data_5EH0
#
_entry.id 5EH0
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.391
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 5EH0 pdb_00005eh0 10.2210/pdb5eh0/pdb
WWPDB D_1000214899 ? ?
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2016-04-20
2 'Structure model' 1 1 2016-05-11
3 'Structure model' 1 2 2017-08-30
4 'Structure model' 2 0 2019-04-24
5 'Structure model' 2 1 2019-07-10
6 'Structure model' 2 2 2024-05-08
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
loop_
_pdbx_audit_revision_group.ordinal
_pdbx_audit_revision_group.revision_ordinal
_pdbx_audit_revision_group.data_content_type
_pdbx_audit_revision_group.group
1 2 'Structure model' 'Database references'
2 3 'Structure model' 'Author supporting evidence'
3 4 'Structure model' Advisory
4 4 'Structure model' 'Atomic model'
5 4 'Structure model' 'Data collection'
6 4 'Structure model' 'Database references'
7 4 'Structure model' 'Derived calculations'
8 4 'Structure model' 'Polymer sequence'
9 4 'Structure model' 'Source and taxonomy'
10 4 'Structure model' 'Structure summary'
11 5 'Structure model' 'Data collection'
12 6 'Structure model' 'Data collection'
13 6 'Structure model' 'Database references'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 3 'Structure model' pdbx_audit_support
2 4 'Structure model' atom_site
3 4 'Structure model' atom_site_anisotrop
4 4 'Structure model' diffrn_source
5 4 'Structure model' entity
6 4 'Structure model' entity_name_com
7 4 'Structure model' entity_poly
8 4 'Structure model' entity_poly_seq
9 4 'Structure model' entity_src_gen
10 4 'Structure model' pdbx_entity_src_syn
11 4 'Structure model' pdbx_poly_seq_scheme
12 4 'Structure model' pdbx_unobs_or_zero_occ_atoms
13 4 'Structure model' pdbx_unobs_or_zero_occ_residues
14 4 'Structure model' pdbx_validate_polymer_linkage
15 4 'Structure model' struct_conf
16 4 'Structure model' struct_ref
17 4 'Structure model' struct_ref_seq
18 4 'Structure model' struct_ref_seq_dif
19 5 'Structure model' diffrn_source
20 6 'Structure model' chem_comp_atom
21 6 'Structure model' chem_comp_bond
22 6 'Structure model' database_2
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 3 'Structure model' '_pdbx_audit_support.funding_organization'
2 4 'Structure model' '_atom_site.label_seq_id'
3 4 'Structure model' '_atom_site_anisotrop.pdbx_label_seq_id'
4 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site'
5 4 'Structure model' '_entity.formula_weight'
6 4 'Structure model' '_entity.pdbx_description'
7 4 'Structure model' '_entity.pdbx_ec'
8 4 'Structure model' '_entity.src_method'
9 4 'Structure model' '_entity_poly.pdbx_seq_one_letter_code'
10 4 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can'
11 4 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_seq_id'
12 4 'Structure model' '_struct_conf.beg_label_seq_id'
13 4 'Structure model' '_struct_conf.end_label_seq_id'
14 4 'Structure model' '_struct_ref.db_code'
15 4 'Structure model' '_struct_ref.db_name'
16 4 'Structure model' '_struct_ref.pdbx_align_begin'
17 4 'Structure model' '_struct_ref.pdbx_db_accession'
18 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code'
19 4 'Structure model' '_struct_ref_seq.pdbx_db_accession'
20 4 'Structure model' '_struct_ref_seq.seq_align_end'
21 5 'Structure model' '_diffrn_source.pdbx_synchrotron_site'
22 6 'Structure model' '_database_2.pdbx_DOI'
23 6 'Structure model' '_database_2.pdbx_database_accession'
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.entry_id 5EH0
_pdbx_database_status.recvd_initial_deposition_date 2015-10-27
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site RCSB
_pdbx_database_status.process_site PDBE
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible Y
_pdbx_database_status.status_code_nmr_data ?
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
'Innocenti, P.' 1
'Woodward, H.L.' 2
'Solanki, S.' 3
'Naud, N.' 4
'Westwood, I.M.' 5
'Cronin, N.' 6
'Hayes, A.' 7
'Roberts, J.' 8
'Henley, A.T.' 9
'Baker, R.' 10
'Faisal, A.' 11
'Mak, G.' 12
'Box, G.' 13
'Valenti, M.' 14
'De Haven Brandon, A.' 15
;O'Fee, L.
;
16
'Saville, J.' 17
'Schmitt, J.' 18
'Burke, R.' 19
'van Montfort, R.L.M.' 20
'Raymaud, F.I.' 21
'Eccles, S.A.' 22
'Linardopoulos, S.' 23
'Blagg, J.' 24
'Hoelder, S.' 25
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country US
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev J.Med.Chem.
_citation.journal_id_ASTM JMCMAR
_citation.journal_id_CSD 0151
_citation.journal_id_ISSN 0022-2623
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 59
_citation.language ?
_citation.page_first 3671
_citation.page_last 3688
_citation.title
;Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle Kinase 1 (MPS1) Using a Structure-Based Hybridization Approach.
;
_citation.year 2016
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.5b01811
_citation.pdbx_database_id_PubMed 27055065
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Innocenti, P.' 1 ?
primary 'Woodward, H.L.' 2 ?
primary 'Solanki, S.' 3 ?
primary 'Naud, S.' 4 ?
primary 'Westwood, I.M.' 5 ?
primary 'Cronin, N.' 6 ?
primary 'Hayes, A.' 7 ?
primary 'Roberts, J.' 8 ?
primary 'Henley, A.T.' 9 ?
primary 'Baker, R.' 10 ?
primary 'Faisal, A.' 11 ?
primary 'Mak, G.W.' 12 ?
primary 'Box, G.' 13 ?
primary 'Valenti, M.' 14 ?
primary 'De Haven Brandon, A.' 15 ?
primary
;O'Fee, L.
;
16 ?
primary 'Saville, H.' 17 ?
primary 'Schmitt, J.' 18 ?
primary 'Matijssen, B.' 19 ?
primary 'Burke, R.' 20 ?
primary 'van Montfort, R.L.' 21 ?
primary 'Raynaud, F.I.' 22 ?
primary 'Eccles, S.A.' 23 ?
primary 'Linardopoulos, S.' 24 ?
primary 'Blagg, J.' 25 ?
primary 'Hoelder, S.' 26 ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man 'Dual specificity protein kinase TTK' 32245.084 1
2.7.12.1 ? ? 'N8-Neopentyl-N2-(2-methoxy-4-(1-methyl-1H-pyrazol-4-yl)phenyl)pyrido[3,4-d]pyrimidine-2,8-diamine'
2 non-polymer syn 'N2-(2-Methoxy-4-(1-methyl-1H-pyrazol-4-yl)phenyl)-N8-neopentylpyrido[3,4-d]pyrimidine-2,8-diamine' 417.507 1
? ? ? ?
3 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 1
? ? ? ?
4 water nat water 18.015 31
? ? ? ?
#
_entity_name_com.entity_id 1
_entity_name_com.name 'Phosphotyrosine picked threonine-protein kinase,PYT'
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer no
_entity_poly.pdbx_seq_one_letter_code
;QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITD
QYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDT
TSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIE
FPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
;
_entity_poly.pdbx_seq_one_letter_code_can
;QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITD
QYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDT
TSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIE
FPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
;
_entity_poly.pdbx_strand_id A
_entity_poly.pdbx_target_identifier ?
#
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
2 'N2-(2-Methoxy-4-(1-methyl-1H-pyrazol-4-yl)phenyl)-N8-neopentylpyrido[3,4-d]pyrimidine-2,8-diamine' 5NW
3 'DIMETHYL SULFOXIDE' DMS
4 water HOH
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 GLN n
1 2 SER n
1 3 MET n
1 4 SER n
1 5 VAL n
1 6 LYS n
1 7 GLY n
1 8 ARG n
1 9 ILE n
1 10 TYR n
1 11 SER n
1 12 ILE n
1 13 LEU n
1 14 LYS n
1 15 GLN n
1 16 ILE n
1 17 GLY n
1 18 SER n
1 19 GLY n
1 20 GLY n
1 21 SER n
1 22 SER n
1 23 LYS n
1 24 VAL n
1 25 PHE n
1 26 GLN n
1 27 VAL n
1 28 LEU n
1 29 ASN n
1 30 GLU n
1 31 LYS n
1 32 LYS n
1 33 GLN n
1 34 ILE n
1 35 TYR n
1 36 ALA n
1 37 ILE n
1 38 LYS n
1 39 TYR n
1 40 VAL n
1 41 ASN n
1 42 LEU n
1 43 GLU n
1 44 GLU n
1 45 ALA n
1 46 ASP n
1 47 ASN n
1 48 GLN n
1 49 THR n
1 50 LEU n
1 51 ASP n
1 52 SER n
1 53 TYR n
1 54 ARG n
1 55 ASN n
1 56 GLU n
1 57 ILE n
1 58 ALA n
1 59 TYR n
1 60 LEU n
1 61 ASN n
1 62 LYS n
1 63 LEU n
1 64 GLN n
1 65 GLN n
1 66 HIS n
1 67 SER n
1 68 ASP n
1 69 LYS n
1 70 ILE n
1 71 ILE n
1 72 ARG n
1 73 LEU n
1 74 TYR n
1 75 ASP n
1 76 TYR n
1 77 GLU n
1 78 ILE n
1 79 THR n
1 80 ASP n
1 81 GLN n
1 82 TYR n
1 83 ILE n
1 84 TYR n
1 85 MET n
1 86 VAL n
1 87 MET n
1 88 GLU n
1 89 CYS n
1 90 GLY n
1 91 ASN n
1 92 ILE n
1 93 ASP n
1 94 LEU n
1 95 ASN n
1 96 SER n
1 97 TRP n
1 98 LEU n
1 99 LYS n
1 100 LYS n
1 101 LYS n
1 102 LYS n
1 103 SER n
1 104 ILE n
1 105 ASP n
1 106 PRO n
1 107 TRP n
1 108 GLU n
1 109 ARG n
1 110 LYS n
1 111 SER n
1 112 TYR n
1 113 TRP n
1 114 LYS n
1 115 ASN n
1 116 MET n
1 117 LEU n
1 118 GLU n
1 119 ALA n
1 120 VAL n
1 121 HIS n
1 122 THR n
1 123 ILE n
1 124 HIS n
1 125 GLN n
1 126 HIS n
1 127 GLY n
1 128 ILE n
1 129 VAL n
1 130 HIS n
1 131 SER n
1 132 ASP n
1 133 LEU n
1 134 LYS n
1 135 PRO n
1 136 ALA n
1 137 ASN n
1 138 PHE n
1 139 LEU n
1 140 ILE n
1 141 VAL n
1 142 ASP n
1 143 GLY n
1 144 MET n
1 145 LEU n
1 146 LYS n
1 147 LEU n
1 148 ILE n
1 149 ASP n
1 150 PHE n
1 151 GLY n
1 152 ILE n
1 153 ALA n
1 154 ASN n
1 155 GLN n
1 156 MET n
1 157 GLN n
1 158 PRO n
1 159 ASP n
1 160 THR n
1 161 THR n
1 162 SER n
1 163 VAL n
1 164 VAL n
1 165 LYS n
1 166 ASP n
1 167 SER n
1 168 GLN n
1 169 VAL n
1 170 GLY n
1 171 THR n
1 172 VAL n
1 173 ASN n
1 174 TYR n
1 175 MET n
1 176 PRO n
1 177 PRO n
1 178 GLU n
1 179 ALA n
1 180 ILE n
1 181 LYS n
1 182 ASP n
1 183 MET n
1 184 SER n
1 185 SER n
1 186 SER n
1 187 ARG n
1 188 GLU n
1 189 ASN n
1 190 GLY n
1 191 LYS n
1 192 SER n
1 193 LYS n
1 194 SER n
1 195 LYS n
1 196 ILE n
1 197 SER n
1 198 PRO n
1 199 LYS n
1 200 SER n
1 201 ASP n
1 202 VAL n
1 203 TRP n
1 204 SER n
1 205 LEU n
1 206 GLY n
1 207 CYS n
1 208 ILE n
1 209 LEU n
1 210 TYR n
1 211 TYR n
1 212 MET n
1 213 THR n
1 214 TYR n
1 215 GLY n
1 216 LYS n
1 217 THR n
1 218 PRO n
1 219 PHE n
1 220 GLN n
1 221 GLN n
1 222 ILE n
1 223 ILE n
1 224 ASN n
1 225 GLN n
1 226 ILE n
1 227 SER n
1 228 LYS n
1 229 LEU n
1 230 HIS n
1 231 ALA n
1 232 ILE n
1 233 ILE n
1 234 ASP n
1 235 PRO n
1 236 ASN n
1 237 HIS n
1 238 GLU n
1 239 ILE n
1 240 GLU n
1 241 PHE n
1 242 PRO n
1 243 ASP n
1 244 ILE n
1 245 PRO n
1 246 GLU n
1 247 LYS n
1 248 ASP n
1 249 LEU n
1 250 GLN n
1 251 ASP n
1 252 VAL n
1 253 LEU n
1 254 LYS n
1 255 CYS n
1 256 CYS n
1 257 LEU n
1 258 LYS n
1 259 ARG n
1 260 ASP n
1 261 PRO n
1 262 LYS n
1 263 GLN n
1 264 ARG n
1 265 ILE n
1 266 SER n
1 267 ILE n
1 268 PRO n
1 269 GLU n
1 270 LEU n
1 271 LEU n
1 272 ALA n
1 273 HIS n
1 274 PRO n
1 275 TYR n
1 276 VAL n
1 277 GLN n
1 278 ILE n
1 279 GLN n
#
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_src_id 1
_entity_src_gen.pdbx_alt_source_flag sample
_entity_src_gen.pdbx_seq_type 'Biological sequence'
_entity_src_gen.pdbx_beg_seq_num 1
_entity_src_gen.pdbx_end_seq_num 279
_entity_src_gen.gene_src_common_name Human
_entity_src_gen.gene_src_genus ?
_entity_src_gen.pdbx_gene_src_gene 'TTK, MPS1, MPS1L1'
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693
_entity_src_gen.host_org_genus ?
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain ?
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type ?
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.host_org_details ?
_entity_src_gen.expression_system_id ?
_entity_src_gen.plasmid_name ?
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
5NW non-polymer . 'N2-(2-Methoxy-4-(1-methyl-1H-pyrazol-4-yl)phenyl)-N8-neopentylpyrido[3,4-d]pyrimidine-2,8-diamine' ?
