data_5ER5 # _entry.id 5ER5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ER5 pdb_00005er5 10.2210/pdb5er5/pdb WWPDB D_1000215386 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '5ER4 contains the same protein complexed with SC0025' 5ER4 unspecified PDB '5DKR contains the same protein complexed with SBi29' 5DKR unspecified PDB '4PEZ contains the same protein complexed with SC1982' 4PEZ unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ER5 _pdbx_database_status.recvd_initial_deposition_date 2015-11-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cavalier, M.C.' 1 'Melville, Z.E.' 2 'Aligholizadeh, E.' 3 'Fang, L.' 4 'Alasady, M.J.' 5 'Pierce, A.D.' 6 'Wilder, P.T.' 7 'MacKerell Jr., A.D.' 8 'Weber, D.J.' 9 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 72 _citation.language ? _citation.page_first 753 _citation.page_last 760 _citation.title 'Novel protein-inhibitor interactions in site 3 of Ca(2+)-bound S100B as discovered by X-ray crystallography.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798316005532 _citation.pdbx_database_id_PubMed 27303795 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cavalier, M.C.' 1 ? primary 'Melville, Z.' 2 ? primary 'Aligholizadeh, E.' 3 ? primary 'Raman, E.P.' 4 ? primary 'Yu, W.' 5 ? primary 'Fang, L.' 6 ? primary 'Alasady, M.' 7 ? primary 'Pierce, A.D.' 8 ? primary 'Wilder, P.T.' 9 ? primary 'MacKerell, A.D.' 10 ? primary 'Weber, D.J.' 11 ? # _cell.length_a 35.418 _cell.length_b 88.279 _cell.length_c 59.114 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 5ER5 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.entry_id 5ER5 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein S100-B' 10681.974 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 non-polymer syn ETHIDIUM 314.404 1 ? ? ? ? 4 water nat water 18.015 158 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'S-100 protein beta chain,S-100 protein subunit beta,S100 calcium-binding protein B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM ITTACHEFFEHE ; _entity_poly.pdbx_seq_one_letter_code_can ;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM ITTACHEFFEHE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 LEU n 1 5 GLU n 1 6 LYS n 1 7 ALA n 1 8 VAL n 1 9 VAL n 1 10 ALA n 1 11 LEU n 1 12 ILE n 1 13 ASP n 1 14 VAL n 1 15 PHE n 1 16 HIS n 1 17 GLN n 1 18 TYR n 1 19 SER n 1 20 GLY n 1 21 ARG n 1 22 GLU n 1 23 GLY n 1 24 ASP n 1 25 LYS n 1 26 HIS n 1 27 LYS n 1 28 LEU n 1 29 LYS n 1 30 LYS n 1 31 SER n 1 32 GLU n 1 33 LEU n 1 34 LYS n 1 35 GLU n 1 36 LEU n 1 37 ILE n 1 38 ASN n 1 39 ASN n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 HIS n 1 44 PHE n 1 45 LEU n 1 46 GLU n 1 47 GLU n 1 48 ILE n 1 49 LYS n 1 50 GLU n 1 51 GLN n 1 52 GLU n 1 53 VAL n 1 54 VAL n 1 55 ASP n 1 56 LYS n 1 57 VAL n 1 58 MET n 1 59 GLU n 1 60 THR n 1 61 LEU n 1 62 ASP n 1 63 SER n 1 64 ASP n 1 65 GLY n 1 66 ASP n 1 67 GLY n 1 68 GLU n 1 69 CYS n 1 70 ASP n 1 71 PHE n 1 72 GLN n 1 73 GLU n 1 74 PHE n 1 75 MET n 1 76 ALA n 1 77 PHE n 1 78 VAL n 1 79 ALA n 1 80 MET n 1 81 ILE n 1 82 THR n 1 83 THR n 1 84 ALA n 1 85 CYS n 1 86 HIS n 1 87 GLU n 1 88 PHE n 1 89 PHE n 1 90 GLU n 1 91 HIS n 1 92 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 92 _entity_src_gen.gene_src_common_name Bovine _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene S100B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.db_code S100B_BOVIN _struct_ref.db_name UNP _struct_ref.details ? _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.seq_align ? _struct_ref.seq_dif ? _struct_ref.pdbx_db_accession P02638 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM ITTACHEFFEHE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_align_end ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ER5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02638 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 ET non-polymer . ETHIDIUM ? 