data_5EMA # _entry.id 5EMA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5EMA pdb_00005ema 10.2210/pdb5ema/pdb WWPDB D_1000215160 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-09-07 2 'Structure model' 1 1 2016-09-21 3 'Structure model' 1 2 2016-10-19 4 'Structure model' 1 3 2017-09-27 5 'Structure model' 1 4 2020-01-08 6 'Structure model' 1 5 2023-09-27 7 'Structure model' 1 6 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Author supporting evidence' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' 9 6 'Structure model' 'Refinement description' 10 7 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_source 2 4 'Structure model' pdbx_audit_support 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' pdbx_audit_support 5 6 'Structure model' chem_comp_atom 6 6 'Structure model' chem_comp_bond 7 6 'Structure model' database_2 8 6 'Structure model' pdbx_initial_refinement_model 9 7 'Structure model' pdbx_entry_details 10 7 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 4 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 5 'Structure model' '_pdbx_audit_support.funding_organization' 5 6 'Structure model' '_database_2.pdbx_DOI' 6 6 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5EMA _pdbx_database_status.recvd_initial_deposition_date 2015-11-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 4Z8J PDB . unspecified 5ELQ PDB . unspecified 5EM9 PDB . unspecified 5EMB PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Collins, B.M.' 1 'Clairfeuille, T.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-9985 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 23 _citation.language ? _citation.page_first 921 _citation.page_last 932 _citation.title 'A molecular code for endosomal recycling of phosphorylated cargos by the SNX27-retromer complex.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/nsmb.3290 _citation.pdbx_database_id_PubMed 27595347 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Clairfeuille, T.' 1 ? primary 'Mas, C.' 2 ? primary 'Chan, A.S.' 3 ? primary 'Yang, Z.' 4 ? primary 'Tello-Lafoz, M.' 5 ? primary 'Chandra, M.' 6 ? primary 'Widagdo, J.' 7 ? primary 'Kerr, M.C.' 8 ? primary 'Paul, B.' 9 ? primary 'Merida, I.' 10 ? primary 'Teasdale, R.D.' 11 ? primary 'Pavlos, N.J.' 12 ? primary 'Anggono, V.' 13 ? primary 'Collins, B.M.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Sorting nexin-27' 10569.952 1 ? ? 'PDZ domain (UNP residues 39-133)' ? 2 polymer syn ASP-ASP-ILE-SEP-THR-VAL-VAL 924.886 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 150 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MAP-responsive gene protein,Methamphetamine-responsive transcript 1 protein,PDZ-protein Mrt1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHGGSPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATH KQVVDLIRAGEKELILTVLSV ; ;GSHGGSPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATH KQVVDLIRAGEKELILTVLSV ; A ? 