'C23 H27 N7 O' 417.507
ALA 'L-peptide linking' y ALANINE ?
'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ?
'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ?
'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?
'C4 H7 N O4' 133.103
CYS 'L-peptide linking' y CYSTEINE ?
'C3 H7 N O2 S' 121.158
DMS non-polymer . 'DIMETHYL SULFOXIDE' ?
'C2 H6 O S' 78.133
GLN 'L-peptide linking' y GLUTAMINE ?
'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?
'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ?
'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE ?
'C6 H10 N3 O2 1' 156.162
HOH non-polymer . WATER ?
'H2 O' 18.015
ILE 'L-peptide linking' y ISOLEUCINE ?
'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE ?
'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ?
'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE ?
'C5 H11 N O2 S' 149.211
PHE 'L-peptide linking' y PHENYLALANINE ?
'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE ?
'C5 H9 N O2' 115.130
SER 'L-peptide linking' y SERINE ?
'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ?
'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ?
'C11 H12 N2 O2' 204.225
TYR 'L-peptide linking' y TYROSINE ?
'C9 H11 N O3' 181.189
VAL 'L-peptide linking' y VALINE ?
'C5 H11 N O2' 117.146
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 GLN 1 516 516 GLN GLN A . n
A 1 2 SER 2 517 517 SER SER A . n
A 1 3 MET 3 518 518 MET MET A . n
A 1 4 SER 4 519 519 SER SER A . n
A 1 5 VAL 5 520 520 VAL VAL A . n
A 1 6 LYS 6 521 521 LYS LYS A . n
A 1 7 GLY 7 522 522 GLY GLY A . n
A 1 8 ARG 8 523 523 ARG ARG A . n
A 1 9 ILE 9 524 524 ILE ILE A . n
A 1 10 TYR 10 525 525 TYR TYR A . n
A 1 11 SER 11 526 526 SER SER A . n
A 1 12 ILE 12 527 527 ILE ILE A . n
A 1 13 LEU 13 528 528 LEU LEU A . n
A 1 14 LYS 14 529 529 LYS LYS A . n
A 1 15 GLN 15 530 530 GLN GLN A . n
A 1 16 ILE 16 531 531 ILE ILE A . n
A 1 17 GLY 17 532 532 GLY GLY A . n
A 1 18 SER 18 533 533 SER SER A . n
A 1 19 GLY 19 534 534 GLY GLY A . n
A 1 20 GLY 20 535 535 GLY GLY A . n
A 1 21 SER 21 536 536 SER SER A . n
A 1 22 SER 22 537 537 SER SER A . n
A 1 23 LYS 23 538 538 LYS LYS A . n
A 1 24 VAL 24 539 539 VAL VAL A . n
A 1 25 PHE 25 540 540 PHE PHE A . n
A 1 26 GLN 26 541 541 GLN GLN A . n
A 1 27 VAL 27 542 542 VAL VAL A . n
A 1 28 LEU 28 543 543 LEU LEU A . n
A 1 29 ASN 29 544 544 ASN ASN A . n
A 1 30 GLU 30 545 545 GLU GLU A . n
A 1 31 LYS 31 546 546 LYS LYS A . n
A 1 32 LYS 32 547 547 LYS LYS A . n
A 1 33 GLN 33 548 548 GLN GLN A . n
A 1 34 ILE 34 549 549 ILE ILE A . n
A 1 35 TYR 35 550 550 TYR TYR A . n
A 1 36 ALA 36 551 551 ALA ALA A . n
A 1 37 ILE 37 552 552 ILE ILE A . n
A 1 38 LYS 38 553 553 LYS LYS A . n
A 1 39 TYR 39 554 554 TYR TYR A . n
A 1 40 VAL 40 555 555 VAL VAL A . n
A 1 41 ASN 41 556 556 ASN ASN A . n
A 1 42 LEU 42 557 557 LEU LEU A . n
A 1 43 GLU 43 558 558 GLU GLU A . n
A 1 44 GLU 44 559 559 GLU GLU A . n
A 1 45 ALA 45 560 560 ALA ALA A . n
A 1 46 ASP 46 561 561 ASP ASP A . n
A 1 47 ASN 47 562 562 ASN ASN A . n
A 1 48 GLN 48 563 563 GLN GLN A . n
A 1 49 THR 49 564 564 THR THR A . n
A 1 50 LEU 50 565 565 LEU LEU A . n
A 1 51 ASP 51 566 566 ASP ASP A . n
A 1 52 SER 52 567 567 SER SER A . n
A 1 53 TYR 53 568 568 TYR TYR A . n
A 1 54 ARG 54 569 569 ARG ARG A . n
A 1 55 ASN 55 570 570 ASN ASN A . n
A 1 56 GLU 56 571 571 GLU GLU A . n
A 1 57 ILE 57 572 572 ILE ILE A . n
A 1 58 ALA 58 573 573 ALA ALA A . n
A 1 59 TYR 59 574 574 TYR TYR A . n
A 1 60 LEU 60 575 575 LEU LEU A . n
A 1 61 ASN 61 576 576 ASN ASN A . n
A 1 62 LYS 62 577 577 LYS LYS A . n
A 1 63 LEU 63 578 578 LEU LEU A . n
A 1 64 GLN 64 579 579 GLN GLN A . n
A 1 65 GLN 65 580 580 GLN GLN A . n
A 1 66 HIS 66 581 581 HIS HIS A . n
A 1 67 SER 67 582 582 SER SER A . n
A 1 68 ASP 68 583 583 ASP ASP A . n
A 1 69 LYS 69 584 584 LYS LYS A . n
A 1 70 ILE 70 585 585 ILE ILE A . n
A 1 71 ILE 71 586 586 ILE ILE A . n
A 1 72 ARG 72 587 587 ARG ARG A . n
A 1 73 LEU 73 588 588 LEU LEU A . n
A 1 74 TYR 74 589 589 TYR TYR A . n
A 1 75 ASP 75 590 590 ASP ASP A . n
A 1 76 TYR 76 591 591 TYR TYR A . n
A 1 77 GLU 77 592 592 GLU GLU A . n
A 1 78 ILE 78 593 593 ILE ILE A . n
A 1 79 THR 79 594 594 THR THR A . n
A 1 80 ASP 80 595 595 ASP ASP A . n
A 1 81 GLN 81 596 596 GLN GLN A . n
A 1 82 TYR 82 597 597 TYR TYR A . n
A 1 83 ILE 83 598 598 ILE ILE A . n
A 1 84 TYR 84 599 599 TYR TYR A . n
A 1 85 MET 85 600 600 MET MET A . n
A 1 86 VAL 86 601 601 VAL VAL A . n
A 1 87 MET 87 602 602 MET MET A . n
A 1 88 GLU 88 603 603 GLU GLU A . n
A 1 89 CYS 89 604 604 CYS CYS A . n
A 1 90 GLY 90 605 605 GLY GLY A . n
A 1 91 ASN 91 606 606 ASN ASN A . n
A 1 92 ILE 92 607 607 ILE ILE A . n
A 1 93 ASP 93 608 608 ASP ASP A . n
A 1 94 LEU 94 609 609 LEU LEU A . n
A 1 95 ASN 95 610 610 ASN ASN A . n
A 1 96 SER 96 611 611 SER SER A . n
A 1 97 TRP 97 612 612 TRP TRP A . n
A 1 98 LEU 98 613 613 LEU LEU A . n
A 1 99 LYS 99 614 614 LYS LYS A . n
A 1 100 LYS 100 615 615 LYS LYS A . n
A 1 101 LYS 101 616 616 LYS LYS A . n
A 1 102 LYS 102 617 617 LYS LYS A . n
A 1 103 SER 103 618 618 SER SER A . n
A 1 104 ILE 104 619 619 ILE ILE A . n
A 1 105 ASP 105 620 620 ASP ASP A . n
A 1 106 PRO 106 621 621 PRO PRO A . n
A 1 107 TRP 107 622 622 TRP TRP A . n
A 1 108 GLU 108 623 623 GLU GLU A . n
A 1 109 ARG 109 624 624 ARG ARG A . n
A 1 110 LYS 110 625 625 LYS LYS A . n
A 1 111 SER 111 626 626 SER SER A . n
A 1 112 TYR 112 627 627 TYR TYR A . n
A 1 113 TRP 113 628 628 TRP TRP A . n
A 1 114 LYS 114 629 629 LYS LYS A . n
A 1 115 ASN 115 630 630 ASN ASN A . n
A 1 116 MET 116 631 631 MET MET A . n
A 1 117 LEU 117 632 632 LEU LEU A . n
A 1 118 GLU 118 633 633 GLU GLU A . n
A 1 119 ALA 119 634 634 ALA ALA A . n
A 1 120 VAL 120 635 635 VAL VAL A . n
A 1 121 HIS 121 636 636 HIS HIS A . n
A 1 122 THR 122 637 637 THR THR A . n
A 1 123 ILE 123 638 638 ILE ILE A . n
A 1 124 HIS 124 639 639 HIS HIS A . n
A 1 125 GLN 125 640 640 GLN GLN A . n
A 1 126 HIS 126 641 641 HIS HIS A . n
A 1 127 GLY 127 642 642 GLY GLY A . n
A 1 128 ILE 128 643 643 ILE ILE A . n
A 1 129 VAL 129 644 644 VAL VAL A . n
A 1 130 HIS 130 645 645 HIS HIS A . n
A 1 131 SER 131 646 646 SER SER A . n
A 1 132 ASP 132 647 647 ASP ASP A . n
A 1 133 LEU 133 648 648 LEU LEU A . n
A 1 134 LYS 134 649 649 LYS LYS A . n
A 1 135 PRO 135 650 650 PRO PRO A . n
A 1 136 ALA 136 651 651 ALA ALA A . n
A 1 137 ASN 137 652 652 ASN ASN A . n
A 1 138 PHE 138 653 653 PHE PHE A . n
A 1 139 LEU 139 654 654 LEU LEU A . n
A 1 140 ILE 140 655 655 ILE ILE A . n
A 1 141 VAL 141 656 656 VAL VAL A . n
A 1 142 ASP 142 657 657 ASP ASP A . n
A 1 143 GLY 143 658 658 GLY GLY A . n
A 1 144 MET 144 659 659 MET MET A . n
A 1 145 LEU 145 660 660 LEU LEU A . n
A 1 146 LYS 146 661 661 LYS LYS A . n
A 1 147 LEU 147 662 662 LEU LEU A . n
A 1 148 ILE 148 663 663 ILE ILE A . n
A 1 149 ASP 149 664 664 ASP ASP A . n
A 1 150 PHE 150 665 665 PHE PHE A . n
A 1 151 GLY 151 666 666 GLY GLY A . n
A 1 152 ILE 152 667 667 ILE ILE A . n
A 1 153 ALA 153 668 668 ALA ALA A . n
A 1 154 ASN 154 669 669 ASN ASN A . n
A 1 155 GLN 155 670 670 GLN GLN A . n
A 1 156 MET 156 671 671 MET MET A . n
A 1 157 GLN 157 672 672 GLN GLN A . n
A 1 158 PRO 158 673 673 PRO PRO A . n
A 1 159 ASP 159 674 674 ASP ASP A . n
A 1 160 THR 160 675 ? ? ? A . n
A 1 161 THR 161 676 ? ? ? A . n
A 1 162 SER 162 677 ? ? ? A . n
A 1 163 VAL 163 678 ? ? ? A . n
A 1 164 VAL 164 679 ? ? ? A . n
A 1 165 LYS 165 680 ? ? ? A . n
A 1 166 ASP 166 681 ? ? ? A . n
A 1 167 SER 167 682 ? ? ? A . n
A 1 168 GLN 168 683 ? ? ? A . n
A 1 169 VAL 169 684 ? ? ? A . n
A 1 170 GLY 170 685 685 GLY GLY A . n
A 1 171 THR 171 686 686 THR THR A . n
A 1 172 VAL 172 687 687 VAL VAL A . n
A 1 173 ASN 173 688 688 ASN ASN A . n
A 1 174 TYR 174 689 689 TYR TYR A . n
A 1 175 MET 175 690 690 MET MET A . n
A 1 176 PRO 176 691 691 PRO PRO A . n
A 1 177 PRO 177 692 692 PRO PRO A . n
A 1 178 GLU 178 693 693 GLU GLU A . n
A 1 179 ALA 179 694 694 ALA ALA A . n
A 1 180 ILE 180 695 695 ILE ILE A . n
A 1 181 LYS 181 696 696 LYS LYS A . n
A 1 182 ASP 182 697 697 ASP ASP A . n
A 1 183 MET 183 698 698 MET MET A . n
A 1 184 SER 184 699 ? ? ? A . n
A 1 185 SER 185 700 ? ? ? A . n
A 1 186 SER 186 701 ? ? ? A . n
A 1 187 ARG 187 702 ? ? ? A . n
A 1 188 GLU 188 703 ? ? ? A . n
A 1 189 ASN 189 704 ? ? ? A . n
A 1 190 GLY 190 705 ? ? ? A . n
A 1 191 LYS 191 706 ? ? ? A . n
A 1 192 SER 192 707 ? ? ? A . n
A 1 193 LYS 193 708 ? ? ? A . n
A 1 194 SER 194 709 ? ? ? A . n
A 1 195 LYS 195 710 710 LYS LYS A . n
A 1 196 ILE 196 711 711 ILE ILE A . n
A 1 197 SER 197 712 712 SER SER A . n
A 1 198 PRO 198 713 713 PRO PRO A . n
A 1 199 LYS 199 714 714 LYS LYS A . n
A 1 200 SER 200 715 715 SER SER A . n
A 1 201 ASP 201 716 716 ASP ASP A . n
A 1 202 VAL 202 717 717 VAL VAL A . n
A 1 203 TRP 203 718 718 TRP TRP A . n
A 1 204 SER 204 719 719 SER SER A . n
A 1 205 LEU 205 720 720 LEU LEU A . n
A 1 206 GLY 206 721 721 GLY GLY A . n
A 1 207 CYS 207 722 722 CYS CYS A . n
A 1 208 ILE 208 723 723 ILE ILE A . n
A 1 209 LEU 209 724 724 LEU LEU A . n
A 1 210 TYR 210 725 725 TYR TYR A . n
A 1 211 TYR 211 726 726 TYR TYR A . n
A 1 212 MET 212 727 727 MET MET A . n
A 1 213 THR 213 728 728 THR THR A . n
A 1 214 TYR 214 729 729 TYR TYR A . n
A 1 215 GLY 215 730 730 GLY GLY A . n
A 1 216 LYS 216 731 731 LYS LYS A . n
A 1 217 THR 217 732 732 THR THR A . n
A 1 218 PRO 218 733 733 PRO PRO A . n
A 1 219 PHE 219 734 734 PHE PHE A . n
A 1 220 GLN 220 735 735 GLN GLN A . n
A 1 221 GLN 221 736 736 GLN GLN A . n
A 1 222 ILE 222 737 737 ILE ILE A . n
A 1 223 ILE 223 738 738 ILE ILE A . n
A 1 224 ASN 224 739 739 ASN ASN A . n
A 1 225 GLN 225 740 740 GLN GLN A . n
A 1 226 ILE 226 741 741 ILE ILE A . n
A 1 227 SER 227 742 742 SER SER A . n
A 1 228 LYS 228 743 743 LYS LYS A . n
A 1 229 LEU 229 744 744 LEU LEU A . n
A 1 230 HIS 230 745 745 HIS HIS A . n
A 1 231 ALA 231 746 746 ALA ALA A . n
A 1 232 ILE 232 747 747 ILE ILE A . n
A 1 233 ILE 233 748 748 ILE ILE A . n
A 1 234 ASP 234 749 749 ASP ASP A . n
A 1 235 PRO 235 750 750 PRO PRO A . n
A 1 236 ASN 236 751 751 ASN ASN A . n
A 1 237 HIS 237 752 752 HIS HIS A . n
A 1 238 GLU 238 753 753 GLU GLU A . n
A 1 239 ILE 239 754 754 ILE ILE A . n
A 1 240 GLU 240 755 755 GLU GLU A . n
A 1 241 PHE 241 756 756 PHE PHE A . n
A 1 242 PRO 242 757 757 PRO PRO A . n
A 1 243 ASP 243 758 758 ASP ASP A . n
A 1 244 ILE 244 759 759 ILE ILE A . n
A 1 245 PRO 245 760 760 PRO PRO A . n
A 1 246 GLU 246 761 761 GLU GLU A . n
A 1 247 LYS 247 762 762 LYS LYS A . n
A 1 248 ASP 248 763 763 ASP ASP A . n
A 1 249 LEU 249 764 764 LEU LEU A . n
A 1 250 GLN 250 765 765 GLN GLN A . n
A 1 251 ASP 251 766 766 ASP ASP A . n
A 1 252 VAL 252 767 767 VAL VAL A . n
A 1 253 LEU 253 768 768 LEU LEU A . n
A 1 254 LYS 254 769 769 LYS LYS A . n
A 1 255 CYS 255 770 770 CYS CYS A . n
A 1 256 CYS 256 771 771 CYS CYS A . n
A 1 257 LEU 257 772 772 LEU LEU A . n
A 1 258 LYS 258 773 773 LYS LYS A . n
A 1 259 ARG 259 774 774 ARG ARG A . n
A 1 260 ASP 260 775 775 ASP ASP A . n
A 1 261 PRO 261 776 776 PRO PRO A . n
A 1 262 LYS 262 777 777 LYS LYS A . n
A 1 263 GLN 263 778 778 GLN GLN A . n
A 1 264 ARG 264 779 779 ARG ARG A . n
A 1 265 ILE 265 780 780 ILE ILE A . n
A 1 266 SER 266 781 781 SER SER A . n
A 1 267 ILE 267 782 782 ILE ILE A . n
A 1 268 PRO 268 783 783 PRO PRO A . n
A 1 269 GLU 269 784 784 GLU GLU A . n
A 1 270 LEU 270 785 785 LEU LEU A . n
A 1 271 LEU 271 786 786 LEU LEU A . n
A 1 272 ALA 272 787 787 ALA ALA A . n
A 1 273 HIS 273 788 788 HIS HIS A . n
A 1 274 PRO 274 789 789 PRO PRO A . n
A 1 275 TYR 275 790 790 TYR TYR A . n
A 1 276 VAL 276 791 791 VAL VAL A . n
A 1 277 GLN 277 792 792 GLN GLN A . n
A 1 278 ILE 278 793 793 ILE ILE A . n
A 1 279 GLN 279 794 794 GLN GLN A . n
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
B 2 5NW 1 801 1 5NW Z00 A .
