdbx_database_status.recvd_initial_deposition_date 2015-10-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Eigenbrot, C.' 1 'Yu, C.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Bioorg.Med.Chem.Lett. _citation.journal_id_ASTM BMCLE8 _citation.journal_id_CSD 1127 _citation.journal_id_ISSN 1464-3405 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 26 _citation.language ? _citation.page_first 534 _citation.page_last 539 _citation.title ;4-Aminoindazolyl-dihydrofuro[3,4-d]pyrimidines as non-covalent inhibitors of mutant epidermal growth factor receptor tyrosine kinase. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2015.11.078 _citation.pdbx_database_id_PubMed 26639762 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hanan, E.J.' 1 primary 'Baumgardner, M.' 2 primary 'Bryan, M.C.' 3 primary 'Chen, Y.' 4 primary 'Eigenbrot, C.' 5 primary 'Fan, P.' 6 primary 'Gu, X.H.' 7 primary 'La, H.' 8 primary 'Malek, S.' 9 primary 'Purkey, H.E.' 10 primary 'Schaefer, G.' 11 primary 'Schmidt, S.' 12 primary 'Sideris, S.' 13 primary 'Yen, I.' 14 primary 'Yu, C.' 15 primary 'Heffron, T.P.' 16 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5EDR _cell.details ? _cell.formula_units_Z ? _cell.length_a 148.800 _cell.length_a_esd ? _cell.length_b 148.800 _cell.length_b_esd ? _cell.length_c 148.800 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5EDR _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 37549.398 1 2.7.10.1 'T790M, L858R, E865A, E866A, K867A' ? ? 2 non-polymer syn '~{N}-(1~{H}-indazol-3-yl)-7,7-dimethyl-2-(2-methylpyrazol-3-yl)-5~{H}-furo[3,4-d]pyrimidin-4-amine' 361.400 1 ? ? ? ? 3 water nat water 18.015 57 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1,Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH VCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKI TDFGRAKLLGAAAAEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERL PQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDA DEYLIPQQGNS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH VCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKI TDFGRAKLLGAAAAEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERL PQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDA DEYLIPQQGNS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLY n 1 4 GLU n 1 5 ALA n 1 6 PRO n 1 7 ASN n 1 8 GLN n 1 9 ALA n 1 10 LEU n 1 11 LEU n 1 12 ARG n 1 13 ILE n 1 14 LEU n 1 15 LYS n 1 16 GLU n 1 17 THR n 1 18 GLU n 1 19 PHE n 1 20 LYS n 1 21 LYS n 1 22 ILE n 1 23 LYS n 1 24 VAL n 1 25 LEU n 1 26 GLY n 1 27 SER n 1 28 GLY n 1 29 ALA n 1 30 PHE n 1 31 GLY n 1 32 THR n 1 33 VAL n 1 34 TYR n 1 35 LYS n 1 36 GLY n 1 37 LEU n 1 38 TRP n 1 39 ILE n 1 40 PRO n 1 41 GLU n 1 42 GLY n 1 43 GLU n 1 44 LYS n 1 45 VAL n 1 46 LYS n 1 47 ILE n 1 48 PRO n 1 49 VAL n 1 50 ALA n 1 51 ILE n 1 52 LYS n 1 53 GLU n 1 54 LEU n 1 55 ARG n 1 56 GLU n 1 57 ALA n 1 58 THR n 1 59 SER n 1 60 PRO n 1 61 LYS n 1 62 ALA n 1 63 ASN n 1 64 LYS n 1 65 GLU n 1 66 ILE n 1 67 LEU n 1 68 ASP n 1 69 GLU n 1 70 ALA n 1 71 TYR n 1 72 VAL n 1 73 MET n 1 74 ALA n 1 75 SER n 1 76 VAL n 1 77 ASP n 1 78 ASN n 1 79 PRO n 1 80 HIS n 1 81 VAL n 1 82 CYS n 1 83 ARG n 1 84 LEU n 1 85 LEU n 1 86 GLY n 1 87 ILE n 1 88 CYS n 1 89 LEU n 1 90 THR n 1 91 SER n 1 92 THR n 1 93 VAL n 1 94 GLN n 1 95 LEU n 1 96 ILE n 1 97 MET n 1 98 GLN n 1 99 LEU n 1 100 MET n 1 101 PRO n 1 102 PHE n 1 103 GLY n 1 104 CYS n 1 105 LEU n 1 106 LEU n 1 107 ASP n 1 108 TYR n 1 109 VAL n 1 110 ARG n 1 111 GLU n 1 112 HIS n 1 113 LYS n 1 114 ASP n 1 115 ASN n 1 116 ILE n 1 117 GLY n 1 118 SER n 1 119 GLN n 1 120 TYR n 1 121 LEU n 1 122 LEU n 1 123 ASN n 1 124 TRP n 1 125 CYS n 1 126 VAL n 1 127 GLN n 1 128 ILE n 1 129 ALA n 1 130 LYS n 1 131 GLY n 1 132 MET n 1 133 ASN n 1 134 TYR n 1 