data_5ELJ # _entry.id 5ELJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ELJ pdb_00005elj 10.2210/pdb5elj/pdb WWPDB D_1000215108 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-11-16 2 'Structure model' 1 1 2017-08-30 3 'Structure model' 1 2 2018-02-07 4 'Structure model' 1 3 2018-04-18 5 'Structure model' 1 4 2024-01-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Source and taxonomy' 4 3 'Structure model' 'Structure summary' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 3 'Structure model' entity 4 3 'Structure model' entity_src_gen 5 3 'Structure model' struct 6 4 'Structure model' citation 7 4 'Structure model' citation_author 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 11 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.title' 3 3 'Structure model' '_entity.pdbx_description' 4 3 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 5 3 'Structure model' '_struct.pdbx_descriptor' 6 4 'Structure model' '_citation.country' 7 4 'Structure model' '_citation.journal_abbrev' 8 4 'Structure model' '_citation.journal_id_CSD' 9 4 'Structure model' '_citation.journal_id_ISSN' 10 4 'Structure model' '_citation.journal_volume' 11 4 'Structure model' '_citation.pdbx_database_id_DOI' 12 4 'Structure model' '_citation.pdbx_database_id_PubMed' 13 4 'Structure model' '_citation.title' 14 4 'Structure model' '_citation.year' 15 5 'Structure model' '_database_2.pdbx_DOI' 16 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ELJ _pdbx_database_status.recvd_initial_deposition_date 2015-11-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hughes, D.J.' 1 ? 'Tiede, C.' 2 ? 'Hall, N.' 3 ? 'Tang, A.A.S.' 4 ? 'Trinh, C.H.' 5 ? 'Zajac, K.' 6 ? 'Mandal, U.' 7 ? 'Howell, G.' 8 ? 'Edwards, T.A.' 9 ? 'McPherson, M.J.' 10 ? 'Tomlinson, D.C.' 11 ? 'Whitehouse, A.' 12 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Signal' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1937-9145 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/scisignal.aaj2005 _citation.pdbx_database_id_PubMed 29138295 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hughes, D.J.' 1 ? primary 'Tiede, C.' 2 ? primary 'Penswick, N.' 3 ? primary 'Tang, A.A.' 4 ? primary 'Trinh, C.H.' 5 ? primary 'Mandal, U.' 6 ? primary 'Zajac, K.Z.' 7 ? primary 'Gaule, T.' 8 ? primary 'Howell, G.' 9 ? primary 'Edwards, T.A.' 10 ? primary 'Duan, J.' 11 ? primary 'Feyfant, E.' 12 ? primary 'McPherson, M.J.' 13 ? primary 'Tomlinson, D.C.' 14 ? primary 'Whitehouse, A.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man SUMO-Affirmer-S2D5 13252.120 1 ? ? ? ? 2 polymer man 'Small ubiquitin-related modifier 1' 9686.066 1 ? ? ? ? 