2 'polypeptide(L)' no yes 'PDDI(SEP)TVV' PDDISTVV B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 GLY n 1 5 GLY n 1 6 SER n 1 7 PRO n 1 8 ARG n 1 9 VAL n 1 10 VAL n 1 11 ARG n 1 12 ILE n 1 13 VAL n 1 14 LYS n 1 15 SER n 1 16 GLU n 1 17 SER n 1 18 GLY n 1 19 TYR n 1 20 GLY n 1 21 PHE n 1 22 ASN n 1 23 VAL n 1 24 ARG n 1 25 GLY n 1 26 GLN n 1 27 VAL n 1 28 SER n 1 29 GLU n 1 30 GLY n 1 31 GLY n 1 32 GLN n 1 33 LEU n 1 34 ARG n 1 35 SER n 1 36 ILE n 1 37 ASN n 1 38 GLY n 1 39 GLU n 1 40 LEU n 1 41 TYR n 1 42 ALA n 1 43 PRO n 1 44 LEU n 1 45 GLN n 1 46 HIS n 1 47 VAL n 1 48 SER n 1 49 ALA n 1 50 VAL n 1 51 LEU n 1 52 PRO n 1 53 GLY n 1 54 GLY n 1 55 ALA n 1 56 ALA n 1 57 ASP n 1 58 ARG n 1 59 ALA n 1 60 GLY n 1 61 VAL n 1 62 ARG n 1 63 LYS n 1 64 GLY n 1 65 ASP n 1 66 ARG n 1 67 ILE n 1 68 LEU n 1 69 GLU n 1 70 VAL n 1 71 ASN n 1 72 GLY n 1 73 VAL n 1 74 ASN n 1 75 VAL n 1 76 GLU n 1 77 GLY n 1 78 ALA n 1 79 THR n 1 80 HIS n 1 81 LYS n 1 82 GLN n 1 83 VAL n 1 84 VAL n 1 85 ASP n 1 86 LEU n 1 87 ILE n 1 88 ARG n 1 89 ALA n 1 90 GLY n 1 91 GLU n 1 92 LYS n 1 93 GLU n 1 94 LEU n 1 95 ILE n 1 96 LEU n 1 97 THR n 1 98 VAL n 1 99 LEU n 1 100 SER n 1 101 VAL n 2 1 PRO n 2 2 ASP n 2 3 ASP n 2 4 ILE n 2 5 SEP n 2 6 THR n 2 7 VAL n 2 8 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 101 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Snx27, Mrt1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 8 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 35 ? ? ? A . n A 1 2 SER 2 36 ? ? ? A . n A 1 3 HIS 3 37 ? ? ? A . n A 1 4 GLY 4 38 ? ? ? A . n A 1 5 GLY 5 39 ? ? ? A . n A 1 6 SER 6 40 40 SER SER A . n A 1 7 PRO 7 41 41 PRO PRO A . n A 1 8 ARG 8 42 42 ARG ARG A . n A 1 9 VAL 9 43 43 VAL VAL A . n A 1 10 VAL 10 44 44 VAL VAL A . n A 1 11 ARG 11 45 45 ARG ARG A . n A 1 12 ILE 12 46 46 ILE ILE A . n A 1 13 VAL 13 47 47 VAL VAL A . n A 1 14 LYS 14 48 48 LYS LYS A . n A 1 15 SER 15 49 49 SER SER A . n A 1 16 GLU 16 50 50 GLU GLU A . n A 1 17 SER 17 51 51 SER SER A . n A 1 18 GLY 18 52 52 GLY GLY A . n A 1 19 TYR 19 53 53 TYR TYR A . n A 1 20 GLY 20 54 54 GLY GLY A . n A 1 21 PHE 21 55 55 PHE PHE A . n A 1 22 ASN 22 56 56 ASN ASN A . n A 1 23 VAL 23 57 57 VAL VAL A . n A 1 24 ARG 24 58 58 ARG ARG A . n A 1 25 GLY 25 59 59 GLY GLY A . n A 1 26 GLN 26 60 60 GLN GLN A . n A 1 27 VAL 27 61 61 VAL VAL A . n A 1 28 SER 28 62 62 SER SER A . n A 1 29 GLU 29 63 63 GLU GLU A . n A 1 30 GLY 30 64 64 GLY GLY A . n A 1 31 GLY 31 65 65 GLY GLY A . n A 1 32 GLN 32 66 66 GLN GLN A . n A 1 33 LEU 33 67 67 LEU LEU A . n A 1 34 ARG 34 68 68 ARG ARG A . n A 1 35 SER 35 69 69 SER SER A . n A 1 36 ILE 36 70 70 ILE ILE A . n A 1 37 ASN 37 71 71 ASN ASN A . n A 1 38 GLY 38 72 72 GLY GLY A . n A 1 39 GLU 39 73 73 GLU GLU A . n A 1 40 LEU 40 74 74 LEU LEU A . n A 1 41 TYR 41 75 75 TYR TYR A . n A 1 42 ALA 42 76 76 ALA ALA A . n A 1 43 PRO 43 77 77 PRO PRO A . n A 1 44 LEU 44 78 78 LEU LEU A . n A 1 45 GLN 45 79 79 GLN GLN A . n A 1 46 HIS 46 80 80 HIS HIS A . n A 1 47 VAL 47 81 81 VAL VAL A . n A 1 48 SER 48 82 82 SER SER A . n A 1 49 ALA 49 83 83 ALA ALA A . n A 1 50 VAL 50 84 84 VAL VAL A . n A 1 51 LEU 51 85 85 LEU LEU A . n A 1 52 PRO 52 86 86 PRO PRO A . n A 1 53 GLY 53 87 87 GLY GLY A . n A 1 54 GLY 54 88 88 GLY GLY A . n A 1 55 ALA 55 89 89 ALA ALA A . n A 1 56 ALA 56 90 90 ALA ALA A . n A 1 57 ASP 57 91 91 ASP ASP A . n A 1 58 ARG 58 92 92 ARG ARG A . n A 1 59 ALA 59 93 93 ALA ALA A . n A 1 60 GLY 60 94 94 GLY GLY A . n A 1 61 VAL 61 95 95 VAL VAL A . n A 1 62 ARG 62 96 96 ARG ARG A . n A 1 63 LYS 63 97 97 LYS LYS A . n A 1 64 GLY 64 98 98 GLY GLY A . n A 1 65 ASP 65 99 99 ASP ASP A . n A 