C 3 DMS 1 802 1 DMS DMS A .
D 4 HOH 1 901 2 HOH HOH A .
D 4 HOH 2 902 9 HOH HOH A .
D 4 HOH 3 903 15 HOH HOH A .
D 4 HOH 4 904 30 HOH HOH A .
D 4 HOH 5 905 7 HOH HOH A .
D 4 HOH 6 906 46 HOH HOH A .
D 4 HOH 7 907 6 HOH HOH A .
D 4 HOH 8 908 52 HOH HOH A .
D 4 HOH 9 909 45 HOH HOH A .
D 4 HOH 10 910 16 HOH HOH A .
D 4 HOH 11 911 25 HOH HOH A .
D 4 HOH 12 912 35 HOH HOH A .
D 4 HOH 13 913 20 HOH HOH A .
D 4 HOH 14 914 28 HOH HOH A .
D 4 HOH 15 915 47 HOH HOH A .
D 4 HOH 16 916 5 HOH HOH A .
D 4 HOH 17 917 17 HOH HOH A .
D 4 HOH 18 918 48 HOH HOH A .
D 4 HOH 19 919 4 HOH HOH A .
D 4 HOH 20 920 34 HOH HOH A .
D 4 HOH 21 921 26 HOH HOH A .
D 4 HOH 22 922 49 HOH HOH A .
D 4 HOH 23 923 53 HOH HOH A .
D 4 HOH 24 924 29 HOH HOH A .
D 4 HOH 25 925 22 HOH HOH A .
D 4 HOH 26 926 31 HOH HOH A .
D 4 HOH 27 927 1 HOH HOH A .
D 4 HOH 28 928 10 HOH HOH A .
D 4 HOH 29 929 14 HOH HOH A .
D 4 HOH 30 930 27 HOH HOH A .
D 4 HOH 31 931 3 HOH HOH A .
#
loop_
_pdbx_unobs_or_zero_occ_atoms.id
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num
_pdbx_unobs_or_zero_occ_atoms.polymer_flag
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id
_pdbx_unobs_or_zero_occ_atoms.label_alt_id
_pdbx_unobs_or_zero_occ_atoms.label_asym_id
_pdbx_unobs_or_zero_occ_atoms.label_comp_id
_pdbx_unobs_or_zero_occ_atoms.label_seq_id
_pdbx_unobs_or_zero_occ_atoms.label_atom_id
1 1 Y 1 A GLN 516 ? CG ? A GLN 1 CG
2 1 Y 1 A GLN 516 ? CD ? A GLN 1 CD
3 1 Y 1 A GLN 516 ? OE1 ? A GLN 1 OE1
4 1 Y 1 A GLN 516 ? NE2 ? A GLN 1 NE2
5 1 Y 1 A ARG 523 ? CZ ? A ARG 8 CZ
6 1 Y 1 A ARG 523 ? NH1 ? A ARG 8 NH1
7 1 Y 1 A ARG 523 ? NH2 ? A ARG 8 NH2
8 1 Y 1 A LYS 529 ? CE ? A LYS 14 CE
9 1 Y 1 A LYS 529 ? NZ ? A LYS 14 NZ
10 1 Y 1 A SER 536 ? OG ? A SER 21 OG
11 1 Y 1 A LYS 538 ? CD ? A LYS 23 CD
12 1 Y 1 A LYS 538 ? CE ? A LYS 23 CE
13 1 Y 1 A LYS 538 ? NZ ? A LYS 23 NZ
14 1 Y 1 A GLU 545 ? CG ? A GLU 30 CG
15 1 Y 1 A GLU 545 ? CD ? A GLU 30 CD
16 1 Y 1 A GLU 545 ? OE1 ? A GLU 30 OE1
17 1 Y 1 A GLU 545 ? OE2 ? A GLU 30 OE2
18 1 Y 1 A LYS 546 ? CG ? A LYS 31 CG
19 1 Y 1 A LYS 546 ? CD ? A LYS 31 CD
20 1 Y 1 A LYS 546 ? CE ? A LYS 31 CE
21 1 Y 1 A LYS 546 ? NZ ? A LYS 31 NZ
22 1 Y 1 A LYS 547 ? CG ? A LYS 32 CG
23 1 Y 1 A LYS 547 ? CD ? A LYS 32 CD
24 1 Y 1 A LYS 547 ? CE ? A LYS 32 CE
25 1 Y 1 A LYS 547 ? NZ ? A LYS 32 NZ
26 1 Y 1 A GLU 559 ? CG ? A GLU 44 CG
27 1 Y 1 A GLU 559 ? CD ? A GLU 44 CD
28 1 Y 1 A GLU 559 ? OE1 ? A GLU 44 OE1
29 1 Y 1 A GLU 559 ? OE2 ? A GLU 44 OE2
30 1 Y 1 A GLN 563 ? CG ? A GLN 48 CG
31 1 Y 1 A GLN 563 ? CD ? A GLN 48 CD
32 1 Y 1 A GLN 563 ? OE1 ? A GLN 48 OE1
33 1 Y 1 A GLN 563 ? NE2 ? A GLN 48 NE2
34 1 Y 1 A GLN 580 ? CD ? A GLN 65 CD
35 1 Y 1 A GLN 580 ? OE1 ? A GLN 65 OE1
36 1 Y 1 A GLN 580 ? NE2 ? A GLN 65 NE2
37 1 Y 1 A LYS 614 ? CE ? A LYS 99 CE
38 1 Y 1 A LYS 614 ? NZ ? A LYS 99 NZ
39 1 Y 1 A LYS 615 ? CD ? A LYS 100 CD
40 1 Y 1 A LYS 615 ? CE ? A LYS 100 CE
41 1 Y 1 A LYS 615 ? NZ ? A LYS 100 NZ
42 1 Y 1 A LYS 616 ? CE ? A LYS 101 CE
43 1 Y 1 A LYS 616 ? NZ ? A LYS 101 NZ
44 1 Y 1 A LYS 617 ? CG ? A LYS 102 CG
45 1 Y 1 A LYS 617 ? CD ? A LYS 102 CD
46 1 Y 1 A LYS 617 ? CE ? A LYS 102 CE
47 1 Y 1 A LYS 617 ? NZ ? A LYS 102 NZ
48 1 Y 1 A SER 618 ? OG ? A SER 103 OG
49 1 Y 1 A LYS 629 ? CG ? A LYS 114 CG
50 1 Y 1 A LYS 629 ? CD ? A LYS 114 CD
51 1 Y 1 A LYS 629 ? CE ? A LYS 114 CE
52 1 Y 1 A LYS 629 ? NZ ? A LYS 114 NZ
53 1 Y 1 A GLU 633 ? CG ? A GLU 118 CG
54 1 Y 1 A GLU 633 ? CD ? A GLU 118 CD
55 1 Y 1 A GLU 633 ? OE1 ? A GLU 118 OE1
56 1 Y 1 A GLU 633 ? OE2 ? A GLU 118 OE2
57 1 Y 1 A ASP 657 ? CG ? A ASP 142 CG
58 1 Y 1 A ASP 657 ? OD1 ? A ASP 142 OD1
59 1 Y 1 A ASP 657 ? OD2 ? A ASP 142 OD2
60 1 Y 1 A ASN 669 ? CG ? A ASN 154 CG
61 1 Y 1 A ASN 669 ? OD1 ? A ASN 154 OD1
62 1 Y 1 A ASN 669 ? ND2 ? A ASN 154 ND2
63 1 Y 1 A GLN 670 ? CG ? A GLN 155 CG
64 1 Y 1 A GLN 670 ? CD ? A GLN 155 CD
65 1 Y 1 A GLN 670 ? OE1 ? A GLN 155 OE1
66 1 Y 1 A GLN 670 ? NE2 ? A GLN 155 NE2
67 1 Y 1 A GLN 672 ? CG ? A GLN 157 CG
68 1 Y 1 A GLN 672 ? CD ? A GLN 157 CD
69 1 Y 1 A GLN 672 ? OE1 ? A GLN 157 OE1
70 1 Y 1 A GLN 672 ? NE2 ? A GLN 157 NE2
71 1 Y 1 A LYS 696 ? CD ? A LYS 181 CD
72 1 Y 1 A LYS 696 ? CE ? A LYS 181 CE
73 1 Y 1 A LYS 696 ? NZ ? A LYS 181 NZ
74 1 Y 1 A ASP 697 ? CG ? A ASP 182 CG
75 1 Y 1 A ASP 697 ? OD1 ? A ASP 182 OD1
76 1 Y 1 A ASP 697 ? OD2 ? A ASP 182 OD2
77 1 Y 1 A LYS 710 ? CG ? A LYS 195 CG
78 1 Y 1 A LYS 710 ? CD ? A LYS 195 CD
79 1 Y 1 A LYS 710 ? CE ? A LYS 195 CE
80 1 Y 1 A LYS 710 ? NZ ? A LYS 195 NZ
81 1 Y 1 A ILE 738 ? CG1 ? A ILE 223 CG1
82 1 Y 1 A ILE 738 ? CG2 ? A ILE 223 CG2
83 1 Y 1 A ILE 738 ? CD1 ? A ILE 223 CD1
84 1 Y 1 A GLU 753 ? CG ? A GLU 238 CG
85 1 Y 1 A GLU 753 ? CD ? A GLU 238 CD
86 1 Y 1 A GLU 753 ? OE1 ? A GLU 238 OE1
87 1 Y 1 A GLU 753 ? OE2 ? A GLU 238 OE2
88 1 Y 1 A GLU 755 ? CG ? A GLU 240 CG
89 1 Y 1 A GLU 755 ? CD ? A GLU 240 CD
90 1 Y 1 A GLU 755 ? OE1 ? A GLU 240 OE1
91 1 Y 1 A GLU 755 ? OE2 ? A GLU 240 OE2
92 1 Y 1 A LYS 762 ? CG ? A LYS 247 CG
93 1 Y 1 A LYS 762 ? CD ? A LYS 247 CD
94 1 Y 1 A LYS 762 ? CE ? A LYS 247 CE
95 1 Y 1 A LYS 762 ? NZ ? A LYS 247 NZ
96 1 Y 1 A LYS 769 ? CG ? A LYS 254 CG
97 1 Y 1 A LYS 769 ? CD ? A LYS 254 CD
98 1 Y 1 A LYS 769 ? CE ? A LYS 254 CE
99 1 Y 1 A LYS 769 ? NZ ? A LYS 254 NZ
100 1 Y 1 A LYS 773 ? CD ? A LYS 258 CD
101 1 Y 1 A LYS 773 ? CE ? A LYS 258 CE
102 1 Y 1 A LYS 773 ? NZ ? A LYS 258 NZ
103 1 Y 1 A LYS 777 ? CG ? A LYS 262 CG
104 1 Y 1 A LYS 777 ? CD ? A LYS 262 CD
105 1 Y 1 A LYS 777 ? CE ? A LYS 262 CE
106 1 Y 1 A LYS 777 ? NZ ? A LYS 262 NZ
107 1 Y 1 A GLN 794 ? CG ? A GLN 279 CG
108 1 Y 1 A GLN 794 ? CD ? A GLN 279 CD
109 1 Y 1 A GLN 794 ? OE1 ? A GLN 279 OE1
110 1 Y 1 A GLN 794 ? NE2 ? A GLN 279 NE2
#
loop_
_software.citation_id
_software.classification
_software.compiler_name
_software.compiler_version
_software.contact_author
_software.contact_author_email
_software.date
_software.description
_software.dependencies
_software.hardware
_software.language
_software.location
_software.mods
_software.name
_software.os
_software.os_version
_software.type
_software.version
_software.pdbx_ordinal
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.7 1
? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.7 2
? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER-TNT ? ? ? . 3
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5
#
_cell.angle_alpha 90.000
_cell.angle_alpha_esd ?