3 water nat water 18.015 75 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name ;SUMO-1,GAP-modifying protein 1,GMP1,SMT3 homolog 3,Sentrin,Ubiquitin-homology domain protein PIC1,Ubiquitin-like protein SMT3C,Smt3C,Ubiquitin-like protein UBL1 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MASAATGVRAVPGNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIDLTQEWVFTMYYLTLEAKDGGKKKLYEAK VWVKGLTNWKLGMNFKELQEFKPVGDAAAAHHHHHH ; ;MASAATGVRAVPGNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIDLTQEWVFTMYYLTLEAKDGGKKKLYEAK VWVKGLTNWKLGMNFKELQEFKPVGDAAAAHHHHHH ; A ? 2 'polypeptide(L)' no no ;MHMEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ TGG ; ;MHMEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQ TGG ; B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 ALA n 1 5 ALA n 1 6 THR n 1 7 GLY n 1 8 VAL n 1 9 ARG n 1 10 ALA n 1 11 VAL n 1 12 PRO n 1 13 GLY n 1 14 ASN n 1 15 GLU n 1 16 ASN n 1 17 SER n 1 18 LEU n 1 19 GLU n 1 20 ILE n 1 21 GLU n 1 22 GLU n 1 23 LEU n 1 24 ALA n 1 25 ARG n 1 26 PHE n 1 27 ALA n 1 28 VAL n 1 29 ASP n 1 30 GLU n 1 31 HIS n 1 32 ASN n 1 33 LYS n 1 34 LYS n 1 35 GLU n 1 36 ASN n 1 37 ALA n 1 38 LEU n 1 39 LEU n 1 40 GLU n 1 41 PHE n 1 42 VAL n 1 43 ARG n 1 44 VAL n 1 45 VAL n 1 46 LYS n 1 47 ALA n 1 48 LYS n 1 49 GLU n 1 50 GLN n 1 51 ILE n 1 52 ASP n 1 53 LEU n 1 54 THR n 1 55 GLN n 1 56 GLU n 1 57 TRP n 1 58 VAL n 1 59 PHE n 1 60 THR n 1 61 MET n 1 62 TYR n 1 63 TYR n 1 64 LEU n 1 65 THR n 1 66 LEU n 1 67 GLU n 1 68 ALA n 1 69 LYS n 1 70 ASP n 1 71 GLY n 1 72 GLY n 1 73 LYS n 1 74 LYS n 1 75 LYS n 1 76 LEU n 1 77 TYR n 1 78 GLU n 1 79 ALA n 1 80 LYS n 1 81 VAL n 1 82 TRP n 1 83 VAL n 1 84 LYS n 1 85 GLY n 1 86 LEU n 1 87 THR n 1 88 ASN n 1 89 TRP n 1 90 LYS n 1 91 LEU n 1 92 GLY n 1 93 MET n 1 94 ASN n 1 95 PHE n 1 96 LYS n 1 97 GLU n 1 98 LEU n 1 99 GLN n 1 100 GLU n 1 101 PHE n 1 102 LYS n 1 103 PRO n 1 104 VAL n 1 105 GLY n 1 106 ASP n 1 107 ALA n 1 108 ALA n 1 109 ALA n 1 110 ALA n 1 111 HIS n 1 112 HIS n 1 113 HIS n 1 114 HIS n 1 115 HIS n 1 116 HIS n 2 1 MET n 2 2 HIS n 2 3 MET n 2 4 GLU n 2 5 GLY n 2 6 GLU n 2 7 TYR n 2 8 ILE n 2 9 LYS n 2 10 LEU n 2 11 LYS n 2 12 VAL n 2 13 ILE n 2 14 GLY n 2 15 GLN n 2 16 ASP n 2 17 SER n 2 18 SER n 2 19 GLU n 2 20 ILE n 2 21 HIS n 2 22 PHE n 2 23 LYS n 2 24 VAL n 2 25 LYS n 2 26 MET n 2 27 THR n 2 28 THR n 2 29 HIS n 2 30 LEU n 2 31 LYS n 2 32 LYS n 2 33 LEU n 2 34 LYS n 2 35 GLU n 2 36 SER n 2 37 TYR n 2 38 CYS n 2 39 GLN n 2 40 ARG n 2 41 GLN n 2 42 GLY n 2 43 VAL n 2 44 PRO n 2 45 MET n 2 46 ASN n 2 47 SER n 2 48 LEU n 2 49 ARG n 2 50 PHE n 2 51 LEU n 2 52 PHE n 2 53 GLU n 2 54 GLY n 2 55 GLN n 2 56 ARG n 2 57 ILE n 2 58 ALA n 2 59 ASP n 2 60 ASN n 2 61 HIS n 2 62 THR n 2 63 PRO n 2 64 LYS n 2 65 GLU n 2 66 LEU n 2 67 GLY n 2 68 MET n 2 69 GLU n 2 70 GLU n 2 71 GLU n 2 72 ASP n 2 73 VAL n 2 74 ILE n 2 75 GLU n 2 76 VAL n 2 77 TYR n 2 78 GLN n 2 79 GLU n 2 80 GLN n 2 81 THR n 2 82 GLY n 2 83 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 116 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? PET11 ? ? 