1 66 ARG 66 100 100 ARG ARG A . n A 1 67 ILE 67 101 101 ILE ILE A . n A 1 68 LEU 68 102 102 LEU LEU A . n A 1 69 GLU 69 103 103 GLU GLU A . n A 1 70 VAL 70 104 104 VAL VAL A . n A 1 71 ASN 71 105 105 ASN ASN A . n A 1 72 GLY 72 106 106 GLY GLY A . n A 1 73 VAL 73 107 107 VAL VAL A . n A 1 74 ASN 74 108 108 ASN ASN A . n A 1 75 VAL 75 109 109 VAL VAL A . n A 1 76 GLU 76 110 110 GLU GLU A . n A 1 77 GLY 77 111 111 GLY GLY A . n A 1 78 ALA 78 112 112 ALA ALA A . n A 1 79 THR 79 113 113 THR THR A . n A 1 80 HIS 80 114 114 HIS HIS A . n A 1 81 LYS 81 115 115 LYS LYS A . n A 1 82 GLN 82 116 116 GLN GLN A . n A 1 83 VAL 83 117 117 VAL VAL A . n A 1 84 VAL 84 118 118 VAL VAL A . n A 1 85 ASP 85 119 119 ASP ASP A . n A 1 86 LEU 86 120 120 LEU LEU A . n A 1 87 ILE 87 121 121 ILE ILE A . n A 1 88 ARG 88 122 122 ARG ARG A . n A 1 89 ALA 89 123 123 ALA ALA A . n A 1 90 GLY 90 124 124 GLY GLY A . n A 1 91 GLU 91 125 125 GLU GLU A . n A 1 92 LYS 92 126 126 LYS LYS A . n A 1 93 GLU 93 127 127 GLU GLU A . n A 1 94 LEU 94 128 128 LEU LEU A . n A 1 95 ILE 95 129 129 ILE ILE A . n A 1 96 LEU 96 130 130 LEU LEU A . n A 1 97 THR 97 131 131 THR THR A . n A 1 98 VAL 98 132 132 VAL VAL A . n A 1 99 LEU 99 133 133 LEU LEU A . n A 1 100 SER 100 134 134 SER SER A . n A 1 101 VAL 101 135 135 VAL VAL A . n B 2 1 PRO 1 0 ? ? ? B . n B 2 2 ASP 2 1 1 ASP ASP B . n B 2 3 ASP 3 2 2 ASP ASP B . n B 2 4 ILE 4 3 3 ILE ILE B . n B 2 5 SEP 5 4 4 SEP SEP B . n B 2 6 THR 6 5 5 THR THR B . n B 2 7 VAL 7 6 6 VAL VAL B . n B 2 8 VAL 8 7 7 VAL VAL B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 201 1 GOL GOL A . D 4 HOH 1 301 133 HOH HOH A . D 4 HOH 2 302 137 HOH HOH A . D 4 HOH 3 303 80 HOH HOH A . D 4 HOH 4 304 121 HOH HOH A . D 4 HOH 5 305 81 HOH HOH A . D 4 HOH 6 306 106 HOH HOH A . D 4 HOH 7 307 71 HOH HOH A . D 4 HOH 8 308 99 HOH HOH A . D 4 HOH 9 309 68 HOH HOH A . D 4 HOH 10 310 120 HOH HOH A . D 4 HOH 11 311 123 HOH HOH A . D 4 HOH 12 312 30 HOH HOH A . D 4 HOH 13 313 24 HOH HOH A . D 4 HOH 14 314 36 HOH HOH A . D 4 HOH 15 315 45 HOH HOH A . D 4 HOH 16 316 144 HOH HOH A . D 4 HOH 17 317 76 HOH HOH A . D 4 HOH 18 318 3 HOH HOH A . D 4 HOH 19 319 65 HOH HOH A . D 4 HOH 20 320 55 HOH HOH A . D 4 HOH 21 321 43 HOH HOH A . D 4 HOH 22 322 79 HOH HOH A . D 4 HOH 23 323 23 HOH HOH A . D 4 HOH 24 324 44 HOH HOH A . D 4 HOH 25 325 108 HOH HOH A . D 4 HOH 26 326 48 HOH HOH A . D 4 HOH 27 327 22 HOH HOH A . D 4 HOH 28 328 20 HOH HOH A . D 4 HOH 29 329 52 HOH HOH A . D 4 HOH 30 330 116 HOH HOH A . D 4 HOH 31 331 14 HOH HOH A . D 4 HOH 32 332 13 HOH HOH A . D 4 HOH 33 333 1 HOH HOH A . D 4 HOH 34 334 128 HOH HOH A . D 4 HOH 35 335 29 HOH HOH A . D 4 HOH 36 336 16 HOH HOH A . D 4 HOH 37 337 21 HOH HOH A . D 4 HOH 38 338 17 HOH HOH A . D 4 HOH 39 339 78 HOH HOH A . D 4 HOH 40 340 9 HOH HOH A . D 4 HOH 41 341 33 HOH HOH A . D 4 HOH 42 342 4 HOH HOH A . D 4 HOH 43 343 2 HOH HOH A . D 4 HOH 44 344 101 HOH HOH A . D 4 HOH 45 345 118 HOH HOH A . D 4 HOH 46 346 83 HOH HOH A . D 4 HOH 47 347 73 HOH HOH A . D 4 HOH 48 348 75 HOH HOH A . D 4 HOH 49 349 12 HOH HOH A . D 4 HOH 50 350 38 HOH HOH A . D 4 HOH 51 351 15 HOH HOH A . D 4 HOH 52 352 64 HOH HOH A . D 4 HOH 53 353 59 HOH HOH A . D 4 HOH 54 354 54 HOH HOH A . D 4 HOH 55 355 126 HOH HOH A . D 4 HOH 56 356 105 HOH HOH A . D 4 HOH 