135 LEU n 1 136 GLU n 1 137 ASP n 1 138 ARG n 1 139 ARG n 1 140 LEU n 1 141 VAL n 1 142 HIS n 1 143 ARG n 1 144 ASP n 1 145 LEU n 1 146 ALA n 1 147 ALA n 1 148 ARG n 1 149 ASN n 1 150 VAL n 1 151 LEU n 1 152 VAL n 1 153 LYS n 1 154 THR n 1 155 PRO n 1 156 GLN n 1 157 HIS n 1 158 VAL n 1 159 LYS n 1 160 ILE n 1 161 THR n 1 162 ASP n 1 163 PHE n 1 164 GLY n 1 165 ARG n 1 166 ALA n 1 167 LYS n 1 168 LEU n 1 169 LEU n 1 170 GLY n 1 171 ALA n 1 172 ALA n 1 173 ALA n 1 174 ALA n 1 175 GLU n 1 176 TYR n 1 177 HIS n 1 178 ALA n 1 179 GLU n 1 180 GLY n 1 181 GLY n 1 182 LYS n 1 183 VAL n 1 184 PRO n 1 185 ILE n 1 186 LYS n 1 187 TRP n 1 188 MET n 1 189 ALA n 1 190 LEU n 1 191 GLU n 1 192 SER n 1 193 ILE n 1 194 LEU n 1 195 HIS n 1 196 ARG n 1 197 ILE n 1 198 TYR n 1 199 THR n 1 200 HIS n 1 201 GLN n 1 202 SER n 1 203 ASP n 1 204 VAL n 1 205 TRP n 1 206 SER n 1 207 TYR n 1 208 GLY n 1 209 VAL n 1 210 THR n 1 211 VAL n 1 212 TRP n 1 213 GLU n 1 214 LEU n 1 215 MET n 1 216 THR n 1 217 PHE n 1 218 GLY n 1 219 SER n 1 220 LYS n 1 221 PRO n 1 222 TYR n 1 223 ASP n 1 224 GLY n 1 225 ILE n 1 226 PRO n 1 227 ALA n 1 228 SER n 1 229 GLU n 1 230 ILE n 1 231 SER n 1 232 SER n 1 233 ILE n 1 234 LEU n 1 235 GLU n 1 236 LYS n 1 237 GLY n 1 238 GLU n 1 239 ARG n 1 240 LEU n 1 241 PRO n 1 242 GLN n 1 243 PRO n 1 244 PRO n 1 245 ILE n 1 246 CYS n 1 247 THR n 1 248 ILE n 1 249 ASP n 1 250 VAL n 1 251 TYR n 1 252 MET n 1 253 ILE n 1 254 MET n 1 255 VAL n 1 256 LYS n 1 257 CYS n 1 258 TRP n 1 259 MET n 1 260 ILE n 1 261 ASP n 1 262 ALA n 1 263 ASP n 1 264 SER n 1 265 ARG n 1 266 PRO n 1 267 LYS n 1 268 PHE n 1 269 ARG n 1 270 GLU n 1 271 LEU n 1 272 ILE n 1 273 ILE n 1 274 GLU n 1 275 PHE n 1 276 SER n 1 277 LYS n 1 278 MET n 1 279 ALA n 1 280 ARG n 1 281 ASP n 1 282 PRO n 1 283 GLN n 1 284 ARG n 1 285 TYR n 1 286 LEU n 1 287 VAL n 1 288 ILE n 1 289 GLN n 1 290 GLY n 1 291 ASP n 1 292 GLU n 1 293 ARG n 1 294 MET n 1 295 HIS n 1 296 LEU n 1 297 PRO n 1 298 SER n 1 299 PRO n 1 300 THR n 1 301 ASP n 1 302 SER n 1 303 ASN n 1 304 PHE n 1 305 TYR n 1 306 ARG n 1 307 ALA n 1 308 LEU n 1 309 MET n 1 310 ASP n 1 311 GLU n 1 312 GLU n 1 313 ASP n 1 314 MET n 1 315 ASP n 1 316 ASP n 1 317 VAL n 1 318 VAL n 1 319 ASP n 1 320 ALA n 1 321 ASP n 1 322 GLU n 1 323 TYR n 1 324 LEU n 1 325 ILE n 1 326 PRO n 1 327 GLN n 1 328 GLN n 1 329 GLY n 1 330 ASN n 1 331 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 331 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQQG ; _struct_ref.pdbx_align_begin 695 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5EDR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 329 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 695 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 695 _struct_ref_seq.pdbx_auth_seq_align_end 1022 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5EDR GLY A 1 ? UNP P00533 ? ? 'expression tag' 694 1 1 5EDR MET A 97 ? UNP P00533 THR 790 'engineered mutation' 790 2 1 5EDR ARG A 165 ? UNP P00533 LEU 858 'engineered mutation' 858 3 1 5EDR ALA A 172 ? UNP P00533 GLU 865 'engineered mutation' 865 4 1 5EDR ALA A 173 ? UNP P00533 GLU 866 'engineered mutation' 866 5 1 5EDR ALA A 174 ? UNP P00533 LYS 867 'engineered mutation' 867 6 1 5EDR ASN A 330 ? UNP P00533 ? ? 'expression tag' 1023 7 1 5EDR SER A 331 ? UNP P00533 ? ? 'expression tag' 1024 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 5N4 non-polymer . '~{N}-(1~{H}-indazol-3-yl)-7,7-dimethyl-2-(2-methylpyrazol-3-yl)-5~{H}-furo[3,4-d]pyrimidin-4-amine' ? 'C19 H19 N7 O' 361.400 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5EDR _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.66 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 10K, ethylene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-02-29 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 78.88 _reflns.entry_id 5EDR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.60 _reflns.d_resolution_low 47.