2 1 sample 'Biological sequence' 1 83 Human ? 'SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? PET11 ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 18 ? ? ? A . n A 1 2 ALA 2 19 ? ? ? A . n A 1 3 SER 3 20 ? ? ? A . n A 1 4 ALA 4 21 ? ? ? A . n A 1 5 ALA 5 22 ? ? ? A . n A 1 6 THR 6 23 ? ? ? A . n A 1 7 GLY 7 24 ? ? ? A . n A 1 8 VAL 8 25 ? ? ? A . n A 1 9 ARG 9 26 ? ? ? A . n A 1 10 ALA 10 27 ? ? ? A . n A 1 11 VAL 11 28 ? ? ? A . n A 1 12 PRO 12 29 ? ? ? A . n A 1 13 GLY 13 30 ? ? ? A . n A 1 14 ASN 14 31 ? ? ? A . n A 1 15 GLU 15 32 32 GLU GLU A . n A 1 16 ASN 16 33 33 ASN ASN A . n A 1 17 SER 17 34 34 SER SER A . n A 1 18 LEU 18 35 35 LEU LEU A . n A 1 19 GLU 19 36 36 GLU GLU A . n A 1 20 ILE 20 37 37 ILE ILE A . n A 1 21 GLU 21 38 38 GLU GLU A . n A 1 22 GLU 22 39 39 GLU GLU A . n A 1 23 LEU 23 40 40 LEU LEU A . n A 1 24 ALA 24 41 41 ALA ALA A . n A 1 25 ARG 25 42 42 ARG ARG A . n A 1 26 PHE 26 43 43 PHE PHE A . n A 1 27 ALA 27 44 44 ALA ALA A . n A 1 28 VAL 28 45 45 VAL VAL A . n A 1 29 ASP 29 46 46 ASP ASP A . n A 1 30 GLU 30 47 47 GLU GLU A . n A 1 31 HIS 31 48 48 HIS HIS A . n A 1 32 ASN 32 49 49 ASN ASN A . n A 1 33 LYS 33 50 50 LYS LYS A . n A 1 34 LYS 34 51 51 LYS LYS A . n A 1 35 GLU 35 52 52 GLU GLU A . n A 1 36 ASN 36 53 53 ASN ASN A . n A 1 37 ALA 37 54 54 ALA ALA A . n A 1 38 LEU 38 55 55 LEU LEU A . n A 1 39 LEU 39 56 56 LEU LEU A . n A 1 40 GLU 40 57 57 GLU GLU A . n A 1 41 PHE 41 58 58 PHE PHE A . n A 1 42 VAL 42 59 59 VAL VAL A . n A 1 43 ARG 43 60 60 ARG ARG A . n A 1 44 VAL 44 61 61 VAL VAL A . n A 1 45 VAL 45 62 62 VAL VAL A . n A 1 46 LYS 46 63 63 LYS LYS A . n A 1 47 ALA 47 64 64 ALA ALA A . n A 1 48 LYS 48 65 65 LYS LYS A . n A 1 49 GLU 49 66 66 GLU GLU A . n A 1 50 GLN 50 67 67 GLN GLN A . n A 1 51 ILE 51 68 68 ILE ILE A . n A 1 52 ASP 52 69 69 ASP ASP A . n A 1 53 LEU 53 70 70 LEU LEU A . n A 1 54 THR 54 71 71 THR THR A . n A 1 55 GLN 55 72 72 GLN GLN A . n A 1 56 GLU 56 73 73 GLU GLU A . n A 1 57 TRP 57 74 74 TRP TRP A . n A 1 58 VAL 58 75 75 VAL VAL A . n A 1 59 PHE 59 76 76 PHE PHE A . n A 1 60 THR 60 77 77 THR THR A . n A 1 61 MET 61 78 78 MET MET A . n A 1 62 TYR 62 79 79 TYR TYR A . n A 1 63 TYR 63 80 80 TYR TYR A . n A 1 64 LEU 64 81 81 LEU LEU A . n A 1 65 THR 65 82 82 THR THR A . n A 1 66 LEU 66 83 83 LEU LEU A . n A 1 67 GLU 67 84 84 GLU GLU A . n A 1 68 ALA 68 85 85 ALA ALA A . n A 1 69 LYS 69 86 86 LYS LYS A . n A 1 70 ASP 70 87 87 ASP ASP A . n A 1 71 GLY 71 88 88 GLY GLY A . n A 1 72 GLY 72 89 89 GLY GLY A . n A 1 73 LYS 73 90 90 LYS LYS A . n A 1 74 LYS 74 91 91 LYS LYS A . n A 1 75 LYS 75 92 92 LYS LYS A . n A 1 76 LEU 76 93 93 LEU LEU A . n A 1 77 TYR 77 94 94 TYR TYR A . n A 1 78 GLU 78 95 95 GLU GLU A . n A 1 79 ALA 79 