57 357 62 HOH HOH A . D 4 HOH 58 358 58 HOH HOH A . D 4 HOH 59 359 96 HOH HOH A . D 4 HOH 60 360 119 HOH HOH A . D 4 HOH 61 361 26 HOH HOH A . D 4 HOH 62 362 7 HOH HOH A . D 4 HOH 63 363 91 HOH HOH A . D 4 HOH 64 364 5 HOH HOH A . D 4 HOH 65 365 104 HOH HOH A . D 4 HOH 66 366 77 HOH HOH A . D 4 HOH 67 367 34 HOH HOH A . D 4 HOH 68 368 95 HOH HOH A . D 4 HOH 69 369 40 HOH HOH A . D 4 HOH 70 370 6 HOH HOH A . D 4 HOH 71 371 19 HOH HOH A . D 4 HOH 72 372 28 HOH HOH A . D 4 HOH 73 373 27 HOH HOH A . D 4 HOH 74 374 18 HOH HOH A . D 4 HOH 75 375 67 HOH HOH A . D 4 HOH 76 376 10 HOH HOH A . D 4 HOH 77 377 66 HOH HOH A . D 4 HOH 78 378 63 HOH HOH A . D 4 HOH 79 379 72 HOH HOH A . D 4 HOH 80 380 146 HOH HOH A . D 4 HOH 81 381 141 HOH HOH A . D 4 HOH 82 382 124 HOH HOH A . D 4 HOH 83 383 8 HOH HOH A . D 4 HOH 84 384 35 HOH HOH A . D 4 HOH 85 385 57 HOH HOH A . D 4 HOH 86 386 70 HOH HOH A . D 4 HOH 87 387 117 HOH HOH A . D 4 HOH 88 388 47 HOH HOH A . D 4 HOH 89 389 93 HOH HOH A . D 4 HOH 90 390 61 HOH HOH A . D 4 HOH 91 391 143 HOH HOH A . D 4 HOH 92 392 90 HOH HOH A . D 4 HOH 93 393 138 HOH HOH A . D 4 HOH 94 394 113 HOH HOH A . D 4 HOH 95 395 84 HOH HOH A . D 4 HOH 96 396 46 HOH HOH A . D 4 HOH 97 397 102 HOH HOH A . D 4 HOH 98 398 125 HOH HOH A . D 4 HOH 99 399 88 HOH HOH A . D 4 HOH 100 400 148 HOH HOH A . D 4 HOH 101 401 149 HOH HOH A . D 4 HOH 102 402 53 HOH HOH A . D 4 HOH 103 403 103 HOH HOH A . D 4 HOH 104 404 142 HOH HOH A . D 4 HOH 105 405 111 HOH HOH A . D 4 HOH 106 406 112 HOH HOH A . D 4 HOH 107 407 147 HOH HOH A . D 4 HOH 108 408 89 HOH HOH A . D 4 HOH 109 409 92 HOH HOH A . D 4 HOH 110 410 87 HOH HOH A . D 4 HOH 111 411 100 HOH HOH A . D 4 HOH 112 412 97 HOH HOH A . D 4 HOH 113 413 145 HOH HOH A . D 4 HOH 114 414 132 HOH HOH A . D 4 HOH 115 415 98 HOH HOH A . D 4 HOH 116 416 82 HOH HOH A . D 4 HOH 117 417 51 HOH HOH A . D 4 HOH 118 418 49 HOH HOH A . D 4 HOH 119 419 140 HOH HOH A . D 4 HOH 120 420 11 HOH HOH A . D 4 HOH 121 421 94 HOH HOH A . D 4 HOH 122 422 139 HOH HOH A . D 4 HOH 123 423 74 HOH HOH A . D 4 HOH 124 424 127 HOH HOH A . D 4 HOH 125 425 85 HOH HOH A . D 4 HOH 126 426 129 HOH HOH A . D 4 HOH 127 427 50 HOH HOH A . D 4 HOH 128 428 56 HOH HOH A . D 4 HOH 129 429 150 HOH HOH A . D 4 HOH 130 430 136 HOH HOH A . D 4 HOH 131 431 39 HOH HOH A . D 4 HOH 132 432 110 HOH HOH A . D 4 HOH 133 433 130 HOH HOH A . D 4 HOH 134 434 109 HOH HOH A . E 4 HOH 1 101 25 HOH HOH B . E 4 HOH 2 102 60 HOH HOH B . E 4 HOH 3 103 41 HOH HOH B . E 4 HOH 4 104 31 HOH HOH B . E 4 HOH 5 105 134 HOH HOH B . E 4 HOH 6 106 32 HOH HOH B . E 4 HOH 7 107 86 HOH HOH B . E 4 HOH 8 108 42 HOH HOH B . E 4 HOH 9 109 37 HOH HOH B . E 4 HOH 10 110 69 HOH HOH B . E 4 HOH 11 111 122 HOH HOH B . E 4 HOH 12 112 107 HOH HOH B . E 4 HOH 13 113 135 HOH HOH B . E 4 HOH 14 114 115 HOH HOH B . E 4 HOH 15 115 131 HOH HOH B . E 4 HOH 16 116 114 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.4_1496 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5EMA _cell.details ? _cell.formula_units_Z ? _cell.length_a 37.171 _cell.length_a_esd ? _cell.length_b 48.490 _cell.length_b_esd ? _cell.length_c 56.229 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5EMA _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5EMA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2 