_cell.angle_beta 90.000
_cell.angle_beta_esd ?
_cell.angle_gamma 90.000
_cell.angle_gamma_esd ?
_cell.entry_id 5EH0
_cell.details ?
_cell.formula_units_Z ?
_cell.length_a 70.420
_cell.length_a_esd ?
_cell.length_b 105.920
_cell.length_b_esd ?
_cell.length_c 112.210
_cell.length_c_esd ?
_cell.volume ?
_cell.volume_esd ?
_cell.Z_PDB 8
_cell.reciprocal_angle_alpha ?
_cell.reciprocal_angle_beta ?
_cell.reciprocal_angle_gamma ?
_cell.reciprocal_angle_alpha_esd ?
_cell.reciprocal_angle_beta_esd ?
_cell.reciprocal_angle_gamma_esd ?
_cell.reciprocal_length_a ?
_cell.reciprocal_length_b ?
_cell.reciprocal_length_c ?
_cell.reciprocal_length_a_esd ?
_cell.reciprocal_length_b_esd ?
_cell.reciprocal_length_c_esd ?
_cell.pdbx_unique_axis ?
#
_symmetry.entry_id 5EH0
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 23
_symmetry.space_group_name_Hall ?
_symmetry.space_group_name_H-M 'I 2 2 2'
_symmetry.pdbx_full_space_group_name_H-M ?
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 5EH0
_exptl.crystals_number 1
_exptl.details ?
_exptl.method 'X-RAY DIFFRACTION'
_exptl.method_details ?
#
_exptl_crystal.colour ?
_exptl_crystal.density_diffrn ?
_exptl_crystal.density_Matthews 3.48
_exptl_crystal.density_method ?
_exptl_crystal.density_percent_sol 64.67
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.id 1
_exptl_crystal.preparation ?
_exptl_crystal.size_max ?
_exptl_crystal.size_mid ?
_exptl_crystal.size_min ?
_exptl_crystal.size_rad ?
_exptl_crystal.colour_lustre ?
_exptl_crystal.colour_modifier ?
_exptl_crystal.colour_primary ?
_exptl_crystal.density_meas ?
_exptl_crystal.density_meas_esd ?
_exptl_crystal.density_meas_gt ?
_exptl_crystal.density_meas_lt ?
_exptl_crystal.density_meas_temp ?
_exptl_crystal.density_meas_temp_esd ?
_exptl_crystal.density_meas_temp_gt ?
_exptl_crystal.density_meas_temp_lt ?
_exptl_crystal.pdbx_crystal_image_url ?
_exptl_crystal.pdbx_crystal_image_format ?
_exptl_crystal.pdbx_mosaicity ?
_exptl_crystal.pdbx_mosaicity_esd ?
#
_exptl_crystal_grow.apparatus ?
_exptl_crystal_grow.atmosphere ?
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.details ?
_exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP'
_exptl_crystal_grow.method_ref ?
_exptl_crystal_grow.pH 7.5
_exptl_crystal_grow.pressure ?
_exptl_crystal_grow.pressure_esd ?
_exptl_crystal_grow.seeding ?
_exptl_crystal_grow.seeding_ref ?
_exptl_crystal_grow.temp 291.15
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.temp_esd ?
_exptl_crystal_grow.time ?
_exptl_crystal_grow.pdbx_details
;0.1 M BisTris Propane pH 7.5
0.2 M MgCl2
0.2M Sodium Formate
20% PEG3350
;
_exptl_crystal_grow.pdbx_pH_range ?
#
_diffrn.ambient_environment ?
_diffrn.ambient_temp 100
_diffrn.ambient_temp_details ?
_diffrn.ambient_temp_esd ?
_diffrn.crystal_id 1
_diffrn.crystal_support ?
_diffrn.crystal_treatment ?
_diffrn.details ?
_diffrn.id 1
_diffrn.ambient_pressure ?
_diffrn.ambient_pressure_esd ?
_diffrn.ambient_pressure_gt ?
_diffrn.ambient_pressure_lt ?
_diffrn.ambient_temp_gt ?
_diffrn.ambient_temp_lt ?
_diffrn.pdbx_serial_crystal_experiment ?
#
_diffrn_detector.details ?
_diffrn_detector.detector PIXEL
_diffrn_detector.diffrn_id 1
_diffrn_detector.type 'DECTRIS PILATUS 6M'
_diffrn_detector.area_resol_mean ?
_diffrn_detector.dtime ?
_diffrn_detector.pdbx_frames_total ?
_diffrn_detector.pdbx_collection_time_total ?
_diffrn_detector.pdbx_collection_date 2012-07-29
#
_diffrn_radiation.collimation ?
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.filter_edge ?
_diffrn_radiation.inhomogeneity ?
_diffrn_radiation.monochromator ?
_diffrn_radiation.polarisn_norm ?
_diffrn_radiation.polarisn_ratio ?
_diffrn_radiation.probe ?
_diffrn_radiation.type ?
_diffrn_radiation.xray_symbol ?
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_wavelength_list ?
_diffrn_radiation.pdbx_wavelength ?
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.pdbx_analyzer ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 0.9680
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.current ?
_diffrn_source.details ?
_diffrn_source.diffrn_id 1
_diffrn_source.power ?
_diffrn_source.size ?
_diffrn_source.source SYNCHROTRON
_diffrn_source.target ?
_diffrn_source.type 'DIAMOND BEAMLINE I24'
_diffrn_source.voltage ?
_diffrn_source.take-off_angle ?
_diffrn_source.pdbx_wavelength_list 0.9680
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_synchrotron_beamline I24
_diffrn_source.pdbx_synchrotron_site Diamond
#
_reflns.B_iso_Wilson_estimate 70.460
_reflns.entry_id 5EH0
_reflns.data_reduction_details ?
_reflns.data_reduction_method ?
_reflns.d_resolution_high 2.180
_reflns.d_resolution_low 40.540
_reflns.details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.number_all ?
_reflns.number_obs 22272
_reflns.observed_criterion ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.observed_criterion_I_max ?
_reflns.observed_criterion_I_min ?
_reflns.observed_criterion_sigma_F ?
_reflns.observed_criterion_sigma_I ?
_reflns.percent_possible_obs 99.900
_reflns.R_free_details ?
_reflns.Rmerge_F_all ?
_reflns.Rmerge_F_obs ?
_reflns.Friedel_coverage ?
_reflns.number_gt ?
_reflns.threshold_expression ?
_reflns.pdbx_redundancy 4.400
_reflns.pdbx_Rmerge_I_obs 0.042
_reflns.pdbx_Rmerge_I_all ?
_reflns.pdbx_Rsym_value ?
_reflns.pdbx_netI_over_av_sigmaI ?
_reflns.pdbx_netI_over_sigmaI 11.400
_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
_reflns.pdbx_res_netI_over_sigmaI_2 ?
_reflns.pdbx_chi_squared ?
_reflns.pdbx_scaling_rejects 24
_reflns.pdbx_d_res_high_opt ?
_reflns.pdbx_d_res_low_opt ?
_reflns.pdbx_d_res_opt_method ?
_reflns.phase_calculation_details ?
_reflns.pdbx_Rrim_I_all ?
_reflns.pdbx_Rpim_I_all 0.022
_reflns.pdbx_d_opt ?
_reflns.pdbx_number_measured_all 97927
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
_reflns.pdbx_CC_half 0.999
_reflns.pdbx_R_split ?
#
loop_
_reflns_shell.d_res_high
_reflns_shell.d_res_low
_reflns_shell.meanI_over_sigI_all
_reflns_shell.meanI_over_sigI_obs
_reflns_shell.number_measured_all
_reflns_shell.number_measured_obs
_reflns_shell.number_possible
_reflns_shell.number_unique_all
_reflns_shell.number_unique_obs
_reflns_shell.percent_possible_all
_reflns_shell.percent_possible_obs
_reflns_shell.Rmerge_F_all
_reflns_shell.Rmerge_F_obs
_reflns_shell.Rmerge_I_all
_reflns_shell.Rmerge_I_obs
_reflns_shell.meanI_over_sigI_gt
_reflns_shell.meanI_over_uI_all
_reflns_shell.meanI_over_uI_gt
_reflns_shell.number_measured_gt
_reflns_shell.number_unique_gt
_reflns_shell.percent_possible_gt
_reflns_shell.Rmerge_F_gt
_reflns_shell.Rmerge_I_gt
_reflns_shell.pdbx_redundancy
_reflns_shell.pdbx_Rsym_value
_reflns_shell.pdbx_chi_squared
_reflns_shell.pdbx_netI_over_sigmaI_all
_reflns_shell.pdbx_netI_over_sigmaI_obs
_reflns_shell.pdbx_Rrim_I_all
_reflns_shell.pdbx_Rpim_I_all
_reflns_shell.pdbx_rejects
_reflns_shell.pdbx_ordinal
_reflns_shell.pdbx_diffrn_id
_reflns_shell.pdbx_CC_half
_reflns_shell.pdbx_R_split
2.180 2.250 ? 0.500 8221 ? ? 1897 ? 99.700 ? ? ? ? 2.555 ? ? ? ? ? ? ? ? 4.300 ? ? ? ? ? 1.393 0 1 1 0.374 ?
8.990 40.540 ? 41.400 1396 ? ? 368 ? 99.300 ? ? ? ? 0.020 ? ? ? ? ? ? ? ? 3.800 ? ? ? ? ? 0.011 0 2 1 0.999 ?
#
_refine.aniso_B[1][1] 13.3541
_refine.aniso_B[1][2] 0.0000
_refine.aniso_B[1][3] 0.0000
_refine.aniso_B[2][2] -16.3806
_refine.aniso_B[2][3] 0.0000
_refine.aniso_B[3][3] 3.0265
_refine.B_iso_max 167.750
_refine.B_iso_mean 88.2100
_refine.B_iso_min 57.990
_refine.correlation_coeff_Fo_to_Fc 0.9537
_refine.correlation_coeff_Fo_to_Fc_free 0.9560
_refine.details ?
_refine.diff_density_max ?
_refine.diff_density_max_esd ?
_refine.diff_density_min ?
_refine.diff_density_min_esd ?
_refine.diff_density_rms ?
_refine.diff_density_rms_esd ?
_refine.entry_id 5EH0
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_abs_structure_details ?
_refine.ls_abs_structure_Flack ?
_refine.ls_abs_structure_Flack_esd ?
_refine.ls_abs_structure_Rogers ?
_refine.ls_abs_structure_Rogers_esd ?
_refine.ls_d_res_high 2.1800
_refine.ls_d_res_low 23.7800
_refine.ls_extinction_coef ?
_refine.ls_extinction_coef_esd ?
_refine.ls_extinction_expression ?
_refine.ls_extinction_method ?
_refine.ls_goodness_of_fit_all ?
_refine.ls_goodness_of_fit_all_esd ?
_refine.ls_goodness_of_fit_obs ?
_refine.ls_goodness_of_fit_obs_esd ?
_refine.ls_hydrogen_treatment ?
_refine.ls_matrix_type ?
_refine.ls_number_constraints ?
_refine.ls_number_parameters ?
_refine.ls_number_reflns_all ?
_refine.ls_number_reflns_obs 22237
_refine.ls_number_reflns_R_free 1178
_refine.ls_number_reflns_R_work ?
_refine.ls_number_restraints ?
_refine.ls_percent_reflns_obs 99.8800
_refine.ls_percent_reflns_R_free 5.3000
_refine.ls_R_factor_all ?
_refine.ls_R_factor_obs 0.1975
_refine.ls_R_factor_R_free 0.2165
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_R_factor_R_work 0.1964
_refine.ls_R_Fsqd_factor_obs ?
_refine.ls_R_I_factor_obs ?
_refine.ls_redundancy_reflns_all ?
_refine.ls_redundancy_reflns_obs ?
_refine.ls_restrained_S_all ?
_refine.ls_restrained_S_obs ?
_refine.ls_shift_over_esd_max ?
_refine.ls_shift_over_esd_mean ?
_refine.ls_structure_factor_coef ?
_refine.ls_weighting_details ?
_refine.ls_weighting_scheme ?
_refine.ls_wR_factor_all ?
_refine.ls_wR_factor_obs ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.solvent_model_details ?
_refine.solvent_model_param_bsol ?
_refine.solvent_model_param_ksol ?
_refine.ls_R_factor_gt ?
_refine.ls_goodness_of_fit_gt ?
_refine.ls_goodness_of_fit_ref ?
_refine.ls_shift_over_su_max ?
_refine.ls_shift_over_su_max_lt ?
_refine.ls_shift_over_su_mean ?
_refine.ls_shift_over_su_mean_lt ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F 0.000
_refine.pdbx_ls_sigma_Fsqd ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.pdbx_isotropic_thermal_model ?
_refine.pdbx_ls_cross_valid_method THROUGHOUT
_refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT'
_refine.pdbx_starting_model ?
_refine.pdbx_stereochemistry_target_values ?
_refine.pdbx_R_Free_selection_details RANDOM
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_overall_ESU_R ?
_refine.pdbx_overall_ESU_R_Free ?
_refine.pdbx_solvent_vdw_probe_radii ?
_refine.pdbx_solvent_ion_probe_radii ?
_refine.pdbx_solvent_shrinkage_radii ?
_refine.pdbx_real_space_R ?
_refine.pdbx_density_correlation ?
_refine.pdbx_pd_number_of_powder_patterns ?
_refine.pdbx_pd_number_of_points ?
_refine.pdbx_pd_meas_number_of_points ?
_refine.pdbx_pd_proc_ls_prof_R_factor ?
_refine.pdbx_pd_proc_ls_prof_wR_factor ?
_refine.pdbx_pd_Marquardt_correlation_coeff ?