96 96 ALA ALA A . n A 1 80 LYS 80 97 97 LYS LYS A . n A 1 81 VAL 81 98 98 VAL VAL A . n A 1 82 TRP 82 99 99 TRP TRP A . n A 1 83 VAL 83 100 100 VAL VAL A . n A 1 84 LYS 84 101 101 LYS LYS A . n A 1 85 GLY 85 102 102 GLY GLY A . n A 1 86 LEU 86 103 103 LEU LEU A . n A 1 87 THR 87 104 104 THR THR A . n A 1 88 ASN 88 105 105 ASN ASN A . n A 1 89 TRP 89 106 106 TRP TRP A . n A 1 90 LYS 90 107 107 LYS LYS A . n A 1 91 LEU 91 108 108 LEU LEU A . n A 1 92 GLY 92 109 109 GLY GLY A . n A 1 93 MET 93 110 110 MET MET A . n A 1 94 ASN 94 111 111 ASN ASN A . n A 1 95 PHE 95 112 112 PHE PHE A . n A 1 96 LYS 96 113 113 LYS LYS A . n A 1 97 GLU 97 114 114 GLU GLU A . n A 1 98 LEU 98 115 115 LEU LEU A . n A 1 99 GLN 99 116 116 GLN GLN A . n A 1 100 GLU 100 117 117 GLU GLU A . n A 1 101 PHE 101 118 118 PHE PHE A . n A 1 102 LYS 102 119 119 LYS LYS A . n A 1 103 PRO 103 120 120 PRO PRO A . n A 1 104 VAL 104 121 121 VAL VAL A . n A 1 105 GLY 105 122 ? ? ? A . n A 1 106 ASP 106 123 ? ? ? A . n A 1 107 ALA 107 124 ? ? ? A . n A 1 108 ALA 108 125 ? ? ? A . n A 1 109 ALA 109 126 ? ? ? A . n A 1 110 ALA 110 127 ? ? ? A . n A 1 111 HIS 111 128 ? ? ? A . n A 1 112 HIS 112 129 ? ? ? A . n A 1 113 HIS 113 130 ? ? ? A . n A 1 114 HIS 114 131 ? ? ? A . n A 1 115 HIS 115 132 ? ? ? A . n A 1 116 HIS 116 133 ? ? ? A . n B 2 1 MET 1 15 ? ? ? B . n B 2 2 HIS 2 16 ? ? ? B . n B 2 3 MET 3 17 ? ? ? B . n B 2 4 GLU 4 18 ? ? ? B . n B 2 5 GLY 5 19 19 GLY GLY B . n B 2 6 GLU 6 20 20 GLU GLU B . n B 2 7 TYR 7 21 21 TYR TYR B . n B 2 8 ILE 8 22 22 ILE ILE B . n B 2 9 LYS 9 23 23 LYS LYS B . n B 2 10 LEU 10 24 24 LEU LEU B . n B 2 11 LYS 11 25 25 LYS LYS B . n B 2 12 VAL 12 26 26 VAL VAL B . n B 2 13 ILE 13 27 27 ILE ILE B . n B 2 14 GLY 14 28 28 GLY GLY B . n B 2 15 GLN 15 29 29 GLN GLN B . n B 2 16 ASP 16 30 30 ASP ASP B . n B 2 17 SER 17 31 31 SER SER B . n B 2 18 SER 18 32 32 SER SER B . n B 2 19 GLU 19 33 33 GLU GLU B . n B 2 20 ILE 20 34 34 ILE ILE B . n B 2 21 HIS 21 35 35 HIS HIS B . n B 2 22 PHE 22 36 36 PHE PHE B . n B 2 23 LYS 23 37 37 LYS LYS B . n B 2 24 VAL 24 38 38 VAL VAL B . n B 2 25 LYS 25 39 39 LYS LYS B . n B 2 26 MET 26 40 40 MET MET B . n B 2 27 THR 27 41 41 THR THR B . n B 2 28 THR 28 42 42 THR THR B . n B 2 29 HIS 29 43 43 HIS HIS B . n B 2 30 LEU 30 44 44 LEU LEU B . n B 2 31 LYS 31 45 45 LYS LYS B . n B 2 32 LYS 32 46 46 LYS LYS B . n B 2 33 LEU 33 47 47 LEU LEU B . n B 2 34 LYS 34 48 48 LYS LYS B . n B 2 35 GLU 35 49 49 GLU GLU B . n B 2 36 SER 36 50 50 SER SER B . n B 2 37 TYR 37 51 51 TYR TYR B . n B 2 38 CYS 38 52 52 CYS CYS B . n B 2 39 GLN 39 53 53 GLN GLN B . n B 2 40 ARG 40 54 54 ARG ARG B . n B 2 41 GLN 41 55 55 GLN GLN B . n B 2 42 GLY 42 56 56 GLY GLY B . n B 2 43 VAL 43 57 57 VAL VAL B . n B 2 44 PRO 44 58 58 PRO PRO B . n B 2 45 MET 45 59 59 MET MET B . n B 2 46 ASN 46 