M ammonium sulphate and 0.1 M sodium acetate (pH 4.6)' _exptl_crystal_grow.pdbx_pH_range 4.6 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-10-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95370 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95370 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5EMA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.32 _reflns.d_resolution_low 48.5 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23850 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.1 _reflns.pdbx_Rmerge_I_obs 0.054 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.Rmerge_I_obs 0.614 _reflns_shell.d_res_high 1.32 _reflns_shell.d_res_low 1.34 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_sigI_obs 2.5 _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_gt ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_gt ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_redundancy 6.2 _reflns_shell.pdbx_rejects ? _reflns_shell.percent_possible_all 86.4 _reflns_shell.percent_possible_gt ? _reflns_shell.percent_possible_obs ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5EMA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.32 _refine.ls_d_res_low 36.721 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23811 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.17 _refine.ls_percent_reflns_R_free 8.40 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1632 _refine.ls_R_factor_R_free 0.1788 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1618 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4Z8J _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 16.80 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.11 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 772 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 150 _refine_hist.number_atoms_total 928 _refine_hist.d_res_high 1.32 _refine_hist.d_res_low 36.721 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 803 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.431 ? 1088 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.506 ? 303 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.078 ? 127 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 145 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.3161 1.3490 . . 130 1422 89.00 . . . 0.2532 . 0.2377 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3490 1.3854 . . 139 1504 95.00 . . . 0.2418 . 0.1886 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3854 1.4262 . . 140 1529 96.00 . . . 0.2164 . 0.1949 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4262 1.4723 . . 138 1517 96.00 . . . 0.2116 . 0.1796 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4723 1.5249 . . 144 1556 97.00 . . . 0.2181 . 0.1692 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5249 1.5859 . . 140 1533 97.00 . . . 0.1663 . 0.1600 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5859 1.6581 . . 142 1555 97.00 . . . 0.1845 . 0.1554 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6581 1.7455 . . 143 1559 97.00 . . . 0.1798 . 0.1552 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7455 1.8549 . . 146 1594 97.00 . . . 0.1754 . 0.1554 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8549 1.9981 . . 145 1570 98.00 . . . 0.1506 . 