_refine.pdbx_pd_Fsqrd_R_factor ?
_refine.pdbx_pd_ls_matrix_band_width ?
_refine.pdbx_overall_phase_error ?
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.1440
_refine.pdbx_overall_SU_R_free_Blow_DPI 0.1410
_refine.pdbx_overall_SU_R_Blow_DPI 0.1620
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_diffrn_id 1
_refine.overall_SU_B ?
_refine.overall_SU_ML ?
_refine.overall_SU_R_Cruickshank_DPI 0.1640
_refine.overall_SU_R_free ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_average_fsc_overall ?
_refine.pdbx_average_fsc_work ?
_refine.pdbx_average_fsc_free ?
#
_refine_analyze.entry_id 5EH0
_refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_analyze.Luzzati_coordinate_error_free ?
_refine_analyze.Luzzati_coordinate_error_obs 0.351
_refine_analyze.Luzzati_d_res_low_free ?
_refine_analyze.Luzzati_d_res_low_obs ?
_refine_analyze.Luzzati_sigma_a_free ?
_refine_analyze.Luzzati_sigma_a_free_details ?
_refine_analyze.Luzzati_sigma_a_obs ?
_refine_analyze.Luzzati_sigma_a_obs_details ?
_refine_analyze.number_disordered_residues ?
_refine_analyze.occupancy_sum_hydrogen ?
_refine_analyze.occupancy_sum_non_hydrogen ?
_refine_analyze.RG_d_res_high ?
_refine_analyze.RG_d_res_low ?
_refine_analyze.RG_free ?
_refine_analyze.RG_work ?
_refine_analyze.RG_free_work_ratio ?
_refine_analyze.pdbx_Luzzati_d_res_high_obs ?
#
_refine_hist.cycle_id final
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.d_res_high 2.1800
_refine_hist.d_res_low 23.7800
_refine_hist.pdbx_number_atoms_ligand 35
_refine_hist.number_atoms_solvent 31
_refine_hist.number_atoms_total 2065
_refine_hist.pdbx_number_residues_total 258
_refine_hist.pdbx_B_iso_mean_ligand 84.08
_refine_hist.pdbx_B_iso_mean_solvent 83.60
_refine_hist.pdbx_number_atoms_protein 1999
_refine_hist.pdbx_number_atoms_nucleic_acid 0
#
loop_
_refine_ls_restr.pdbx_refine_id
_refine_ls_restr.criterion
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.number
_refine_ls_restr.rejects
_refine_ls_restr.type
_refine_ls_restr.weight
_refine_ls_restr.pdbx_restraint_function
'X-RAY DIFFRACTION' ? ? ? 690 ? t_dihedral_angle_d 2.000 SINUSOIDAL
'X-RAY DIFFRACTION' ? ? ? 49 ? t_trig_c_planes 2.000 HARMONIC
'X-RAY DIFFRACTION' ? ? ? 326 ? t_gen_planes 5.000 HARMONIC
'X-RAY DIFFRACTION' ? ? ? 2085 ? t_it 20.000 HARMONIC
'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ?
'X-RAY DIFFRACTION' ? ? ? 282 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC
'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ?
'X-RAY DIFFRACTION' ? ? ? 2347 ? t_ideal_dist_contact 4.000 SEMIHARMONIC
'X-RAY DIFFRACTION' ? 0.010 ? 2085 ? t_bond_d 2.000 HARMONIC
'X-RAY DIFFRACTION' ? 1.060 ? 2839 ? t_angle_deg 2.000 HARMONIC
'X-RAY DIFFRACTION' ? 2.870 ? ? ? t_omega_torsion ? ?
'X-RAY DIFFRACTION' ? 18.410 ? ? ? t_other_torsion ? ?
#
_refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_ls_shell.d_res_high 2.1800
_refine_ls_shell.d_res_low 2.2900
_refine_ls_shell.number_reflns_all 2919
_refine_ls_shell.number_reflns_obs ?
_refine_ls_shell.number_reflns_R_free 165
_refine_ls_shell.number_reflns_R_work 2754
_refine_ls_shell.percent_reflns_obs 99.6900
_refine_ls_shell.percent_reflns_R_free 5.6500
_refine_ls_shell.R_factor_all 0.2429
_refine_ls_shell.R_factor_obs ?
_refine_ls_shell.R_factor_R_free 0.2751
_refine_ls_shell.R_factor_R_free_error ?
_refine_ls_shell.R_factor_R_work 0.2410
_refine_ls_shell.redundancy_reflns_all ?
_refine_ls_shell.redundancy_reflns_obs ?
_refine_ls_shell.wR_factor_all ?
_refine_ls_shell.wR_factor_obs ?
_refine_ls_shell.wR_factor_R_free ?
_refine_ls_shell.wR_factor_R_work ?
_refine_ls_shell.pdbx_total_number_of_bins_used 11
_refine_ls_shell.pdbx_phase_error ?
_refine_ls_shell.pdbx_fsc_work ?
_refine_ls_shell.pdbx_fsc_free ?
#
_struct.entry_id 5EH0
_struct.title
;Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle kinase 1 (MPS1) Using a Structure-Based Hydridization Approach
;
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag ?
#
_struct_keywords.entry_id 5EH0
_struct_keywords.text
'Spindle Assembly Checkpoint (SAC), Oncology target Pyrido[3, 4-d]pyrimidine based inhibitors Selective against MPS1, transferase'
_struct_keywords.pdbx_keywords TRANSFERASE
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 3 ?
D N N 4 ?
#
_struct_ref.id 1
_struct_ref.db_name UNP
_struct_ref.db_code TTK_HUMAN
_struct_ref.pdbx_db_accession P33981
_struct_ref.pdbx_db_isoform ?
_struct_ref.entity_id 1
_struct_ref.pdbx_seq_one_letter_code
;ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITD
QYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDT
TSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIE
FPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
;
_struct_ref.pdbx_align_begin 516
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 5EH0
_struct_ref_seq.pdbx_strand_id A
_struct_ref_seq.seq_align_beg 1
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 279
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession P33981
_struct_ref_seq.db_align_beg 516
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 794
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg 516
_struct_ref_seq.pdbx_auth_seq_align_end 794
#
loop_
_struct_ref_seq_dif.align_id
_struct_ref_seq_dif.pdbx_pdb_id_code
_struct_ref_seq_dif.mon_id
_struct_ref_seq_dif.pdbx_pdb_strand_id
_struct_ref_seq_dif.seq_num
_struct_ref_seq_dif.pdbx_pdb_ins_code
_struct_ref_seq_dif.pdbx_seq_db_name
_struct_ref_seq_dif.pdbx_seq_db_accession_code
_struct_ref_seq_dif.db_mon_id
_struct_ref_seq_dif.pdbx_seq_db_seq_num
_struct_ref_seq_dif.details
_struct_ref_seq_dif.pdbx_auth_seq_num
_struct_ref_seq_dif.pdbx_ordinal
1 5EH0 GLN A 1 ? UNP P33981 GLU 516 conflict 516 1
1 5EH0 SER A 2 ? UNP P33981 CYS 517 conflict 517 2
1 5EH0 MET A 3 ? UNP P33981 ILE 518 conflict 518 3
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details software_defined_assembly
_pdbx_struct_assembly.method_details PISA
_pdbx_struct_assembly.oligomeric_details dimeric
_pdbx_struct_assembly.oligomeric_count 2
#
loop_
_pdbx_struct_assembly_prop.biol_id
_pdbx_struct_assembly_prop.type
_pdbx_struct_assembly_prop.value
_pdbx_struct_assembly_prop.details
1 'ABSA (A^2)' 2320 ?
1 MORE -13 ?
1 'SSA (A^2)' 22270 ?
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1,2
_pdbx_struct_assembly_gen.asym_id_list A,B,C,D
#
loop_
_pdbx_struct_oper_list.id
_pdbx_struct_oper_list.type
_pdbx_struct_oper_list.name
_pdbx_struct_oper_list.symmetry_operation
_pdbx_struct_oper_list.matrix[1][1]
_pdbx_struct_oper_list.matrix[1][2]
_pdbx_struct_oper_list.matrix[1][3]
_pdbx_struct_oper_list.vector[1]
_pdbx_struct_oper_list.matrix[2][1]
_pdbx_struct_oper_list.matrix[2][2]
_pdbx_struct_oper_list.matrix[2][3]
_pdbx_struct_oper_list.vector[2]
_pdbx_struct_oper_list.matrix[3][1]
_pdbx_struct_oper_list.matrix[3][2]
_pdbx_struct_oper_list.matrix[3][3]
_pdbx_struct_oper_list.vector[3]
1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000
2 'crystal symmetry operation' 2_545 -x,-y-1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000
0.0000000000 -105.9200000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 ASP A 46 ? GLN A 64 ? ASP A 561 GLN A 579 1 ? 19
HELX_P HELX_P2 AA2 LEU A 94 ? LYS A 101 ? LEU A 609 LYS A 616 1 ? 8
HELX_P HELX_P3 AA3 ASP A 105 ? HIS A 126 ? ASP A 620 HIS A 641 1 ? 22
HELX_P HELX_P4 AA4 LYS A 134 ? ALA A 136 ? LYS A 649 ALA A 651 5 ? 3
HELX_P HELX_P5 AA5 PRO A 176 ? ASP A 182 ? PRO A 691 ASP A 697 1 ? 7
HELX_P HELX_P6 AA6 SER A 197 ? GLY A 215 ? SER A 712 GLY A 730 1 ? 19
HELX_P HELX_P7 AA7 ASN A 224 ? ASP A 234 ? ASN A 739 ASP A 749 1 ? 11
HELX_P HELX_P8 AA8 GLU A 246 ? LEU A 257 ? GLU A 761 LEU A 772 1 ? 12
HELX_P HELX_P9 AA9 SER A 266 ? LEU A 271 ? SER A 781 LEU A 786 1 ? 6
HELX_P HELX_P10 AB1 HIS A 273 ? ILE A 278 ? HIS A 788 ILE A 793 1 ? 6
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_sheet.id
_struct_sheet.type
_struct_sheet.number_strands
_struct_sheet.details
AA1 ? 6 ?
AA2 ? 3 ?
AA3 ? 3 ?
#
loop_
_struct_sheet_order.sheet_id
_struct_sheet_order.range_id_1
_struct_sheet_order.range_id_2
_struct_sheet_order.offset
_struct_sheet_order.sense
AA1 1 2 ? anti-parallel
AA1 2 3 ? anti-parallel
AA1 3 4 ? anti-parallel
AA1 4 5 ? anti-parallel
AA1 5 6 ? anti-parallel
AA2 1 2 ? anti-parallel
AA2 2 3 ? anti-parallel
AA3 1 2 ? anti-parallel
AA3 2 3 ? anti-parallel
#
loop_
_struct_sheet_range.sheet_id
_struct_sheet_range.id
_struct_sheet_range.beg_label_comp_id
_struct_sheet_range.beg_label_asym_id
_struct_sheet_range.beg_label_seq_id
_struct_sheet_range.pdbx_beg_PDB_ins_code
_struct_sheet_range.end_label_comp_id
_struct_sheet_range.end_label_asym_id
_struct_sheet_range.end_label_seq_id
_struct_sheet_range.pdbx_end_PDB_ins_code
_struct_sheet_range.beg_auth_comp_id
_struct_sheet_range.beg_auth_asym_id
_struct_sheet_range.beg_auth_seq_id
_struct_sheet_range.end_auth_comp_id
_struct_sheet_range.end_auth_asym_id
_struct_sheet_range.end_auth_seq_id
AA1 1 SER A 2 ? VAL A 5 ? SER A 517 VAL A 520
AA1 2 ARG A 8 ? SER A 18 ? ARG A 523 SER A 533
AA1 3 SER A 22 ? LEU A 28 ? SER A 537 LEU A 543
AA1 4 ILE A 34 ? ASN A 41 ? ILE A 549 ASN A 556
AA1 5 TYR A 82 ? MET A 87 ? TYR A 597 MET A 602
AA1 6 LEU A 73 ? ILE A 78 ? LEU A 588 ILE A 593
AA2 1 SER A 2 ? VAL A 5 ? SER A 517 VAL A 520
AA2 2 ARG A 8 ? SER A 18 ? ARG A 523 SER A 533
AA2 3 GLN A 157 ? PRO A 158 ? GLN A 672 PRO A 673
AA3 1 ILE A 92 ? ASP A 93 ? ILE A 607 ASP A 608
AA3 2 PHE A 138 ? ILE A 140 ? PHE A 653 ILE A 655
AA3 3 LEU A 145 ? LEU A 147 ? LEU A 660 LEU A 662
#
loop_
_pdbx_struct_sheet_hbond.sheet_id
_pdbx_struct_sheet_hbond.range_id_1
_pdbx_struct_sheet_hbond.range_id_2
_pdbx_struct_sheet_hbond.range_1_label_atom_id
_pdbx_struct_sheet_hbond.range_1_label_comp_id
_pdbx_struct_sheet_hbond.range_1_label_asym_id
_pdbx_struct_sheet_hbond.range_1_label_seq_id
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code
_pdbx_struct_sheet_hbond.range_1_auth_atom_id
_pdbx_struct_sheet_hbond.range_1_auth_comp_id
_pdbx_struct_sheet_hbond.range_1_auth_asym_id
_pdbx_struct_sheet_hbond.range_1_auth_seq_id
_pdbx_struct_sheet_hbond.range_2_label_atom_id
_pdbx_struct_sheet_hbond.range_2_label_comp_id
_pdbx_struct_sheet_hbond.range_2_label_asym_id
_pdbx_struct_sheet_hbond.range_2_label_seq_id
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code
_pdbx_struct_sheet_hbond.range_2_auth_atom_id
_pdbx_struct_sheet_hbond.range_2_auth_comp_id
_pdbx_struct_sheet_hbond.range_2_auth_asym_id
_pdbx_struct_sheet_hbond.range_2_auth_seq_id
AA1 1 2 N MET A 3 ? N MET A 518 O TYR A 10 ? O TYR A 525
AA1 2 3 N LEU A 13 ? N LEU A 528 O GLN A 26 ? O GLN A 541
AA1 3 4 N LYS A 23 ? N LYS A 538 O TYR A 39 ? O TYR A 554
AA1 4 5 N ALA A 36 ? N ALA A 551 O MET A 87 ? O MET A 602
AA1 5 6 O VAL A 86 ? O VAL A 601 N TYR A 74 ? N TYR A 589
AA2 1 2 N MET A 3 ? N MET A 518 O TYR A 10 ? O TYR A 525
AA2 2 3 N SER A 18 ? N SER A 533 O GLN A 157 ? O GLN A 672
AA3 1 2 N ILE A 92 ? N ILE A 607 O ILE A 140 ? O ILE A 655
AA3 2 3 N LEU A 139 ? N LEU A 654 O LYS A 146 ? O LYS A 661
#
loop_
_struct_site.id
_struct_site.pdbx_evidence_code
_struct_site.pdbx_auth_asym_id
_struct_site.pdbx_auth_comp_id
_struct_site.pdbx_auth_seq_id
_struct_site.pdbx_auth_ins_code
_struct_site.pdbx_num_residues
_struct_site.details
AC1 Software A 5NW 801 ? 14 'binding site for residue 5NW A 801'
AC2 Software A DMS 802 ? 2 'binding site for residue DMS A 802'