60 60 ASN ASN B . n B 2 47 SER 47 61 61 SER SER B . n B 2 48 LEU 48 62 62 LEU LEU B . n B 2 49 ARG 49 63 63 ARG ARG B . n B 2 50 PHE 50 64 64 PHE PHE B . n B 2 51 LEU 51 65 65 LEU LEU B . n B 2 52 PHE 52 66 66 PHE PHE B . n B 2 53 GLU 53 67 67 GLU GLU B . n B 2 54 GLY 54 68 68 GLY GLY B . n B 2 55 GLN 55 69 69 GLN GLN B . n B 2 56 ARG 56 70 70 ARG ARG B . n B 2 57 ILE 57 71 71 ILE ILE B . n B 2 58 ALA 58 72 72 ALA ALA B . n B 2 59 ASP 59 73 73 ASP ASP B . n B 2 60 ASN 60 74 74 ASN ASN B . n B 2 61 HIS 61 75 75 HIS HIS B . n B 2 62 THR 62 76 76 THR THR B . n B 2 63 PRO 63 77 77 PRO PRO B . n B 2 64 LYS 64 78 78 LYS LYS B . n B 2 65 GLU 65 79 79 GLU GLU B . n B 2 66 LEU 66 80 80 LEU LEU B . n B 2 67 GLY 67 81 81 GLY GLY B . n B 2 68 MET 68 82 82 MET MET B . n B 2 69 GLU 69 83 83 GLU GLU B . n B 2 70 GLU 70 84 84 GLU GLU B . n B 2 71 GLU 71 85 85 GLU GLU B . n B 2 72 ASP 72 86 86 ASP ASP B . n B 2 73 VAL 73 87 87 VAL VAL B . n B 2 74 ILE 74 88 88 ILE ILE B . n B 2 75 GLU 75 89 89 GLU GLU B . n B 2 76 VAL 76 90 90 VAL VAL B . n B 2 77 TYR 77 91 91 TYR TYR B . n B 2 78 GLN 78 92 92 GLN GLN B . n B 2 79 GLU 79 93 93 GLU GLU B . n B 2 80 GLN 80 94 ? ? ? B . n B 2 81 THR 81 95 ? ? ? B . n B 2 82 GLY 82 96 ? ? ? B . n B 2 83 GLY 83 97 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 201 50 HOH HOH A . C 3 HOH 2 202 61 HOH HOH A . C 3 HOH 3 203 5 HOH HOH A . C 3 HOH 4 204 9 HOH HOH A . C 3 HOH 5 205 1 HOH HOH A . C 3 HOH 6 206 72 HOH HOH A . C 3 HOH 7 207 44 HOH HOH A . C 3 HOH 8 208 60 HOH HOH A . C 3 HOH 9 209 39 HOH HOH A . C 3 HOH 10 210 3 HOH HOH A . C 3 HOH 11 211 49 HOH HOH A . C 3 HOH 12 212 73 HOH HOH A . C 3 HOH 13 213 34 HOH HOH A . C 3 HOH 14 214 31 HOH HOH A . C 3 HOH 15 215 16 HOH HOH A . C 3 HOH 16 216 11 HOH HOH A . C 3 HOH 17 217 36 HOH HOH A . C 3 HOH 18 218 12 HOH HOH A . C 3 HOH 19 219 62 HOH HOH A . C 3 HOH 20 220 74 HOH HOH A . C 3 HOH 21 221 35 HOH HOH A . C 3 HOH 22 222 46 HOH HOH A . C 3 HOH 23 223 29 HOH HOH A . C 3 HOH 24 224 55 HOH HOH A . C 3 HOH 25 225 26 HOH HOH A . C 3 HOH 26 226 53 HOH HOH A . C 3 HOH 27 227 59 HOH HOH A . C 3 HOH 28 228 25 HOH HOH A . C 3 HOH 29 229 48 HOH HOH A . C 3 HOH 30 230 54 HOH HOH A . C 3 HOH 31 231 66 HOH HOH A . C 3 HOH 32 232 13 HOH HOH A . C 3 HOH 33 233 7 HOH HOH A . C 3 HOH 34 234 24 HOH HOH A . C 3 HOH 35 235 10 HOH HOH A . C 3 HOH 36 236 69 HOH HOH A . C 3 HOH 37 237 58 HOH HOH A . C 3 HOH 38 238 71 HOH HOH A . C 3 HOH 39 239 23 HOH HOH A . C 3 HOH 40 240 14 HOH HOH A . D 3 HOH 1 101 37 HOH HOH B . D 3 HOH 2 102 70 HOH HOH B . D 3 HOH 3 103 4 HOH HOH B . D 3 HOH 4 104 30 HOH HOH B . D 3 HOH 5 105 22 HOH HOH B . D 3 HOH 6 106 28 HOH HOH B . D 3 HOH 7 107 45 HOH HOH B . D 3 HOH 8 108 19 HOH HOH B . D 3 HOH 9 109 6 HOH HOH B . D 3 HOH 10 110 51 HOH HOH B . D 3 HOH 11 111 20 HOH HOH B . D 3 HOH 12 112 41 