0.1464 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9981 2.1991 . . 146 1596 98.00 . . . 0.1788 . 0.1384 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1991 2.5173 . . 147 1608 99.00 . . . 0.1516 . 0.1439 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5173 3.1713 . . 151 1638 99.00 . . . 0.1878 . 0.1673 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1713 36.7357 . . 149 1630 93.00 . . . 0.1742 . 0.1717 . . . . . . . . . . # _struct.entry_id 5EMA _struct.title 'Crystal structure of the SNX27 PDZ domain bound to the phosphorylated C-terminal LRRC3B PDZ binding motif' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5EMA _struct_keywords.text 'Endosome, PDZ domain, sorting nexin, PROTEIN TRANSPORT' _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SNX27_RAT Q8K4V4 ? 1 ;PRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDL IRAGEKELILTVLSV ; 39 2 PDB 5EMA 5EMA ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5EMA A 7 ? 101 ? Q8K4V4 39 ? 133 ? 41 135 2 2 5EMA B 1 ? 8 ? 5EMA 0 ? 7 ? 0 7 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5EMA GLY A 1 ? UNP Q8K4V4 ? ? 'expression tag' 35 1 1 5EMA SER A 2 ? UNP Q8K4V4 ? ? 'expression tag' 36 2 1 5EMA HIS A 3 ? UNP Q8K4V4 ? ? 'expression tag' 37 3 1 5EMA GLY A 4 ? UNP Q8K4V4 ? ? 'expression tag' 38 4 1 5EMA GLY A 5 ? UNP Q8K4V4 ? ? 'expression tag' 39 5 1 5EMA SER A 6 ? UNP Q8K4V4 ? ? 'expression tag' 40 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1140 ? 1 MORE -7 ? 1 'SSA (A^2)' 5850 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 54 ? GLY A 60 ? GLY A 88 GLY A 94 1 ? 7 HELX_P HELX_P2 AA2 THR A 79 ? ARG A 88 ? THR A 113 ARG A 122 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ILE 4 C ? ? ? 1_555 B SEP 5 N ? ? B ILE 3 B SEP 4 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale2 covale both ? B SEP 5 C ? ? ? 1_555 B THR 6 N ? ? B SEP 4 B THR 5 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id SEP _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 5 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id SEP _pdbx_modification_feature.auth_asym_id B _pdbx_modification_feature.auth_seq_id 4 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id SER _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id SEP _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 8 ? VAL A 13 ? ARG A 42 VAL A 47 AA1 2 GLU A 93 ? LEU A 99 ? GLU A 127 LEU A 133 AA1 3 ARG A 66 ? VAL A 70 ? ARG A 100 VAL A 104 AA1 4 VAL A 73 ? ASN A 74 ? VAL A 107 ASN A 108 AA2 1 HIS A 46 ? VAL A 50 ? HIS A 80 VAL A 84 AA2 2 PHE A 21 ? GLY A 25 ? PHE A 55 GLY A 59 AA2 3 ILE B 4 ? VAL B 7 ? ILE B 3 VAL B 6 AA3 1 ARG A 34 ? ILE A 36 ? ARG A 68 ILE A 70 AA3 2 GLU A 39 ? TYR A 41 ? GLU A 73 TYR A 75 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 12 ? N ILE A 46 O LEU A 94 ? O LEU A 128 AA1 2 3 O THR A 97 ? O THR A 131 N LEU A 68 ? N LEU A 102 AA1 3 4 N VAL A 70 ? N VAL A 104 O VAL A 73 ? O VAL A 107 AA2 1 2 O HIS A 46 ? O HIS A 80 N ARG A 24 ? N ARG A 58 AA2 2 3 N GLY A 25 ? N GLY A 59 O ILE B 4 ? O ILE B 3 AA3 1 2 N ILE A 36 ? N ILE A 70 O GLU A 39 ? O GLU A 73 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id GOL _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'binding site for residue GOL A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASN A 22 ? ASN A 56 . ? 