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 16882 _reflns.number_obs 16882 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I -3 _reflns.percent_possible_obs 99.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.056 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.0000 _refine.B_iso_max ? _refine.B_iso_mean 77.17 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.9438 _refine.correlation_coeff_Fo_to_Fc_free 0.9311 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5EDR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.60 _refine.ls_d_res_low 47.0 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16852 _refine.ls_number_reflns_R_free 701 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.07 _refine.ls_percent_reflns_R_free 4.16 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1916 _refine.ls_R_factor_R_free 0.2151 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1906 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.215 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.211 _refine.pdbx_overall_SU_R_Blow_DPI 0.292 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.298 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5EDR _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.427 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2409 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 2493 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 47.0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2493 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.08 ? 3381 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 874 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 60 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 349 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2493 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.93 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 18.76 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 322 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2845 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.60 _refine_ls_shell.d_res_low 2.78 _refine_ls_shell.number_reflns_all 3032 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 115 _refine_ls_shell.number_reflns_R_work 2917 _refine_ls_shell.percent_reflns_obs 99.07 _refine_ls_shell.percent_reflns_R_free 3.79 _refine_ls_shell.R_factor_all 0.2243 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2615 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2229 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5EDR _struct.title ;EGFR kinase (T790M/L858R) with inhibitor compound 27: ~{N}-(1~{H}-indazol-3-yl)-7,7-dimethyl-2-(2-methylpyrazol-3-yl)-5~{H}-furo[3,4-d]pyrimidin-4-amine ; _struct.pdbx_descriptor 'Epidermal growth factor receptor (E.C.2.7.10.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5EDR _struct_keywords.text 'protein kinase, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 15 ? THR A 17 ? LYS A 708 THR A 710 5 ? 3 HELX_P HELX_P2 AA2 SER A 59 ? SER A 75 ? SER A 752 SER A 768 1 ? 17 HELX_P HELX_P3 AA3 CYS A 104 ? LYS A 113 ? CYS A 797 LYS A 806 1 ? 10 HELX_P HELX_P4 AA4 ASP A 114 ? ILE A 116 ? ASP A 807 ILE A 809 5 ? 3 HELX_P HELX_P5 AA5 GLY A 117 ? ARG A 138 ? GLY A 810 ARG A 831 1 ? 22 HELX_P HELX_P6 AA6 ALA A 146 ? ARG A 148 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P7 AA7 PRO A 184 ? MET A 188 ? PRO A 877 MET A 881 5 ? 5 HELX_P HELX_P8 AA8 ALA A 189 ? ARG A 196 ? ALA A 882 ARG A 889 1 ? 8 HELX_P HELX_P9 AA9 THR A 199 ? THR A 216 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P10 AB1 PRO A 226 ? SER A 228 ? PRO A 919 SER A 921 5 ? 