#
loop_
_struct_site_gen.id
_struct_site_gen.site_id
_struct_site_gen.pdbx_num_res
_struct_site_gen.label_comp_id
_struct_site_gen.label_asym_id
_struct_site_gen.label_seq_id
_struct_site_gen.pdbx_auth_ins_code
_struct_site_gen.auth_comp_id
_struct_site_gen.auth_asym_id
_struct_site_gen.auth_seq_id
_struct_site_gen.label_atom_id
_struct_site_gen.label_alt_id
_struct_site_gen.symmetry
_struct_site_gen.details
1 AC1 14 ILE A 16 ? ILE A 531 . ? 1_555 ?
2 AC1 14 GLN A 26 ? GLN A 541 . ? 1_555 ?
3 AC1 14 ALA A 36 ? ALA A 551 . ? 1_555 ?
4 AC1 14 GLU A 88 ? GLU A 603 . ? 1_555 ?
5 AC1 14 CYS A 89 ? CYS A 604 . ? 1_555 ?
6 AC1 14 GLY A 90 ? GLY A 605 . ? 1_555 ?
7 AC1 14 ASN A 91 ? ASN A 606 . ? 1_555 ?
8 AC1 14 ILE A 92 ? ILE A 607 . ? 1_555 ?
9 AC1 14 ASP A 93 ? ASP A 608 . ? 1_555 ?
10 AC1 14 SER A 96 ? SER A 611 . ? 1_555 ?
11 AC1 14 ALA A 136 ? ALA A 651 . ? 1_555 ?
12 AC1 14 LEU A 139 ? LEU A 654 . ? 1_555 ?
13 AC1 14 ILE A 148 ? ILE A 663 . ? 1_555 ?
14 AC1 14 MET A 156 ? MET A 671 . ? 1_555 ?
15 AC2 2 TYR A 10 ? TYR A 525 . ? 1_555 ?
16 AC2 2 TYR A 35 ? TYR A 550 . ? 1_555 ?
#
loop_
_pdbx_validate_close_contact.id
_pdbx_validate_close_contact.PDB_model_num
_pdbx_validate_close_contact.auth_atom_id_1
_pdbx_validate_close_contact.auth_asym_id_1
_pdbx_validate_close_contact.auth_comp_id_1
_pdbx_validate_close_contact.auth_seq_id_1
_pdbx_validate_close_contact.PDB_ins_code_1
_pdbx_validate_close_contact.label_alt_id_1
_pdbx_validate_close_contact.auth_atom_id_2
_pdbx_validate_close_contact.auth_asym_id_2
_pdbx_validate_close_contact.auth_comp_id_2
_pdbx_validate_close_contact.auth_seq_id_2
_pdbx_validate_close_contact.PDB_ins_code_2
_pdbx_validate_close_contact.label_alt_id_2
_pdbx_validate_close_contact.dist
1 1 OD1 A ASN 544 ? ? N A GLN 548 ? ? 2.04
2 1 OD1 A ASN 544 ? ? N A LYS 547 ? ? 2.10
3 1 NZ A LYS 731 ? ? OE1 A GLN 736 ? ? 2.12
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 LYS A 547 ? ? 81.69 23.56
2 1 SER A 646 ? ? 75.04 -3.07
3 1 ASP A 697 ? ? -93.44 51.32
4 1 PHE A 756 ? ? -118.59 77.81
5 1 LEU A 772 ? ? -97.27 32.53
#
_diffrn_reflns.diffrn_id 1
_diffrn_reflns.pdbx_d_res_high 2.180
_diffrn_reflns.pdbx_d_res_low 40.540
_diffrn_reflns.pdbx_number_obs 22272
_diffrn_reflns.pdbx_Rmerge_I_obs 0.042
_diffrn_reflns.pdbx_Rsym_value ?
_diffrn_reflns.pdbx_chi_squared ?
_diffrn_reflns.pdbx_redundancy 4.40
_diffrn_reflns.pdbx_rejects 24
_diffrn_reflns.pdbx_percent_possible_obs 99.90
_diffrn_reflns.pdbx_observed_criterion ?
_diffrn_reflns.number 97927
_diffrn_reflns.limit_h_max ?
_diffrn_reflns.limit_h_min ?
_diffrn_reflns.limit_k_max ?
_diffrn_reflns.limit_k_min ?
_diffrn_reflns.limit_l_max ?
_diffrn_reflns.limit_l_min ?
#
loop_
_pdbx_diffrn_reflns_shell.diffrn_id
_pdbx_diffrn_reflns_shell.d_res_high
_pdbx_diffrn_reflns_shell.d_res_low
_pdbx_diffrn_reflns_shell.number_obs
_pdbx_diffrn_reflns_shell.rejects
_pdbx_diffrn_reflns_shell.Rmerge_I_obs
_pdbx_diffrn_reflns_shell.Rsym_value
_pdbx_diffrn_reflns_shell.chi_squared
_pdbx_diffrn_reflns_shell.redundancy
_pdbx_diffrn_reflns_shell.percent_possible_obs
1 2.18 2.25 ? ? 2.555 ? ? 4.30 ?
1 8.99 40.54 ? ? 0.020 ? ? 3.80 ?
#
loop_
_pdbx_refine_tls.id
_pdbx_refine_tls.pdbx_refine_id
_pdbx_refine_tls.details
_pdbx_refine_tls.method
_pdbx_refine_tls.origin_x
_pdbx_refine_tls.origin_y
_pdbx_refine_tls.origin_z
_pdbx_refine_tls.T[1][1]
_pdbx_refine_tls.T[1][1]_esd
_pdbx_refine_tls.T[1][2]
_pdbx_refine_tls.T[1][2]_esd
_pdbx_refine_tls.T[1][3]
_pdbx_refine_tls.T[1][3]_esd
_pdbx_refine_tls.T[2][2]
_pdbx_refine_tls.T[2][2]_esd
_pdbx_refine_tls.T[2][3]
_pdbx_refine_tls.T[2][3]_esd
_pdbx_refine_tls.T[3][3]
_pdbx_refine_tls.T[3][3]_esd
_pdbx_refine_tls.L[1][1]
_pdbx_refine_tls.L[1][1]_esd
_pdbx_refine_tls.L[1][2]
_pdbx_refine_tls.L[1][2]_esd
_pdbx_refine_tls.L[1][3]
_pdbx_refine_tls.L[1][3]_esd
_pdbx_refine_tls.L[2][2]
_pdbx_refine_tls.L[2][2]_esd
_pdbx_refine_tls.L[2][3]
_pdbx_refine_tls.L[2][3]_esd
_pdbx_refine_tls.L[3][3]
_pdbx_refine_tls.L[3][3]_esd
_pdbx_refine_tls.S[1][1]
_pdbx_refine_tls.S[1][1]_esd
_pdbx_refine_tls.S[1][2]
_pdbx_refine_tls.S[1][2]_esd
_pdbx_refine_tls.S[1][3]
_pdbx_refine_tls.S[1][3]_esd
_pdbx_refine_tls.S[2][1]
_pdbx_refine_tls.S[2][1]_esd
_pdbx_refine_tls.S[2][2]
_pdbx_refine_tls.S[2][2]_esd
_pdbx_refine_tls.S[2][3]
_pdbx_refine_tls.S[2][3]_esd
_pdbx_refine_tls.S[3][1]
_pdbx_refine_tls.S[3][1]_esd
_pdbx_refine_tls.S[3][2]
_pdbx_refine_tls.S[3][2]_esd
_pdbx_refine_tls.S[3][3]
_pdbx_refine_tls.S[3][3]_esd
1 'X-RAY DIFFRACTION' ? refined 1.2938 -31.5997 -16.2065 -0.2238 ? 0.0128 ? 0.0659 ? -0.0013 ? 0.1104 ? -0.2476 ? 4.4011 ?
1.3445 ? 1.3239 ? 2.3276 ? -0.2900 ? 3.3169 ? -0.0233 ? -0.5442 ? -0.1521 ? 0.2105 ? 0.0243 ? 0.0518 ? -0.1118 ? -0.0994 ?
-0.0011 ?
2 'X-RAY DIFFRACTION' ? refined -12.4564 -44.5383 -29.0082 -0.2448 ? -0.0981 ? -0.0184 ? -0.0765 ? 0.0887 ? -0.0405 ? 1.8679 ?
-1.0989 ? -0.2342 ? 2.7661 ? -0.4056 ? 3.6749 ? 0.0509 ? -0.0926 ? -0.5442 ? -0.1570 ? -0.0211 ? 0.4811 ? 0.5082 ? -0.4668 ?
-0.0298 ?
#
loop_
_pdbx_refine_tls_group.id
_pdbx_refine_tls_group.pdbx_refine_id
_pdbx_refine_tls_group.refine_tls_id
_pdbx_refine_tls_group.beg_label_asym_id
_pdbx_refine_tls_group.beg_label_seq_id
_pdbx_refine_tls_group.beg_auth_asym_id
_pdbx_refine_tls_group.beg_auth_seq_id
_pdbx_refine_tls_group.end_label_asym_id
_pdbx_refine_tls_group.end_label_seq_id
_pdbx_refine_tls_group.end_auth_asym_id
_pdbx_refine_tls_group.end_auth_seq_id
_pdbx_refine_tls_group.selection
_pdbx_refine_tls_group.selection_details
1 'X-RAY DIFFRACTION' 1 ? ? A 516 ? ? A 662 ? '{A|516 - 662}'
2 'X-RAY DIFFRACTION' 2 ? ? A 663 ? ? A 794 ? '{A|663 - 794}'
#
_pdbx_phasing_MR.entry_id 5EH0
_pdbx_phasing_MR.method_rotation ?
_pdbx_phasing_MR.method_translation ?
_pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO'
_pdbx_phasing_MR.R_factor ?
_pdbx_phasing_MR.R_rigid_body ?
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ?
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic ?
_pdbx_phasing_MR.d_res_high_rotation 3.500
_pdbx_phasing_MR.d_res_low_rotation 40.540
_pdbx_phasing_MR.d_res_high_translation ?
_pdbx_phasing_MR.d_res_low_translation ?
_pdbx_phasing_MR.packing ?
_pdbx_phasing_MR.reflns_percent_rotation ?
_pdbx_phasing_MR.reflns_percent_translation ?
_pdbx_phasing_MR.sigma_F_rotation ?
_pdbx_phasing_MR.sigma_F_translation ?
_pdbx_phasing_MR.sigma_I_rotation ?
_pdbx_phasing_MR.sigma_I_translation ?