1_555 ? 2 AC1 7 LEU A 40 ? LEU A 74 . ? 2_455 ? 3 AC1 7 ALA A 49 ? ALA A 83 . ? 1_555 ? 4 AC1 7 ASN A 71 ? ASN A 105 . ? 3_555 ? 5 AC1 7 GLU A 93 ? GLU A 127 . ? 3_555 ? 6 AC1 7 HOH D . ? HOH A 310 . ? 1_555 ? 7 AC1 7 HOH D . ? HOH A 313 . ? 1_555 ? # _pdbx_entry_details.entry_id 5EMA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ1 A LYS 97 ? ? O A HOH 301 ? ? 1.54 2 1 O A HOH 356 ? ? O A HOH 387 ? ? 1.94 3 1 NZ A LYS 97 ? ? O A HOH 301 ? ? 1.98 4 1 O A HOH 381 ? ? O A HOH 386 ? ? 2.05 5 1 O A HOH 365 ? ? O A HOH 424 ? ? 2.07 6 1 O A HOH 315 ? ? O A HOH 381 ? ? 2.08 7 1 ND2 A ASN 108 ? ? O A HOH 302 ? ? 2.13 8 1 O A HOH 400 ? ? O A HOH 433 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 126 ? ? -143.11 -16.06 2 1 LYS A 126 ? ? -149.92 -16.06 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 35 ? A GLY 1 2 1 Y 1 A SER 36 ? A SER 2 3 1 Y 1 A HIS 37 ? A HIS 3 4 1 Y 1 A GLY 38 ? A GLY 4 5 1 Y 1 A GLY 39 ? A GLY 5 6 1 Y 1 B PRO 0 ? B PRO 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 GOL C1 C N N 123 GOL O1 O N N 124 GOL C2 C N N 125 GOL O2 O N N 126 GOL C3 C N N 127 GOL O3 O N N 128 GOL H11 H N N 129 GOL H12 H N N 130 GOL HO1 H N N 131 GOL H2 H N N 132 GOL HO2 H N N 133 GOL H31 H N N 134 GOL H32 H N N 135 GOL HO3 H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 SEP N N N N 270 SEP CA C N S 271 SEP CB C N N 272 SEP OG O N N 273 SEP C C N N 274 SEP O O N N 275 SEP OXT O N N 276 SEP P P N N 277 SEP O1P O N N 278 SEP O2P O N N 279 SEP O3P O N N 280 SEP H H N N 281 SEP H2 H N N 282 SEP HA H N N 283 SEP HB2 H N N 284 SEP HB3 H N N 285 SEP HXT H N N 286 SEP HOP2 H N N 287 SEP HOP3 H N N 288 SER N N N N 289 SER CA C N S 290 SER C C N N 291 SER O O N N 292 SER CB C N N 293 SER OG O N N 294 SER OXT O N N 295 SER H H N N 296 SER H2 H N N 297 SER HA H N N 298 SER HB2 H N N 299 SER HB3 H N N 300 SER HG H N N 301 SER HXT H N N 302 THR N N N N 303 THR CA C N S 304 THR C C N N 305 THR O O N N 306 THR CB C N R 307 THR OG1 O N N 308 THR CG2 C N N 309 THR OXT O N N 310 THR H H N N 311 THR H2 H N N 312 THR HA H N N 313 THR HB H N N 314 THR HG1 H N N 315 THR HG21 H N N 316 THR HG22 H N N 317 THR HG23 H N N 318 THR HXT H N N 319 TYR N N N N 320 TYR CA C N S 321 TYR C C N N 322 TYR O O N N 323 TYR CB C N N 324 TYR CG C Y N 325 TYR CD1 C Y N 326 TYR CD2 C Y N 327 TYR CE1 C Y N 328 TYR CE2 C Y N 329 TYR CZ C Y N 330 TYR OH O N N 331 TYR OXT O N N 332 TYR H H N N 333 TYR H2 H N N 334 TYR HA H N N 335 TYR HB2 H N N 336 TYR HB3 H N N 337 TYR HD1 H N N 338 TYR HD2 H N N 339 TYR HE1 H N N 340 TYR HE2 H N N 341 TYR HH H N N 342 TYR HXT H N N 343 VAL N N N N 344 VAL CA C N S 345 VAL C C N N 346 VAL O O N N 347 VAL CB C N N 348 VAL CG1 C N N 349 VAL CG2 C N N 350 VAL OXT O N N 351 VAL H H N N 352 VAL H2 H N N 353 VAL HA H N N 354 VAL HB H N N 355 VAL HG11 H N N 356 VAL HG12 H N N 357 VAL HG13 H N N 358 VAL HG21 H N N 359 VAL HG22 H N N 360 VAL HG23 H N N 361 VAL HXT H N N 362 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 PHE N CA sing N N 218 PHE N H sing N N 219 PHE N H2 sing N N 220 PHE CA C sing N N 221 PHE CA CB sing N N 222 PHE CA HA sing N N 223 PHE C O doub N N 224 PHE C OXT sing N N 225 PHE CB CG sing N N 226 PHE CB HB2 sing N N 227 PHE CB HB3 sing N N 228 PHE CG CD1 doub Y N 229 PHE CG CD2 sing Y