3 HELX_P HELX_P11 AB2 GLU A 229 ? GLY A 237 ? GLU A 922 GLY A 930 1 ? 9 HELX_P HELX_P12 AB3 THR A 247 ? TRP A 258 ? THR A 940 TRP A 951 1 ? 12 HELX_P HELX_P13 AB4 ASP A 261 ? ARG A 265 ? ASP A 954 ARG A 958 5 ? 5 HELX_P HELX_P14 AB5 LYS A 267 ? ARG A 280 ? LYS A 960 ARG A 973 1 ? 14 HELX_P HELX_P15 AB6 ASP A 281 ? TYR A 285 ? ASP A 974 TYR A 978 5 ? 5 HELX_P HELX_P16 AB7 GLY A 290 ? MET A 294 ? GLY A 983 MET A 987 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 19 ? SER A 27 ? PHE A 712 SER A 720 AA1 2 THR A 32 ? TRP A 38 ? THR A 725 TRP A 731 AA1 3 ILE A 47 ? GLU A 53 ? ILE A 740 GLU A 746 AA1 4 GLN A 94 ? GLN A 98 ? GLN A 787 GLN A 791 AA1 5 LEU A 84 ? CYS A 88 ? LEU A 777 CYS A 781 AA2 1 VAL A 150 ? THR A 154 ? VAL A 843 THR A 847 AA2 2 HIS A 157 ? ILE A 160 ? HIS A 850 ILE A 853 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 22 ? N ILE A 715 O LYS A 35 ? O LYS A 728 AA1 2 3 N TRP A 38 ? N TRP A 731 O ILE A 47 ? O ILE A 740 AA1 3 4 N ALA A 50 ? N ALA A 743 O MET A 97 ? O MET A 790 AA1 4 5 O ILE A 96 ? O ILE A 789 N LEU A 85 ? N LEU A 778 AA2 1 2 N LEU A 151 ? N LEU A 844 O LYS A 159 ? O LYS A 852 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 5N4 _struct_site.pdbx_auth_seq_id 1101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'binding site for residue 5N4 A 1101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 VAL A 33 ? VAL A 726 . ? 1_555 ? 2 AC1 10 ALA A 50 ? ALA A 743 . ? 1_555 ? 3 AC1 10 LYS A 52 ? LYS A 745 . ? 1_555 ? 4 AC1 10 GLU A 69 ? GLU A 762 . ? 1_555 ? 5 AC1 10 MET A 73 ? MET A 766 . ? 1_555 ? 6 AC1 10 LEU A 95 ? LEU A 788 . ? 1_555 ? 7 AC1 10 MET A 97 ? MET A 790 . ? 1_555 ? 8 AC1 10 GLN A 98 ? GLN A 791 . ? 1_555 ? 9 AC1 10 MET A 100 ? MET A 793 . ? 1_555 ? 10 AC1 10 LEU A 151 ? LEU A 844 . ? 1_555 ? # _atom_sites.entry_id 5EDR _atom_sites.fract_transf_matrix[1][1] 0.006713 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006713 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006713 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 694 ? ? ? A . n A 1 2 SER 2 695 ? ? ? A . n A 1 3 GLY 3 696 ? ? ? A . n A 1 4 GLU 4 697 697 GLU GLU A . n A 1 5 ALA 5 698 698 ALA ALA A . n A 1 6 PRO 6 699 699 PRO PRO A . n A 1 7 ASN 7 700 700 ASN ASN A . n A 1 8 GLN 8 701 701 GLN GLN A . n A 1 9 ALA 9 702 702 ALA ALA A . n A 1 10 LEU 10 703 703 LEU LEU A . n A 1 11 LEU 11 704 704 LEU LEU A . n A 1 12 ARG 12 705 705 ARG ARG A . n A 1 13 ILE 13 706 706 ILE ILE A . n A 1 14 LEU 14 707 707 LEU LEU A . n A 1 15 LYS 15 708 708 LYS LYS A . n A 1 16 GLU 16 709 709 GLU GLU A . n A 1 17 THR 17 710 710 THR THR A . n A 1 18 GLU 18 711 711 GLU GLU A . n A 1 19 PHE 19 712 712 PHE PHE A . n A 1 20 LYS 20 713 713 LYS LYS A . n A 1 21 LYS 21 714 714 LYS LYS A . n A 1 22 ILE 22 715 715 ILE ILE A . n A 1 23 LYS 23 716 716 LYS LYS A . n A 1 24 VAL 24 717 717 VAL VAL A . n A 1 25 LEU 25 718 718 LEU LEU A . n A 1 26 GLY 26 719 719 GLY GLY A . n A 1 27 SER 27 720 720 SER SER A . n A 1 28 GLY 28 721 721 GLY GLY A . n A 1 29 ALA 29 722 722 ALA ALA A . n A 1 30 PHE 30 723 723 PHE PHE A . n A 1 31 GLY 31 724 724 GLY GLY A . n A 1 32 THR 32 725 725 THR THR A . n A 1 33 VAL 33 726 726 VAL VAL A . n A 1 34 TYR 34 727 727 TYR TYR A . n A 1 35 LYS 35 728 728 LYS LYS A . n A 1 36 GLY 36 729 729 GLY GLY A . n A 1 37 LEU 37 730 730 LEU LEU A . n A 1 38 TRP 38 731 731 TRP TRP A . n A 1 39 ILE 39 732 732 ILE ILE A . n A 1 40 PRO 40 733 733 PRO PRO A . n A 1 41 GLU 41 734 734 GLU GLU A . n A 1 42 GLY 42 735 735 GLY GLY A . n A 1 43 GLU 43 736 736 GLU GLU A . n A 1 44 LYS 44 737 737 LYS LYS A . n A 1 45 VAL 45 738 738 VAL VAL A . n A 1 46 LYS 46 739 739 LYS LYS A . n A 1 47 ILE 47 740 740 ILE ILE A . n A 1 48 PRO 48 741 741 PRO