#
_phasing.method MR
#
loop_
_pdbx_unobs_or_zero_occ_residues.id
_pdbx_unobs_or_zero_occ_residues.PDB_model_num
_pdbx_unobs_or_zero_occ_residues.polymer_flag
_pdbx_unobs_or_zero_occ_residues.occupancy_flag
_pdbx_unobs_or_zero_occ_residues.auth_asym_id
_pdbx_unobs_or_zero_occ_residues.auth_comp_id
_pdbx_unobs_or_zero_occ_residues.auth_seq_id
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code
_pdbx_unobs_or_zero_occ_residues.label_asym_id
_pdbx_unobs_or_zero_occ_residues.label_comp_id
_pdbx_unobs_or_zero_occ_residues.label_seq_id
1 1 Y 1 A THR 675 ? A THR 160
2 1 Y 1 A THR 676 ? A THR 161
3 1 Y 1 A SER 677 ? A SER 162
4 1 Y 1 A VAL 678 ? A VAL 163
5 1 Y 1 A VAL 679 ? A VAL 164
6 1 Y 1 A LYS 680 ? A LYS 165
7 1 Y 1 A ASP 681 ? A ASP 166
8 1 Y 1 A SER 682 ? A SER 167
9 1 Y 1 A GLN 683 ? A GLN 168
10 1 Y 1 A VAL 684 ? A VAL 169
11 1 Y 1 A SER 699 ? A SER 184
12 1 Y 1 A SER 700 ? A SER 185
13 1 Y 1 A SER 701 ? A SER 186
14 1 Y 1 A ARG 702 ? A ARG 187
15 1 Y 1 A GLU 703 ? A GLU 188
16 1 Y 1 A ASN 704 ? A ASN 189
17 1 Y 1 A GLY 705 ? A GLY 190
18 1 Y 1 A LYS 706 ? A LYS 191
19 1 Y 1 A SER 707 ? A SER 192
20 1 Y 1 A LYS 708 ? A LYS 193
21 1 Y 1 A SER 709 ? A SER 194
#
loop_
_chem_comp_atom.comp_id
_chem_comp_atom.atom_id
_chem_comp_atom.type_symbol
_chem_comp_atom.pdbx_aromatic_flag
_chem_comp_atom.pdbx_stereo_config
_chem_comp_atom.pdbx_ordinal
5NW C1 C Y N 1
5NW N5 N Y N 2
5NW C6 C Y N 3
5NW C7 C Y N 4
5NW C8 C Y N 5
5NW C9 C Y N 6
5NW C10 C N N 7
5NW C11 C Y N 8
5NW C12 C Y N 9
5NW C13 C Y N 10
5NW C15 C Y N 11
5NW C18 C N N 12
5NW C19 C N N 13
5NW C20 C N N 14
5NW C21 C N N 15
5NW C22 C N N 16
5NW N6 N N N 17
5NW C17 C Y N 18
5NW C16 C Y N 19
5NW C C Y N 20
5NW N1 N Y N 21
5NW C3 C Y N 22
5NW N N Y N 23
5NW C2 C Y N 24
5NW N2 N N N 25
5NW C4 C Y N 26
5NW O O N N 27
5NW C5 C Y N 28
5NW N4 N Y N 29
5NW C14 C N N 30
5NW N3 N Y N 31
5NW H1 H N N 32
5NW H2 H N N 33
5NW H3 H N N 34
5NW H4 H N N 35
5NW H5 H N N 36
5NW H6 H N N 37
5NW H7 H N N 38
5NW H8 H N N 39
5NW H9 H N N 40
5NW H10 H N N 41
5NW H11 H N N 42
5NW H12 H N N 43
5NW H13 H N N 44
5NW H14 H N N 45
5NW H15 H N N 46
5NW H16 H N N 47
5NW H17 H N N 48
5NW H18 H N N 49
5NW H19 H N N 50
5NW H20 H N N 51
5NW H21 H N N 52
5NW H22 H N N 53
5NW H23 H N N 54
5NW H24 H N N 55
5NW H25 H N N 56
5NW H26 H N N 57
5NW H27 H N N 58
ALA N N N N 59
ALA CA C N S 60
ALA C C N N 61
ALA O O N N 62
ALA CB C N N 63
ALA OXT O N N 64
ALA H H N N 65
ALA H2 H N N 66
ALA HA H N N 67
ALA HB1 H N N 68
ALA HB2 H N N 69
ALA HB3 H N N 70
ALA HXT H N N 71
ARG N N N N 72
ARG CA C N S 73
ARG C C N N 74
ARG O O N N 75
ARG CB C N N 76
ARG CG C N N 77
ARG CD C N N 78
ARG NE N N N 79
ARG CZ C N N 80
ARG NH1 N N N 81
ARG NH2 N N N 82
ARG OXT O N N 83
ARG H H N N 84
ARG H2 H N N 85
ARG HA H N N 86
ARG HB2 H N N 87
ARG HB3 H N N 88
ARG HG2 H N N 89
ARG HG3 H N N 90
ARG HD2 H N N 91
ARG HD3 H N N 92
ARG HE H N N 93
ARG HH11 H N N 94
ARG HH12 H N N 95
ARG HH21 H N N 96
ARG HH22 H N N 97
ARG HXT H N N 98
ASN N N N N 99
ASN CA C N S 100
ASN C C N N 101
ASN O O N N 102
ASN CB C N N 103
ASN CG C N N 104
ASN OD1 O N N 105
ASN ND2 N N N 106
ASN OXT O N N 107
ASN H H N N 108
ASN H2 H N N 109
ASN HA H N N 110
ASN HB2 H N N 111
ASN HB3 H N N 112
ASN HD21 H N N 113
ASN HD22 H N N 114
ASN HXT H N N 115
ASP N N N N 116
ASP CA C N S 117
ASP C C N N 118
ASP O O N N 119
ASP CB C N N 120
ASP CG C N N 121
ASP OD1 O N N 122
ASP OD2 O N N 123
ASP OXT O N N 124
ASP H H N N 125
ASP H2 H N N 126
ASP HA H N N 127
ASP HB2 H N N 128
ASP HB3 H N N 129
ASP HD2 H N N 130
ASP HXT H N N 131
CYS N N N N 132
CYS CA C N R 133
CYS C C N N 134
CYS O O N N 135
CYS CB C N N 136
CYS SG S N N 137
CYS OXT O N N 138
CYS H H N N 139
CYS H2 H N N 140
CYS HA H N N 141
CYS HB2 H N N 142
CYS HB3 H N N 143
CYS HG H N N 144
CYS HXT H N N 145
DMS S S N N 146
DMS O O N N 147
DMS C1 C N N 148
DMS C2 C N N 149
DMS H11 H N N 150
DMS H12 H N N 151
DMS H13 H N N 152
DMS H21 H N N 153
DMS H22 H N N 154
DMS H23 H N N 155
GLN N N N N 156
GLN CA C N S 157
GLN C C N N 158
GLN O O N N 159
GLN CB C N N 160
GLN CG C N N 161
GLN CD C N N 162
GLN OE1 O N N 163
GLN NE2 N N N 164
GLN OXT O N N 165
GLN H H N N 166
GLN H2 H N N 167
GLN HA H N N 168
GLN HB2 H N N 169
GLN HB3 H N N 170
GLN HG2 H N N 171
GLN HG3 H N N 172
GLN HE21 H N N 173
GLN HE22 H N N 174
GLN HXT H N N 175
GLU N N N N 176
GLU CA C N S 177
GLU C C N N 178
GLU O O N N 179
GLU CB C N N 180
GLU CG C N N 181
GLU CD C N N 182
GLU OE1 O N N 183
GLU OE2 O N N 184
GLU OXT O N N 185
GLU H H N N 186
GLU H2 H N N 187
GLU HA H N N 188
GLU HB2 H N N 189
GLU HB3 H N N 190
GLU HG2 H N N 191
GLU HG3 H N N 192
GLU HE2 H N N 193
GLU HXT H N N 194
GLY N N N N 195
GLY CA C N N 196
GLY C C N N 197
GLY O O N N 198
GLY OXT O N N 199
GLY H H N N 200
GLY H2 H N N 201
GLY HA2 H N N 202
GLY HA3 H N N 203
GLY HXT H N N 204
HIS N N N N 205
HIS CA C N S 206
HIS C C N N 207
HIS O O N N 208
HIS CB C N N 209
HIS CG C Y N 210
HIS ND1 N Y N 211
HIS CD2 C Y N 212
HIS CE1 C Y N 213
HIS NE2 N Y N 214
HIS OXT O N N 215
HIS H H N N 216
HIS H2 H N N 217
HIS HA H N N 218
HIS HB2 H N N 219
HIS HB3 H N N 220
HIS HD1 H N N 221
HIS HD2 H N N 222
HIS HE1 H N N 223
HIS HE2 H N N 224
HIS HXT H N N 225
HOH O O N N 226
HOH H1 H N N 227
HOH H2 H N N 228
ILE N N N N 229
ILE CA C N S 230
ILE C C N N 231
ILE O O N N 232
ILE CB C N S 233
ILE CG1 C N N 234
ILE CG2 C N N 235
ILE CD1 C N N 236
ILE OXT O N N 237
ILE H H N N 238
ILE H2 H N N 239
ILE HA H N N 240
ILE HB H N N 241
ILE HG12 H N N 242
ILE HG13 H N N 243
ILE HG21 H N N 244
ILE HG22 H N N 245
ILE HG23 H N N 246
ILE HD11 H N N 247
ILE HD12 H N N 248
ILE HD13 H N N 249
ILE HXT H N N 250
LEU N N N N 251
LEU CA C N S 252
LEU C C N N 253
LEU O O N N 254
LEU CB C N N 255
LEU CG C N N 256
LEU CD1 C N N 257
LEU CD2 C N N 258
LEU OXT O N N 259
LEU H H N N 260
LEU H2 H N N 261
LEU HA H N N 262
LEU HB2 H N N 263
LEU HB3 H N N 264
LEU HG H N N 265
LEU HD11 H N N 266
LEU HD12 H N N 267
LEU HD13 H N N 268
LEU HD21 H N N 269
LEU HD22 H N N 270
LEU HD23 H N N 271
LEU HXT H N N 272
LYS N N N N 273
LYS CA C N S 274
LYS C C N N 275
LYS O O N N 276
LYS CB C N N 277
LYS CG C N N 278
LYS CD C N N 279
LYS CE C N N 280
LYS NZ N N N 281
LYS OXT O N N 282
LYS H H N N 283
LYS H2 H N N 284
LYS HA H N N 285
LYS HB2 H N N 286
LYS HB3 H N N 287
LYS HG2 H N N 288
LYS HG3 H N N 289
LYS HD2 H N N 290
LYS HD3 H N N 291
LYS HE2 H N N 292
LYS HE3 H N N 293
LYS HZ1 H N N 294
LYS HZ2 H N N 295
LYS HZ3 H N N 296
LYS HXT H N N 297
MET N N N N 298
MET CA C N S 299
MET C C N N 300
MET O O N N 301
MET CB C N N 302
MET CG C N N 303
MET SD S N N 304
MET CE C N N 305
MET OXT O N N 306
MET H H N N 307
MET H2 H N N 308
MET HA H N N 309
MET HB2 H N N 310
MET HB3 H N N 311
MET HG2 H N N 312
MET HG3 H N N 313
MET HE1 H N N 314
MET HE2 H N N 315
MET HE3 H N N 316
MET HXT H N N 317
PHE N N N N 318
PHE CA C N S 319
PHE C C N N 320
PHE O O N N 321
PHE CB C N N 322
PHE CG C Y N 323
PHE CD1 C Y N 324
PHE CD2 C Y N 325
PHE CE1 C Y N 326
PHE CE2 C Y N 327
PHE CZ C Y N 328
PHE OXT O N N 329
PHE H H N N 330
PHE H2 H N N 331
PHE HA H N N 332
PHE HB2 H N N 333
PHE HB3 H N N 334
PHE HD1 H N N 335
PHE HD2 H N N 336
PHE HE1 H N N 337
PHE HE2 H N N 338
PHE HZ H N N 339
PHE HXT H N N 340
PRO N N N N 341
PRO CA C N S 342
PRO C C N N 343
PRO O O N N 344
PRO CB C N N 345
PRO CG C N N 346
PRO CD C N N 347
PRO OXT O N N 348
PRO H H N N 349
PRO HA H N N 350
PRO HB2 H N N 351
PRO HB3 H N N 352
PRO HG2 H N N 353
PRO HG3 H N N 354
PRO HD2 H N N 355
PRO HD3 H N N 356
PRO HXT H N N 357
SER N N N N 358
SER CA C N S 359
SER C C N N 360
SER O O N N 361
SER CB C N N 362
SER OG O N N 363
SER OXT O N N 364
SER H H N N 365
SER H2 H N N 366
SER HA H N N 367
SER HB2 H N N 368
SER HB3 H N N 369
SER HG H N N 370
SER HXT H N N 371
THR N N N N 372
THR CA C N S 373
THR C C N N 374
THR O O N N 375
THR CB C N R 376
THR OG1 O N N 377
THR CG2 C N N 378
THR OXT O N N 379
THR H H N N 380
THR H2 H N N 381
THR HA H N N 382
THR HB H N N 383
THR HG1 H N N 384
THR HG21 H N N 385
THR HG22 H N N 386
THR HG23 H N N 387
THR HXT H N N 388
TRP N N N N 389
TRP CA C N S 390
TRP C C N N 391
TRP O O N N 392
TRP CB C N N 393
TRP CG C Y N 394
TRP CD1 C Y N 395
TRP CD2 C Y N 396
TRP NE1 N Y N 397
TRP CE2 C Y N 398
TRP CE3 C Y N 399
TRP CZ2 C Y N 400
TRP CZ3 C Y N 401
TRP CH2 C Y N 402
TRP OXT O N N 403
TRP H H N N 404
TRP H2 H N N 405
TRP HA H N N 406
TRP HB2 H N N 407
TRP HB3 H N N 408
TRP HD1 H N N 409
TRP HE1 H N N 410
TRP HE3 H N N 411
TRP HZ2 H N N 412
TRP HZ3 H N N 413
TRP HH2 H N N 414
TRP HXT H N N 415
TYR N N N N 416
TYR CA C N S 417
TYR C C N N 418
TYR O O N N 419
TYR CB C N N 420
TYR CG C Y N 421
TYR CD1 C Y N 422
TYR CD2 C Y N 423
TYR CE1 C Y N 424
TYR CE2 C Y N 425
TYR CZ C Y N 426
TYR OH O N N 427
TYR OXT O N N 428
TYR H H N N 429
TYR H2 H N N 430
TYR HA H N N 431
TYR HB2 H N N 432
TYR HB3 H N N 433
TYR HD1 H N N 434
TYR HD2 H N N 435
TYR HE1 H N N 436
TYR HE2 H N N 437
TYR HH H N N 438
TYR HXT H N N 439
VAL N N N N 440
VAL CA C N S 441
VAL C C N N 442
VAL O O N N 443
VAL CB C N N 444
VAL CG1 C N N 445
VAL CG2 C N N 446
VAL OXT O N N 447
VAL H H N N 448
VAL H2 H N N 449
VAL HA H N N 450
VAL HB H N N 451
VAL HG11 H N N 452
VAL HG12 H N N 453
VAL HG13 H N N 454
VAL HG21 H N N 455
VAL HG22 H N N 456
VAL HG23 H N N 457
VAL HXT H N N 458
#
loop_
_chem_comp_bond.comp_id
_chem_comp_bond.atom_id_1
_chem_comp_bond.atom_id_2
_chem_comp_bond.value_order
_chem_comp_bond.pdbx_aromatic_flag
_chem_comp_bond.pdbx_stereo_config
_chem_comp_bond.pdbx_ordinal
5NW C22 C19 sing N N 1
5NW C20 C19 sing N N 2
5NW C16 N5 doub Y N 3
5NW C16 C15 sing Y N 4
5NW N5 C17 sing Y N 5
5NW C19 C18 sing N N 6
5NW C19 C21 sing N N 7
5NW C18 N6 sing N N 8
5NW C15 C1 doub Y N 9
5NW C17 N6 sing N N 10
5NW C17 C doub Y N 11
5NW C1 C sing Y N 12
5NW C1 C2 sing Y N 13
5NW C N1 sing Y N 14
5NW C2 N doub Y N 15
5NW N1 C3 doub Y N 16
5NW N C3 sing Y N 17
5NW C3 N2 sing N N 18
5NW C5 C6 doub Y N 19
5NW C5 C4 sing Y N 20
5NW C6 C7 sing Y N 21
5NW N2 C4 sing N N 22
5NW C4 C9 doub Y N 23
5NW C13 C11 doub Y N 24
5NW C13 N4 sing Y N 25
5NW C7 C11 sing N N 26
5NW C7 C8 doub Y N 27
5NW C14 N4 sing N N 28
5NW C11 C12 sing Y N 29
5NW N4 N3 sing Y N 30
5NW C9 C8 sing Y N 31
5NW C9 O sing N N 32