N 230 PHE CD1 CE1 sing Y N 231 PHE CD1 HD1 sing N N 232 PHE CD2 CE2 doub Y N 233 PHE CD2 HD2 sing N N 234 PHE CE1 CZ doub Y N 235 PHE CE1 HE1 sing N N 236 PHE CE2 CZ sing Y N 237 PHE CE2 HE2 sing N N 238 PHE CZ HZ sing N N 239 PHE OXT HXT sing N N 240 PRO N CA sing N N 241 PRO N CD sing N N 242 PRO N H sing N N 243 PRO CA C sing N N 244 PRO CA CB sing N N 245 PRO CA HA sing N N 246 PRO C O doub N N 247 PRO C OXT sing N N 248 PRO CB CG sing N N 249 PRO CB HB2 sing N N 250 PRO CB HB3 sing N N 251 PRO CG CD sing N N 252 PRO CG HG2 sing N N 253 PRO CG HG3 sing N N 254 PRO CD HD2 sing N N 255 PRO CD HD3 sing N N 256 PRO OXT HXT sing N N 257 SEP N CA sing N N 258 SEP N H sing N N 259 SEP N H2 sing N N 260 SEP CA CB sing N N 261 SEP CA C sing N N 262 SEP CA HA sing N N 263 SEP CB OG sing N N 264 SEP CB HB2 sing N N 265 SEP CB HB3 sing N N 266 SEP OG P sing N N 267 SEP C O doub N N 268 SEP C OXT sing N N 269 SEP OXT HXT sing N N 270 SEP P O1P doub N N 271 SEP P O2P sing N N 272 SEP P O3P sing N N 273 SEP O2P HOP2 sing N N 274 SEP O3P HOP3 sing N N 275 SER N CA sing N N 276 SER N H sing N N 277 SER N H2 sing N N 278 SER CA C sing N N 279 SER CA CB sing N N 280 SER CA HA sing N N 281 SER C O doub N N 282 SER C OXT sing N N 283 SER CB OG sing N N 284 SER CB HB2 sing N N 285 SER CB HB3 sing N N 286 SER OG HG sing N N 287 SER OXT HXT sing N N 288 THR N CA sing N N 289 THR N H sing N N 290 THR N H2 sing N N 291 THR CA C sing N N 292 THR CA CB sing N N 293 THR CA HA sing N N 294 THR C O doub N N 295 THR C OXT sing N N 296 THR CB OG1 sing N N 297 THR CB CG2 sing N N 298 THR CB HB sing N N 299 THR OG1 HG1 sing N N 300 THR CG2 HG21 sing N N 301 THR CG2 HG22 sing N N 302 THR CG2 HG23 sing N N 303 THR OXT HXT sing N N 304 TYR N CA sing N N 305 TYR N H sing N N 306 TYR N H2 sing N N 307 TYR CA C sing N N 308 TYR CA CB sing N N 309 TYR CA HA sing N N 310 TYR C O doub N N 311 TYR C OXT sing N N 312 TYR CB CG sing N N 313 TYR CB HB2 sing N N 314 TYR CB HB3 sing N N 315 TYR CG CD1 doub Y N 316 TYR CG CD2 sing Y N 317 TYR CD1 CE1 sing Y N 318 TYR CD1 HD1 sing N N 319 TYR CD2 CE2 doub Y N 320 TYR CD2 HD2 sing N N 321 TYR CE1 CZ doub Y N 322 TYR CE1 HE1 sing N N 323 TYR CE2 CZ sing Y N 324 TYR CE2 HE2 sing N N 325 TYR CZ OH sing N N 326 TYR OH HH sing N N 327 TYR OXT HXT sing N N 328 VAL N CA sing N N 329 VAL N H sing N N 330 VAL N H2 sing N N 331 VAL CA C sing N N 332 VAL CA CB sing N N 333 VAL CA HA sing N N 334 VAL C O doub N N 335 VAL C OXT sing N N 336 VAL CB CG1 sing N N 337 VAL CB CG2 sing N N 338 VAL CB HB sing N N 339 VAL CG1 HG11 sing N N 340 VAL CG1 HG12 sing N N 341 VAL CG1 HG13 sing N N 342 VAL CG2 HG21 sing N N 343 VAL CG2 HG22 sing N N 344 VAL CG2 HG23 sing N N 345 VAL OXT HXT sing N N 346 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Health and Medical Research Council (NHMRC, Australia)' Australia APP1041929 1 'National Health and Medical Research Council (NHMRC, Australia)' Australia APP1058734 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4Z8J _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5EMA _atom_sites.fract_transf_matrix[1][1] 0.026903 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020623 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017784 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P # loop_