PRO A . n A 1 49 VAL 49 742 742 VAL VAL A . n A 1 50 ALA 50 743 743 ALA ALA A . n A 1 51 ILE 51 744 744 ILE ILE A . n A 1 52 LYS 52 745 745 LYS LYS A . n A 1 53 GLU 53 746 746 GLU GLU A . n A 1 54 LEU 54 747 747 LEU LEU A . n A 1 55 ARG 55 748 ? ? ? A . n A 1 56 GLU 56 749 ? ? ? A . n A 1 57 ALA 57 750 750 ALA ALA A . n A 1 58 THR 58 751 751 THR THR A . n A 1 59 SER 59 752 752 SER SER A . n A 1 60 PRO 60 753 753 PRO PRO A . n A 1 61 LYS 61 754 754 LYS LYS A . n A 1 62 ALA 62 755 755 ALA ALA A . n A 1 63 ASN 63 756 756 ASN ASN A . n A 1 64 LYS 64 757 757 LYS LYS A . n A 1 65 GLU 65 758 758 GLU GLU A . n A 1 66 ILE 66 759 759 ILE ILE A . n A 1 67 LEU 67 760 760 LEU LEU A . n A 1 68 ASP 68 761 761 ASP ASP A . n A 1 69 GLU 69 762 762 GLU GLU A . n A 1 70 ALA 70 763 763 ALA ALA A . n A 1 71 TYR 71 764 764 TYR TYR A . n A 1 72 VAL 72 765 765 VAL VAL A . n A 1 73 MET 73 766 766 MET MET A . n A 1 74 ALA 74 767 767 ALA ALA A . n A 1 75 SER 75 768 768 SER SER A . n A 1 76 VAL 76 769 769 VAL VAL A . n A 1 77 ASP 77 770 770 ASP ASP A . n A 1 78 ASN 78 771 771 ASN ASN A . n A 1 79 PRO 79 772 772 PRO PRO A . n A 1 80 HIS 80 773 773 HIS HIS A . n A 1 81 VAL 81 774 774 VAL VAL A . n A 1 82 CYS 82 775 775 CYS CYS A . n A 1 83 ARG 83 776 776 ARG ARG A . n A 1 84 LEU 84 777 777 LEU LEU A . n A 1 85 LEU 85 778 778 LEU LEU A . n A 1 86 GLY 86 779 779 GLY GLY A . n A 1 87 ILE 87 780 780 ILE ILE A . n A 1 88 CYS 88 781 781 CYS CYS A . n A 1 89 LEU 89 782 782 LEU LEU A . n A 1 90 THR 90 783 783 THR THR A . n A 1 91 SER 91 784 784 SER SER A . n A 1 92 THR 92 785 785 THR THR A . n A 1 93 VAL 93 786 786 VAL VAL A . n A 1 94 GLN 94 787 787 GLN GLN A . n A 1 95 LEU 95 788 788 LEU LEU A . n A 1 96 ILE 96 789 789 ILE ILE A . n A 1 97 MET 97 790 790 MET MET A . n A 1 98 GLN 98 791 791 GLN GLN A . n A 1 99 LEU 99 792 792 LEU LEU A . n A 1 100 MET 100 793 793 MET MET A . n A 1 101 PRO 101 794 794 PRO PRO A . n A 1 102 PHE 102 795 795 PHE PHE A . n A 1 103 GLY 103 796 796 GLY GLY A . n A 1 104 CYS 104 797 797 CYS CYS A . n A 1 105 LEU 105 798 798 LEU LEU A . n A 1 106 LEU 106 799 799 LEU LEU A . n A 1 107 ASP 107 800 800 ASP ASP A . n A 1 108 TYR 108 801 801 TYR TYR A . n A 1 109 VAL 109 802 802 VAL VAL A . n A 1 110 ARG 110 803 803 ARG ARG A . n A 1 111 GLU 111 804 804 GLU GLU A . n A 1 112 HIS 112 805 805 HIS HIS A . n A 1 113 LYS 113 806 806 LYS LYS A . n A 1 114 ASP 114 807 807 ASP ASP A . n A 1 115 ASN 115 808 808 ASN ASN A . n A 1 116 ILE 116 809 809 ILE ILE A . n A 1 117 GLY 117 810 810 GLY GLY A . n A 1 118 SER 118 811 811 SER SER A . n A 1 119 GLN 119 812 812 GLN GLN A . n A 1 120 TYR 120 813 813 TYR TYR A . n A 1 121 LEU 121 814 814 LEU LEU A . n A 1 122 LEU 122 815 815 LEU LEU A . n A 1 123 ASN 123 816 816 ASN ASN A . n A 1 124 TRP 124 817 817 TRP TRP A . n A 1 125 CYS 125 818 818 CYS CYS A . n A 1 126 VAL 126 819 819 VAL VAL A . n A 1 127 GLN 127 820 820 GLN GLN A . n A 1 128 ILE 128 821 821 ILE ILE A . n A 1 129 ALA 129 822 822 ALA ALA A . n A 1 130 LYS 130 823 823 LYS LYS A . n A 1 131 GLY 131 824 824 GLY GLY A . n A 1 132 MET 132 825 825 MET MET A . n A 1 133 ASN 133 826 826 ASN ASN A . n A 1 134 TYR 134 827 827 TYR TYR A . n A 1 135 LEU 135 828 828 LEU LEU A . n A 1 136 GLU 136 829 829 GLU GLU A . n A 1 137 ASP 137 830 830 ASP ASP A . n A 1 138 ARG 138 831 831 ARG ARG A . n A 1 139 ARG 139 832 832 ARG ARG A . n A 1 140 LEU 140 833 833 LEU LEU A . n A 1 141 VAL 141 834 834 VAL VAL A . n A 1 142 HIS 142 835 835 HIS HIS A . n A 1 143 ARG 143 836 836 ARG ARG A . n A 1 144 ASP 144 837 837 ASP ASP A . n A 1 145 LEU 145 838 838 LEU LEU A . n A 1 146 ALA 146 839 839 ALA ALA A . n A 1 147 ALA 147 840 840 ALA ALA A . n A 1 148 ARG 148 841 841 ARG ARG A . n A 1 149 ASN 149 842 842 ASN ASN A . n A 1 150 VAL 150 843 