HOH HOH B . D 3 HOH 13 113 40 HOH HOH B . D 3 HOH 14 114 15 HOH HOH B . D 3 HOH 15 115 8 HOH HOH B . D 3 HOH 16 116 33 HOH HOH B . D 3 HOH 17 117 63 HOH HOH B . D 3 HOH 18 118 2 HOH HOH B . D 3 HOH 19 119 38 HOH HOH B . D 3 HOH 20 120 32 HOH HOH B . D 3 HOH 21 121 43 HOH HOH B . D 3 HOH 22 122 68 HOH HOH B . D 3 HOH 23 123 52 HOH HOH B . D 3 HOH 24 124 21 HOH HOH B . D 3 HOH 25 125 27 HOH HOH B . D 3 HOH 26 126 64 HOH HOH B . D 3 HOH 27 127 75 HOH HOH B . D 3 HOH 28 128 57 HOH HOH B . D 3 HOH 29 129 67 HOH HOH B . D 3 HOH 30 130 42 HOH HOH B . D 3 HOH 31 131 17 HOH HOH B . D 3 HOH 32 132 18 HOH HOH B . D 3 HOH 33 133 65 HOH HOH B . D 3 HOH 34 134 47 HOH HOH B . D 3 HOH 35 135 56 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 32 ? CG ? A GLU 15 CG 2 1 Y 1 A GLU 32 ? CD ? A GLU 15 CD 3 1 Y 1 A GLU 32 ? OE1 ? A GLU 15 OE1 4 1 Y 1 A GLU 32 ? OE2 ? A GLU 15 OE2 5 1 Y 1 B GLU 20 ? CG ? B GLU 6 CG 6 1 Y 1 B GLU 20 ? CD ? B GLU 6 CD 7 1 Y 1 B GLU 20 ? OE1 ? B GLU 6 OE1 8 1 Y 1 B GLU 20 ? OE2 ? B GLU 6 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5ELJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 36.230 _cell.length_a_esd ? _cell.length_b 70.720 _cell.length_b_esd ? _cell.length_c 83.630 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ELJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ELJ _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Hepes sodium salt, 10% w/v polyethylene glycol 20000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-06 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'SAGITALLY FOCUSED Si (111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 44.1 _reflns.entry_id 5ELJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.98 _reflns.d_resolution_low 70.7 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15526 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 2.0 _reflns.observed_criterion_sigma_I 2.0 _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.3 _reflns.pdbx_Rmerge_I_obs 0.061 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.98 _reflns_shell.d_res_low 2.03 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.438 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.0 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ELJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.983 _refine.ls_d_res_low 54.001 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13029 _refine.ls_number_reflns_R_free 658 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 83.85 _refine.ls_percent_reflns_R_free 5.05 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1906 _refine.ls_R_factor_R_free 0.2363 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1884 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB ENTRIES 2UYZ and 4N6T' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random Selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.49 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1361 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 1436 _refine_hist.d_res_high 1.983 _refine_hist.d_res_low 54.001 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1386 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.012 ? 