5NW O C10 sing N N 33
5NW C12 N3 doub Y N 34
5NW C6 H1 sing N N 35
5NW C8 H2 sing N N 36
5NW C10 H3 sing N N 37
5NW C10 H4 sing N N 38
5NW C10 H5 sing N N 39
5NW C12 H6 sing N N 40
5NW C13 H7 sing N N 41
5NW C15 H8 sing N N 42
5NW C18 H9 sing N N 43
5NW C18 H10 sing N N 44
5NW C20 H11 sing N N 45
5NW C20 H12 sing N N 46
5NW C20 H13 sing N N 47
5NW C21 H14 sing N N 48
5NW C21 H15 sing N N 49
5NW C21 H16 sing N N 50
5NW C22 H17 sing N N 51
5NW C22 H18 sing N N 52
5NW C22 H19 sing N N 53
5NW N6 H20 sing N N 54
5NW C16 H21 sing N N 55
5NW C2 H22 sing N N 56
5NW N2 H23 sing N N 57
5NW C5 H24 sing N N 58
5NW C14 H25 sing N N 59
5NW C14 H26 sing N N 60
5NW C14 H27 sing N N 61
ALA N CA sing N N 62
ALA N H sing N N 63
ALA N H2 sing N N 64
ALA CA C sing N N 65
ALA CA CB sing N N 66
ALA CA HA sing N N 67
ALA C O doub N N 68
ALA C OXT sing N N 69
ALA CB HB1 sing N N 70
ALA CB HB2 sing N N 71
ALA CB HB3 sing N N 72
ALA OXT HXT sing N N 73
ARG N CA sing N N 74
ARG N H sing N N 75
ARG N H2 sing N N 76
ARG CA C sing N N 77
ARG CA CB sing N N 78
ARG CA HA sing N N 79
ARG C O doub N N 80
ARG C OXT sing N N 81
ARG CB CG sing N N 82
ARG CB HB2 sing N N 83
ARG CB HB3 sing N N 84
ARG CG CD sing N N 85
ARG CG HG2 sing N N 86
ARG CG HG3 sing N N 87
ARG CD NE sing N N 88
ARG CD HD2 sing N N 89
ARG CD HD3 sing N N 90
ARG NE CZ sing N N 91
ARG NE HE sing N N 92
ARG CZ NH1 sing N N 93
ARG CZ NH2 doub N N 94
ARG NH1 HH11 sing N N 95
ARG NH1 HH12 sing N N 96
ARG NH2 HH21 sing N N 97
ARG NH2 HH22 sing N N 98
ARG OXT HXT sing N N 99
ASN N CA sing N N 100
ASN N H sing N N 101
ASN N H2 sing N N 102
ASN CA C sing N N 103
ASN CA CB sing N N 104
ASN CA HA sing N N 105
ASN C O doub N N 106
ASN C OXT sing N N 107
ASN CB CG sing N N 108
ASN CB HB2 sing N N 109
ASN CB HB3 sing N N 110
ASN CG OD1 doub N N 111
ASN CG ND2 sing N N 112
ASN ND2 HD21 sing N N 113
ASN ND2 HD22 sing N N 114
ASN OXT HXT sing N N 115
ASP N CA sing N N 116
ASP N H sing N N 117
ASP N H2 sing N N 118
ASP CA C sing N N 119
ASP CA CB sing N N 120
ASP CA HA sing N N 121
ASP C O doub N N 122
ASP C OXT sing N N 123
ASP CB CG sing N N 124
ASP CB HB2 sing N N 125
ASP CB HB3 sing N N 126
ASP CG OD1 doub N N 127
ASP CG OD2 sing N N 128
ASP OD2 HD2 sing N N 129
ASP OXT HXT sing N N 130
CYS N CA sing N N 131
CYS N H sing N N 132
CYS N H2 sing N N 133
CYS CA C sing N N 134
CYS CA CB sing N N 135
CYS CA HA sing N N 136
CYS C O doub N N 137
CYS C OXT sing N N 138
CYS CB SG sing N N 139
CYS CB HB2 sing N N 140
CYS CB HB3 sing N N 141
CYS SG HG sing N N 142
CYS OXT HXT sing N N 143
DMS S O doub N N 144
DMS S C1 sing N N 145
DMS S C2 sing N N 146
DMS C1 H11 sing N N 147
DMS C1 H12 sing N N 148
DMS C1 H13 sing N N 149
DMS C2 H21 sing N N 150
DMS C2 H22 sing N N 151
DMS C2 H23 sing N N 152
GLN N CA sing N N 153
GLN N H sing N N 154
GLN N H2 sing N N 155
GLN CA C sing N N 156
GLN CA CB sing N N 157
GLN CA HA sing N N 158
GLN C O doub N N 159
GLN C OXT sing N N 160
GLN CB CG sing N N 161
GLN CB HB2 sing N N 162
GLN CB HB3 sing N N 163
GLN CG CD sing N N 164
GLN CG HG2 sing N N 165
GLN CG HG3 sing N N 166
GLN CD OE1 doub N N 167
GLN CD NE2 sing N N 168
GLN NE2 HE21 sing N N 169
GLN NE2 HE22 sing N N 170
GLN OXT HXT sing N N 171
GLU N CA sing N N 172
GLU N H sing N N 173
GLU N H2 sing N N 174
GLU CA C sing N N 175
GLU CA CB sing N N 176
GLU CA HA sing N N 177
GLU C O doub N N 178
GLU C OXT sing N N 179
GLU CB CG sing N N 180
GLU CB HB2 sing N N 181
GLU CB HB3 sing N N 182
GLU CG CD sing N N 183
GLU CG HG2 sing N N 184
GLU CG HG3 sing N N 185
GLU CD OE1 doub N N 186
GLU CD OE2 sing N N 187
GLU OE2 HE2 sing N N 188
GLU OXT HXT sing N N 189
GLY N CA sing N N 190
GLY N H sing N N 191
GLY N H2 sing N N 192
GLY CA C sing N N 193
GLY CA HA2 sing N N 194
GLY CA HA3 sing N N 195
GLY C O doub N N 196
GLY C OXT sing N N 197
GLY OXT HXT sing N N 198
HIS N CA sing N N 199
HIS N H sing N N 200
HIS N H2 sing N N 201
HIS CA C sing N N 202
HIS CA CB sing N N 203
HIS CA HA sing N N 204
HIS C O doub N N 205
HIS C OXT sing N N 206
HIS CB CG sing N N 207
HIS CB HB2 sing N N 208
HIS CB HB3 sing N N 209
HIS CG ND1 sing Y N 210
HIS CG CD2 doub Y N 211
HIS ND1 CE1 doub Y N 212
HIS ND1 HD1 sing N N 213
HIS CD2 NE2 sing Y N 214
HIS CD2 HD2 sing N N 215
HIS CE1 NE2 sing Y N 216
HIS CE1 HE1 sing N N 217
HIS NE2 HE2 sing N N 218
HIS OXT HXT sing N N 219
HOH O H1 sing N N 220
HOH O H2 sing N N 221
ILE N CA sing N N 222
ILE N H sing N N 223
ILE N H2 sing N N 224
ILE CA C sing N N 225
ILE CA CB sing N N 226
ILE CA HA sing N N 227
ILE C O doub N N 228
ILE C OXT sing N N 229
ILE CB CG1 sing N N 230
ILE CB CG2 sing N N 231
ILE CB HB sing N N 232
ILE CG1 CD1 sing N N 233
ILE CG1 HG12 sing N N 234
ILE CG1 HG13 sing N N 235
ILE CG2 HG21 sing N N 236
ILE CG2 HG22 sing N N 237
ILE CG2 HG23 sing N N 238
ILE CD1 HD11 sing N N 239
ILE CD1 HD12 sing N N 240
ILE CD1 HD13 sing N N 241
ILE OXT HXT sing N N 242
LEU N CA sing N N 243
LEU N H sing N N 244
LEU N H2 sing N N 245
LEU CA C sing N N 246
LEU CA CB sing N N 247
LEU CA HA sing N N 248
LEU C O doub N N 249
LEU C OXT sing N N 250
LEU CB CG sing N N 251
LEU CB HB2 sing N N 252
LEU CB HB3 sing N N 253
LEU CG CD1 sing N N 254
LEU CG CD2 sing N N 255
LEU CG HG sing N N 256
LEU CD1 HD11 sing N N 257
LEU CD1 HD12 sing N N 258
LEU CD1 HD13 sing N N 259
LEU CD2 HD21 sing N N 260
LEU CD2 HD22 sing N N 261
LEU CD2 HD23 sing N N 262
LEU OXT HXT sing N N 263
LYS N CA sing N N 264
LYS N H sing N N 265
LYS N H2 sing N N 266
LYS CA C sing N N 267
LYS CA CB sing N N 268
LYS CA HA sing N N 269
LYS C O doub N N 270
LYS C OXT sing N N 271
LYS CB CG sing N N 272
LYS CB HB2 sing N N 273
LYS CB HB3 sing N N 274
LYS CG CD sing N N 275
LYS CG HG2 sing N N 276
LYS CG HG3 sing N N 277
LYS CD CE sing N N 278
LYS CD HD2 sing N N 279
LYS CD HD3 sing N N 280
LYS CE NZ sing N N 281
LYS CE HE2 sing N N 282
LYS CE HE3 sing N N 283
LYS NZ HZ1 sing N N 284
LYS NZ HZ2 sing N N 285
LYS NZ HZ3 sing N N 286
LYS OXT HXT sing N N 287
MET N CA sing N N 288
MET N H sing N N 289
MET N H2 sing N N 290
MET CA C sing N N 291
MET CA CB sing N N 292
MET CA HA sing N N 293
MET C O doub N N 294
MET C OXT sing N N 295
MET CB CG sing N N 296
MET CB HB2 sing N N 297
MET CB HB3 sing N N 298
MET CG SD sing N N 299
MET CG HG2 sing N N 300
MET CG HG3 sing N N 301
MET SD CE sing N N 302
MET CE HE1 sing N N 303
MET CE HE2 sing N N 304
MET CE HE3 sing N N 305
MET OXT HXT sing N N 306
PHE N CA sing N N 307
PHE N H sing N N 308
PHE N H2 sing N N 309
PHE CA C sing N N 310
PHE CA CB sing N N 311
PHE CA HA sing N N 312
PHE C O doub N N 313
PHE C OXT sing N N 314
PHE CB CG sing N N 315
PHE CB HB2 sing N N 316
PHE CB HB3 sing N N 317
PHE CG CD1 doub Y N 318
PHE CG CD2 sing Y N 319
PHE CD1 CE1 sing Y N 320
PHE CD1 HD1 sing N N 321
PHE CD2 CE2 doub Y N 322
PHE CD2 HD2 sing N N 323
PHE CE1 CZ doub Y N 324
PHE CE1 HE1 sing N N 325
PHE CE2 CZ sing Y N 326
PHE CE2 HE2 sing N N 327
PHE CZ HZ sing N N 328
PHE OXT HXT sing N N 329
PRO N CA sing N N 330
PRO N CD sing N N 331
PRO N H sing N N 332
PRO CA C sing N N 333
PRO CA CB sing N N 334
PRO CA HA sing N N 335
PRO C O doub N N 336
PRO C OXT sing N N 337
PRO CB CG sing N N 338
PRO CB HB2 sing N N 339
PRO CB HB3 sing N N 340
PRO CG CD sing N N 341
PRO CG HG2 sing N N 342
PRO CG HG3 sing N N 343
PRO CD HD2 sing N N 344
PRO CD HD3 sing N N 345
PRO OXT HXT sing N N 346
SER N CA sing N N 347
SER N H sing N N 348
SER N H2 sing N N 349
SER CA C sing N N 350
SER CA CB sing N N 351
SER CA HA sing N N 352
SER C O doub N N 353
SER C OXT sing N N 354
SER CB OG sing N N 355
SER CB HB2 sing N N 356
SER CB HB3 sing N N 357
SER OG HG sing N N 358
SER OXT HXT sing N N 359
THR N CA sing N N 360
THR N H sing N N 361
THR N H2 sing N N 362
THR CA C sing N N 363
THR CA CB sing N N 364
THR CA HA sing N N 365
THR C O doub N N 366
THR C OXT sing N N 367
THR CB OG1 sing N N 368
THR CB CG2 sing N N 369
THR CB HB sing N N 370
THR OG1 HG1 sing N N 371
THR CG2 HG21 sing N N 372
THR CG2 HG22 sing N N 373
THR CG2 HG23 sing N N 374
THR OXT HXT sing N N 375
TRP N CA sing N N 376
TRP N H sing N N 377
TRP N H2 sing N N 378
TRP CA C sing N N 379
TRP CA CB sing N N 380
TRP CA HA sing N N 381
TRP C O doub N N 382
TRP C OXT sing N N 383
TRP CB CG sing N N 384
TRP CB HB2 sing N N 385
TRP CB HB3 sing N N 386
TRP CG CD1 doub Y N 387
TRP CG CD2 sing Y N 388
TRP CD1 NE1 sing Y N 389
TRP CD1 HD1 sing N N 390
TRP CD2 CE2 doub Y N 391
TRP CD2 CE3 sing Y N 392
TRP NE1 CE2 sing Y N 393
TRP NE1 HE1 sing N N 394
TRP CE2 CZ2 sing Y N 395
TRP CE3 CZ3 doub Y N 396
TRP CE3 HE3 sing N N 397
TRP CZ2 CH2 doub Y N 398
TRP CZ2 HZ2 sing N N 399
TRP CZ3 CH2 sing Y N 400
TRP CZ3 HZ3 sing N N 401
TRP CH2 HH2 sing N N 402
TRP OXT HXT sing N N 403
TYR N CA sing N N 404
TYR N H sing N N 405
TYR N H2 sing N N 406
TYR CA C sing N N 407
TYR CA CB sing N N 408
TYR CA HA sing N N 409
TYR C O doub N N 410
TYR C OXT sing N N 411
TYR CB CG sing N N 412
TYR CB HB2 sing N N 413
TYR CB HB3 sing N N 414
TYR CG CD1 doub Y N 415
TYR CG CD2 sing Y N 416
TYR CD1 CE1 sing Y N 417
TYR CD1 HD1 sing N N 418
TYR CD2 CE2 doub Y N 419
TYR CD2 HD2 sing N N 420
TYR CE1 CZ doub Y N 421
TYR CE1 HE1 sing N N 422
TYR CE2 CZ sing Y N 423
TYR CE2 HE2 sing N N 424
TYR CZ OH sing N N 425
TYR OH HH sing N N 426
TYR OXT HXT sing N N 427
VAL N CA sing N N 428
VAL N H sing N N 429
VAL N H2 sing N N 430
VAL CA C sing N N 431
VAL CA CB sing N N 432
VAL CA HA sing N N 433
VAL C O doub N N 434
VAL C OXT sing N N 435
VAL CB CG1 sing N N 436
VAL CB CG2 sing N N 437
VAL CB HB sing N N 438
VAL CG1 HG11 sing N N 439
VAL CG1 HG12 sing N N 440
VAL CG1 HG13 sing N N 441
VAL CG2 HG21 sing N N 442
VAL CG2 HG22 sing N N 443
VAL CG2 HG23 sing N N 444
VAL OXT HXT sing N N 445
#
_pdbx_audit_support.funding_organization 'Cancer Research UK'
_pdbx_audit_support.country 'United Kingdom'
_pdbx_audit_support.grant_number ?
_pdbx_audit_support.ordinal 1
#
_atom_sites.entry_id 5EH0
_atom_sites.fract_transf_matrix[1][1] 0.014201
_atom_sites.fract_transf_matrix[1][2] 0.000000
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 0.009441
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 0.008912
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
#
loop_
_atom_type.symbol
C
N
O
S
#
loop_