843 VAL VAL A . n A 1 151 LEU 151 844 844 LEU LEU A . n A 1 152 VAL 152 845 845 VAL VAL A . n A 1 153 LYS 153 846 846 LYS LYS A . n A 1 154 THR 154 847 847 THR THR A . n A 1 155 PRO 155 848 848 PRO PRO A . n A 1 156 GLN 156 849 849 GLN GLN A . n A 1 157 HIS 157 850 850 HIS HIS A . n A 1 158 VAL 158 851 851 VAL VAL A . n A 1 159 LYS 159 852 852 LYS LYS A . n A 1 160 ILE 160 853 853 ILE ILE A . n A 1 161 THR 161 854 854 THR THR A . n A 1 162 ASP 162 855 855 ASP ASP A . n A 1 163 PHE 163 856 856 PHE PHE A . n A 1 164 GLY 164 857 857 GLY GLY A . n A 1 165 ARG 165 858 858 ARG ARG A . n A 1 166 ALA 166 859 859 ALA ALA A . n A 1 167 LYS 167 860 ? ? ? A . n A 1 168 LEU 168 861 ? ? ? A . n A 1 169 LEU 169 862 ? ? ? A . n A 1 170 GLY 170 863 ? ? ? A . n A 1 171 ALA 171 864 ? ? ? A . n A 1 172 ALA 172 865 ? ? ? A . n A 1 173 ALA 173 866 ? ? ? A . n A 1 174 ALA 174 867 ? ? ? A . n A 1 175 GLU 175 868 ? ? ? A . n A 1 176 TYR 176 869 ? ? ? A . n A 1 177 HIS 177 870 ? ? ? A . n A 1 178 ALA 178 871 ? ? ? A . n A 1 179 GLU 179 872 ? ? ? A . n A 1 180 GLY 180 873 ? ? ? A . n A 1 181 GLY 181 874 ? ? ? A . n A 1 182 LYS 182 875 ? ? ? A . n A 1 183 VAL 183 876 876 VAL VAL A . n A 1 184 PRO 184 877 877 PRO PRO A . n A 1 185 ILE 185 878 878 ILE ILE A . n A 1 186 LYS 186 879 879 LYS LYS A . n A 1 187 TRP 187 880 880 TRP TRP A . n A 1 188 MET 188 881 881 MET MET A . n A 1 189 ALA 189 882 882 ALA ALA A . n A 1 190 LEU 190 883 883 LEU LEU A . n A 1 191 GLU 191 884 884 GLU GLU A . n A 1 192 SER 192 885 885 SER SER A . n A 1 193 ILE 193 886 886 ILE ILE A . n A 1 194 LEU 194 887 887 LEU LEU A . n A 1 195 HIS 195 888 888 HIS HIS A . n A 1 196 ARG 196 889 889 ARG ARG A . n A 1 197 ILE 197 890 890 ILE ILE A . n A 1 198 TYR 198 891 891 TYR TYR A . n A 1 199 THR 199 892 892 THR THR A . n A 1 200 HIS 200 893 893 HIS HIS A . n A 1 201 GLN 201 894 894 GLN GLN A . n A 1 202 SER 202 895 895 SER SER A . n A 1 203 ASP 203 896 896 ASP ASP A . n A 1 204 VAL 204 897 897 VAL VAL A . n A 1 205 TRP 205 898 898 TRP TRP A . n A 1 206 SER 206 899 899 SER SER A . n A 1 207 TYR 207 900 900 TYR TYR A . n A 1 208 GLY 208 901 901 GLY GLY A . n A 1 209 VAL 209 902 902 VAL VAL A . n A 1 210 THR 210 903 903 THR THR A . n A 1 211 VAL 211 904 904 VAL VAL A . n A 1 212 TRP 212 905 905 TRP TRP A . n A 1 213 GLU 213 906 906 GLU GLU A . n A 1 214 LEU 214 907 907 LEU LEU A . n A 1 215 MET 215 908 908 MET MET A . n A 1 216 THR 216 909 909 THR THR A . n A 1 217 PHE 217 910 910 PHE PHE A . n A 1 218 GLY 218 911 911 GLY GLY A . n A 1 219 SER 219 912 912 SER SER A . n A 1 220 LYS 220 913 913 LYS LYS A . n A 1 221 PRO 221 914 914 PRO PRO A . n A 1 222 TYR 222 915 915 TYR TYR A . n A 1 223 ASP 223 916 916 ASP ASP A . n A 1 224 GLY 224 917 917 GLY GLY A . n A 1 225 ILE 225 918 918 ILE ILE A . n A 1 226 PRO 226 919 919 PRO PRO A . n A 1 227 ALA 227 920 920 ALA ALA A . n A 1 228 SER 228 921 921 SER SER A . n A 1 229 GLU 229 922 922 GLU GLU A . n A 1 230 ILE 230 923 923 ILE ILE A . n A 1 231 SER 231 924 924 SER SER A . n A 1 232 SER 232 925 925 SER SER A . n A 1 233 ILE 233 926 926 ILE ILE A . n A 1 234 LEU 234 927 927 LEU LEU A . n A 1 235 GLU 235 928 928 GLU GLU A . n A 1 236 LYS 236 929 929 LYS LYS A . n A 1 237 GLY 237 930 930 GLY GLY A . n A 1 238 GLU 238 931 931 GLU GLU A . n A 1 239 ARG 239 932 932 ARG ARG A . n A 1 240 LEU 240 933 933 LEU LEU A . n A 1 241 PRO 241 934 934 PRO PRO A . n A 1 242 GLN 242 935 935 GLN GLN A . n A 1 243 PRO 243 936 936 PRO PRO A . n A 1 244 PRO 244 937 937 PRO PRO A . n A 1 245 ILE 245 938 938 ILE ILE A . n A 1 246 CYS 246 939 939 CYS CYS A . n A 1 247 THR 247 940 940 THR THR A . n A 1 248 ILE 248 941 941 ILE ILE A . n A 1 249 ASP 249 942 942 ASP ASP A . n A 1 250 VAL 250 943 943 VAL VAL A . n A 1 251 TYR 251 944 944 TYR TYR