1857 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.652 ? 531 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.043 ? 200 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 234 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9826 2.1357 . . 60 1168 40.00 . . . 0.2485 . 0.2026 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1357 2.3506 . . 127 2281 79.00 . . . 0.2994 . 0.2331 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3506 2.6907 . . 161 2893 99.00 . . . 0.2607 . 0.2332 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6907 3.3899 . . 162 2932 100.00 . . . 0.2779 . 0.2053 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3899 54.0207 . . 148 3097 99.00 . . . 0.1923 . 0.1613 . . . . . . . . . . # _struct.entry_id 5ELJ _struct.title 'Isoform-specific inhibition of SUMO-dependent protein-protein interactions' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5ELJ _struct_keywords.text 'Ubiquitin, Sumoylation, signaling protein' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 5ELJ 5ELJ ? 1 ? 1 2 UNP SUMO1_HUMAN P63165 ? 2 ;EGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG ; 18 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5ELJ A 1 ? 116 ? 5ELJ 18 ? 133 ? 18 133 2 2 5ELJ B 4 ? 83 ? P63165 18 ? 97 ? 18 97 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 5ELJ MET B 1 ? UNP P63165 ? ? 'initiating methionine' 15 1 2 5ELJ HIS B 2 ? UNP P63165 ? ? 'expression tag' 16 2 2 5ELJ MET B 3 ? UNP P63165 ? ? 'expression tag' 17 3 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 3 'ABSA (A^2)' 1220 ? 3 MORE -4 ? 3 'SSA (A^2)' 9720 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C 2 1 B,D 3 1 A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 15 ? ASN A 36 ? GLU A 32 ASN A 53 1 ? 22 HELX_P HELX_P2 AA2 LEU A 86 ? LYS A 90 ? LEU A 103 LYS A 107 5 ? 5 HELX_P HELX_P3 AA3 GLY A 92 ? ASN A 94 ? GLY A 109 ASN A 111 5 ? 3 HELX_P HELX_P4 AA4 LEU B 30 ? GLY B 42 ? LEU B 44 GLY B 56 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 96 ? PRO A 103 ? LYS A 113 PRO A 120 AA1 2 LYS A 74 ? LYS A 84 ? LYS A 91 LYS A 101 AA1 3 PHE A 59 ? LYS A 69 ? PHE A 76 LYS A 86 AA1 4 GLU A 40 ? ASP A 52 ? GLU A 57 ASP A 69 AA1 5 GLU B 19 ? LYS B 25 ? GLU B 33 LYS B 39 AA1 6 TYR B 7 ? ILE B 13 ? TYR B 21 ILE B 27 AA1 7 ASP B 72 ? GLN B 78 ? ASP B 86 GLN B 92 AA1 8 LEU B 48 ? PHE B 52 ? LEU B 62 PHE B 66 AA1 9 GLN B 55 ? ARG B 56 ? GLN B 69 ARG B 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 