A . n A 1 252 MET 252 945 945 MET MET A . n A 1 253 ILE 253 946 946 ILE ILE A . n A 1 254 MET 254 947 947 MET MET A . n A 1 255 VAL 255 948 948 VAL VAL A . n A 1 256 LYS 256 949 949 LYS LYS A . n A 1 257 CYS 257 950 950 CYS CYS A . n A 1 258 TRP 258 951 951 TRP TRP A . n A 1 259 MET 259 952 952 MET MET A . n A 1 260 ILE 260 953 953 ILE ILE A . n A 1 261 ASP 261 954 954 ASP ASP A . n A 1 262 ALA 262 955 955 ALA ALA A . n A 1 263 ASP 263 956 956 ASP ASP A . n A 1 264 SER 264 957 957 SER SER A . n A 1 265 ARG 265 958 958 ARG ARG A . n A 1 266 PRO 266 959 959 PRO PRO A . n A 1 267 LYS 267 960 960 LYS LYS A . n A 1 268 PHE 268 961 961 PHE PHE A . n A 1 269 ARG 269 962 962 ARG ARG A . n A 1 270 GLU 270 963 963 GLU GLU A . n A 1 271 LEU 271 964 964 LEU LEU A . n A 1 272 ILE 272 965 965 ILE ILE A . n A 1 273 ILE 273 966 966 ILE ILE A . n A 1 274 GLU 274 967 967 GLU GLU A . n A 1 275 PHE 275 968 968 PHE PHE A . n A 1 276 SER 276 969 969 SER SER A . n A 1 277 LYS 277 970 970 LYS LYS A . n A 1 278 MET 278 971 971 MET MET A . n A 1 279 ALA 279 972 972 ALA ALA A . n A 1 280 ARG 280 973 973 ARG ARG A . n A 1 281 ASP 281 974 974 ASP ASP A . n A 1 282 PRO 282 975 975 PRO PRO A . n A 1 283 GLN 283 976 976 GLN GLN A . n A 1 284 ARG 284 977 977 ARG ARG A . n A 1 285 TYR 285 978 978 TYR TYR A . n A 1 286 LEU 286 979 979 LEU LEU A . n A 1 287 VAL 287 980 980 VAL VAL A . n A 1 288 ILE 288 981 981 ILE ILE A . n A 1 289 GLN 289 982 982 GLN GLN A . n A 1 290 GLY 290 983 983 GLY GLY A . n A 1 291 ASP 291 984 984 ASP ASP A . n A 1 292 GLU 292 985 985 GLU GLU A . n A 1 293 ARG 293 986 986 ARG ARG A . n A 1 294 MET 294 987 987 MET MET A . n A 1 295 HIS 295 988 988 HIS HIS A . n A 1 296 LEU 296 989 989 LEU LEU A . n A 1 297 PRO 297 990 990 PRO PRO A . n A 1 298 SER 298 991 991 SER SER A . n A 1 299 PRO 299 992 992 PRO PRO A . n A 1 300 THR 300 993 993 THR THR A . n A 1 301 ASP 301 994 994 ASP ASP A . n A 1 302 SER 302 995 995 SER SER A . n A 1 303 ASN 303 996 996 ASN ASN A . n A 1 304 PHE 304 997 997 PHE PHE A . n A 1 305 TYR 305 998 998 TYR TYR A . n A 1 306 ARG 306 999 ? ? ? A . n A 1 307 ALA 307 1000 ? ? ? A . n A 1 308 LEU 308 1001 ? ? ? A . n A 1 309 MET 309 1002 ? ? ? A . n A 1 310 ASP 310 1003 ? ? ? A . n A 1 311 GLU 311 1004 1004 GLU GLU A . n A 1 312 GLU 312 1005 1005 GLU GLU A . n A 1 313 ASP 313 1006 1006 ASP ASP A . n A 1 314 MET 314 1007 1007 MET MET A . n A 1 315 ASP 315 1008 1008 ASP ASP A . n A 1 316 ASP 316 1009 1009 ASP ASP A . n A 1 317 VAL 317 1010 1010 VAL VAL A . n A 1 318 VAL 318 1011 1011 VAL VAL A . n A 1 319 ASP 319 1012 1012 ASP ASP A . n A 1 320 ALA 320 1013 1013 ALA ALA A . n A 1 321 ASP 321 1014 1014 ASP ASP A . n A 1 322 GLU 322 1015 1015 GLU GLU A . n A 1 323 TYR 323 1016 1016 TYR TYR A . n A 1 324 LEU 324 1017 1017 LEU LEU A . n A 1 325 ILE 325 1018 1018 ILE ILE A . n A 1 326 PRO 326 1019 ? ? ? A . n A 1 327 GLN 327 1020 ? ? ? A . n A 1 328 GLN 328 1021 ? ? ? A . n A 1 329 GLY 329 1022 ? ? ? A . n A 1 330 ASN 330 1023 ? ? ? A . n A 1 331 SER 331 1024 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 5N4 1 1101 1 5N4 DRG A . C 3 HOH 1 1201 25 HOH HOH A . C 3 HOH 2 1202 6 HOH HOH A . C 3 HOH 3 1203 72 HOH HOH A . C 3 HOH 4 1204 10 HOH HOH A . C 3 HOH 5 1205 95 HOH HOH A . C 3 HOH 6 1206 18 HOH HOH A . C 3 HOH 7 1207 37 HOH HOH A . C 3 HOH 8 1208 47 HOH HOH A . C 3 HOH 9 1209 68 HOH HOH A . C 3 HOH 10 1210 8 HOH HOH A . C 3 HOH 11 1211 73 HOH HOH A . C 3 HOH 12 1212 1 HOH HOH A . C 3 HOH 13 1213 94 HOH HOH A . C 3 HOH 14 1214 2 HOH HOH A . C 3 HOH 15 1215 23 HOH HOH A . C 3 HOH 16 1216 71 HOH HOH A . C 3 HOH 17 1217 40 HOH HOH A . C 3 HOH 18 1218 51 HOH HOH A . C 3 HOH 19 1219 45 HOH HOH A . C 3 HOH 20 1220 4 HOH HOH A . C 3 HOH 21 1221 15 HOH HOH A . C 3 HOH 22 1222 11 HOH HOH A . C 3 HOH 23 1223 31 HOH HOH A . C 3 HOH 24 1224 9 HOH HOH A . C 3 HOH 25 1225 76 HOH HOH A . C 3 HOH 26 1226 26 HOH HOH A . C 3 HOH 27 1227 21 HOH HOH A . C 3 HOH 28 1228 108 HOH HOH A . C 3 HOH 29 1229 85 HOH HOH A . C 3 HOH 30 1230 20 HOH HOH A . C 3 HOH 31 1231 104 HOH HOH A . C 3 HOH 32 1232 34 HOH HOH A . C 3 HOH 33 1233 12 HOH HOH A . C 3 HOH 34 1234 61 HOH HOH A . C 3 HOH 35 1235 5 HOH HOH A . C 3 HOH 36 1236 30 HOH HOH A . C 3 HOH 37 1237 43 HOH HOH A . C 3 HOH 38 1238 16 HOH HOH A . C 3 HOH 39 1239 64 HOH HOH A . C 3 HOH 40 1240 90 HOH HOH A . C 3 HOH 41 1241 32 HOH HOH A . C 3 HOH 42 1242 24 HOH HOH A . C 3 HOH 43 1243 101 HOH HOH A . C 3 HOH 44 1244 66 HOH HOH A . C 3 HOH 45 1245 19 HOH HOH A . C 3 HOH 46 1246 74 HOH HOH A . C 3 HOH 47 1247 116 HOH HOH A . C 3 HOH 48 1248 57 HOH HOH A . C 3 HOH 49 1249 3 HOH HOH A . C 3 HOH 50 1250 7 HOH HOH A . C 3 HOH 51 1251 33 HOH HOH A . C 3 HOH 52 1252 62 HOH HOH A . C 3 HOH 53 1253 84 HOH HOH A . C 3 HOH 54 1254 81 HOH HOH A . C 3 HOH 55 1255 53 HOH HOH A . C 3 HOH 56 1256 110 HOH HOH A . C 3 HOH 57 1257 96 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 15620 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-02 2 'Structure model' 1 1 2015-12-23 3 'Structure model' 1 2 2016-01-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -53.9381 7.1330 -32.9599 -0.0500 -0.0343 -0.0388 -0.1520 0.0714 0.0897 2.6050 0.6809 6.5216 -0.6989 -0.8859 0.0441 0.0672 0.0339 -0.1011 -0.2686 0.3152 -0.3078 0.0190 -0.0085 0.5442 'X-RAY DIFFRACTION' 2 ? refined -61.9704 -15.7383 -23.0610 -0.0495 -0.0902 -0.2166 -0.0878 0.1115 0.1188 2.3464 6.5279 2.4160 2.3124 -1.3125 -2.0837 -0.2450 -0.0492 0.2942 -0.1286 -0.2463 -0.5442 -0.4906 0.3268 0.2518 'X-RAY DIFFRACTION' 3 ? refined -65.7948 10.3318 -17.2105 0.0510 -0.0584 -0.0475 -0.1520 0.0289 -0.1053 3.1393 7.8656 0.5536 -0.4953 -2.4063 2.8579 -0.0406 -0.0598 0.1005 -0.1591 0.0574 0.1441 0.2486 -0.0076 -0.0592 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 697 A 786 '{ A|697 - A|786 }' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 787 A 987 '{ A|787 - A|987 A|1101 - A|1101 }' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 2 A 1101 A 1101 '{ A|787 - A|987 A|1101 - A|1101 }' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 3 A 988 A 1018 '{ A|988 - A|1018 }' ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.5 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 782 ? ? -92.91 58.16 2 1 ARG A 836 ? ? 79.57 -12.75 3 1 ASP A 837 ? ? -142.23 40.29 4 1 SER A 921 ? ? -69.47 9.54 5 1 GLU A 1005 ? ? -76.84 -96.24 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 694 ? A GLY 1 2 1 Y 1 A SER 695 ? A SER 2 3 1 Y 1 A GLY 696 ? A GLY 3 4 1 Y 1 A ARG 748 ? A ARG 55 5 1 Y 1 A GLU 749 ? A GLU 56 6 1 Y 1 A LYS 860 ? A LYS 167 7 1 Y 1 A LEU 861 ? A LEU 168 8 1 Y 1 A LEU 862 ? A LEU 169 9 1 Y 1 A GLY 863 ? A GLY 170 10 1 Y 1 A ALA 864 ? A ALA 171 11 1 Y 1 A ALA 865 ? A ALA 172 12 1 Y 1 A ALA 866 ? A ALA 173 13 1 Y 1 A ALA 867 ? A ALA 174 14 1 Y 1 A GLU 868 ? A GLU 175 15 1 Y 1 A TYR 869 ? A TYR 176 16 1 Y 1 A HIS 870 ? A HIS 177 17 1 Y 1 A ALA 871 ? A ALA 178 18 1 Y 1 A GLU 872 ? A GLU 179 19 1 Y 1 A GLY 873 ? A GLY 180 20 1 Y 1 A GLY 874 ? A GLY 181 21 1 Y 1 A LYS 875 ? A LYS 182 22 1 Y 1 A ARG 999 ? A ARG 306 23 1 Y 1 A ALA 1000 ? A ALA 307 24 1 Y 1 A LEU 1001 ? A LEU 308 25 1 Y 1 A MET 1002 ? A MET 309 26 1 Y 1 A ASP 1003 ? A ASP 310 27 1 Y 1 A PRO 1019 ? A PRO 326 28 1 Y 1 A GLN 1020 ? A GLN 327 29 1 Y 1 A GLN 1021 ? A GLN 328 30 1 Y 1 A GLY 1022 ? A GLY 329 31 1 Y 1 A ASN 1023 ? A ASN 330 32 1 Y 1 A SER 1024 ? A SER 331 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-(1~{H}-indazol-3-yl)-7,7-dimethyl-2-(2-methylpyrazol-3-yl)-5~{H}-furo[3,4-d]pyrimidin-4-amine' 5N4 3 water HOH #