97 ? O GLU A 114 N TRP A 82 ? N TRP A 99 AA1 2 3 O VAL A 83 ? O VAL A 100 N THR A 60 ? N THR A 77 AA1 3 4 O GLU A 67 ? O GLU A 84 N ARG A 43 ? N ARG A 60 AA1 4 5 N GLU A 49 ? N GLU A 66 O HIS B 21 ? O HIS B 35 AA1 5 6 O VAL B 24 ? O VAL B 38 N ILE B 8 ? N ILE B 22 AA1 6 7 N LYS B 11 ? N LYS B 25 O ILE B 74 ? O ILE B 88 AA1 7 8 O TYR B 77 ? O TYR B 91 N ARG B 49 ? N ARG B 63 AA1 8 9 N PHE B 52 ? N PHE B 66 O GLN B 55 ? O GLN B 69 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -5.1129 33.9871 -37.9857 0.2867 ? 0.0244 ? -0.0883 ? 0.3219 ? 0.0187 ? 0.2836 ? 1.4358 ? -0.3577 ? -0.1832 ? 3.8910 ? -1.1705 ? 6.6341 ? 0.1163 ? 0.2762 ? 0.1770 ? -0.2944 ? -0.3104 ? 0.1312 ? -0.0292 ? -0.2678 ? 0.2458 ? 2 'X-RAY DIFFRACTION' ? refined -1.0690 18.0672 -19.8382 0.2998 ? -0.0796 ? -0.0512 ? 0.2158 ? -0.0072 ? 0.2821 ? 4.0185 ? -2.2265 ? 0.9393 ? 5.8559 ? -1.5972 ? 5.2919 ? 0.0151 ? -0.0479 ? -0.0865 ? 0.1017 ? -0.1095 ? 0.1082 ? 0.1065 ? -0.1323 ? 0.0770 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;(chain 'A' and resid 32 through 121) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;(chain 'B' and resid 19 through 93) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 18 ? A MET 1 2 1 Y 1 A ALA 19 ? A ALA 2 3 1 Y 1 A SER 20 ? A SER 3 4 1 Y 1 A ALA 21 ? A ALA 4 5 1 Y 1 A ALA 22 ? A ALA 5 6 1 Y 1 A THR 23 ? A THR 6 7 1 Y 1 A GLY 24 ? A GLY 7 8 1 Y 1 A VAL 25 ? A VAL 8 9 1 Y 1 A ARG 26 ? A ARG 9 10 1 Y 1 A ALA 27 ? A ALA 10 11 1 Y 1 A VAL 28 ? A VAL 11 12 1 Y 1 A PRO 29 ? A PRO 12 13 1 Y 1 A GLY 30 ? A GLY 13 14 1 Y 1 A ASN 31 ? A ASN 14 15 1 Y 1 A GLY 122 ? A GLY 105 16 1 Y 1 A ASP 123 ? A ASP 106 17 1 Y 1 A ALA 124 ? A ALA 107 18 1 Y 1 A ALA 125 ? A ALA 108 19 1 Y 1 A ALA 126 ? A ALA 109 20 1 Y 1 A ALA 127 ? A ALA 110 21 1 Y 1 A HIS 128 ? A HIS 111 22 1 Y 1 A HIS 129 ? A HIS 112 23 1 Y 1 A HIS 130 ? A HIS 113 24 1 Y 1 A HIS 131 ? A HIS 114 25 1 Y 1 A HIS 132 ? A HIS 115 26 1 Y 1 A HIS 133 ? A HIS 116 27 1 Y 1 B MET 15 ? B MET 1 28 1 Y 1 B HIS 16 ? B HIS 2 29 1 Y 1 B MET 17 ? B MET 3 30 1 Y 1 B GLU 18 ? B GLU 4 31 1 Y 1 B GLN 94 ? B GLN 80 32 1 Y 1 B THR 95 ? B THR 81 33 1 Y 1 B GLY 96 ? B GLY 82 34 1 Y 1 B GLY 97 ? B GLY 83 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Wellcome Trust' 'United Kingdom' 089330 1 'Biotechnology and Biological Sciences Research Council' ? BB/K000306/1 2 'Biotechnology and Biological Sciences Research Council' ? BB/M006557/1 3 # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 2UYZ 'PDB ENTRIES 2UYZ and 4N6T' 2 ? 'experimental model' PDB 4N6T 'PDB ENTRIES 2UYZ and 4N6T' # _atom_sites.entry_id 5ELJ _atom_sites.fract_transf_matrix[1][1] 0.027601 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014140 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011957 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_