'C21 H20 N3 1' 314.404 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ER5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.16 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.13 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG 3,350; 0.1M Hepes, pH7.0; 5% Glycerol; 7.5mM CaCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.12710 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL7-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.12710 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL7-1 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.d_resolution_high 1.260 _reflns.d_resolution_low 35.370 _reflns.pdbx_number_measured_all 173942 _reflns.number_obs 25238 _reflns.pdbx_Rmerge_I_obs 0.033 _reflns.pdbx_netI_over_sigmaI 28.700 _reflns.pdbx_redundancy 6.900 _reflns.percent_possible_obs 99.100 _reflns.pdbx_Rrim_I_all 0.036 _reflns.pdbx_Rpim_I_all 0.014 _reflns.pdbx_CC_half 1.000 _reflns.B_iso_Wilson_estimate 14.990 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 5ER5 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 1.260 1.280 ? 6301 ? 0 1.038 ? ? ? 5.400 ? 1.600 ? 1172 ? ? ? ? 94.300 1.150 0.485 0.531 1 2 6.900 35.370 ? 1060 ? 0 0.026 ? ? ? 5.700 ? 93.000 ? 187 ? ? ? ? 99.500 0.029 0.012 0.999 # _refine.entry_id 5ER5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 1.2600 _refine.ls_d_res_low 35.3680 _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.9100 _refine.ls_number_reflns_obs 25218 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1551 _refine.ls_R_factor_R_work 0.1524 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.1868 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 7.9300 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_reflns_R_work 23218 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 20.6095 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.1000 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 1MHO _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 58.480 _refine.B_iso_min 10.380 _refine.pdbx_overall_phase_error 17.9100 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.2600 _refine_hist.d_res_low 35.3680 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 158 _refine_hist.number_atoms_total 911 _refine_hist.pdbx_number_residues_total 90 _refine_hist.pdbx_B_iso_mean_ligand 19.93 _refine_hist.pdbx_B_iso_mean_solvent 35.58 _refine_hist.pdbx_number_atoms_protein 727 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 765 0.009 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 1026 1.018 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 108 0.376 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 131 0.005 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 282 20.109 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_obs 1.2597 1.2912 14 95.0000 1550 . 0.2366 0.2837 . 133 . 1683 . 'X-RAY DIFFRACTION' . 1.2912 1.3261 14 98.0000 1635 . 0.2007 0.2488 . 141 . 1776 . 'X-RAY DIFFRACTION' . 1.3261 1.3651 14 98.0000 1621 . 0.1842 0.2194 . 140 . 1761 . 'X-RAY DIFFRACTION' . 1.3651 1.4092 14 98.0000 1619 . 0.1625 0.2056 . 139 . 1758 . 'X-RAY DIFFRACTION' . 1.4092 1.4595 14 99.0000 1648 . 0.1524 0.2311 . 143 . 1791 . 'X-RAY DIFFRACTION' . 1.4595 1.5180 14 99.0000 1653 . 0.1288 0.1750 . 142 . 1795 . 'X-RAY DIFFRACTION' . 1.5180 1.5871 14 99.0000 1640 . 0.1204 0.1532 . 141 . 1781 . 'X-RAY DIFFRACTION' . 1.5871 1.6707 14 99.0000 1647 . 0.1148 0.1829 . 142 . 1789 . 'X-RAY DIFFRACTION' . 1.6707 1.7754 14 100.0000 1675 . 0.1266 0.1680 . 144 . 1819 . 'X-RAY DIFFRACTION' . 1.7754 1.9125 14 100.0000 1653 . 0.1237 0.1888 . 143 . 1796 . 'X-RAY DIFFRACTION' . 1.9125 2.1049 14 100.0000 1684 . 0.1238 0.1579 . 145 . 1829 . 'X-RAY DIFFRACTION' . 2.1049 2.4094 14 100.0000 1684 . 0.1266 0.1584 . 145 . 1829 . 'X-RAY DIFFRACTION' . 2.4094 3.0354 14 100.0000 1718 . 0.1578 0.1720 . 148 . 1866 . 'X-RAY DIFFRACTION' . 3.0354 35.3817 14 100.0000 1791 . 0.1786 0.2054 . 154 . 1945 . 'X-RAY DIFFRACTION' . # _struct.entry_id 5ER5 _struct.title 'Crystal Structure of Calcium-loaded S100B bound to SC1990' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5ER5 _struct_keywords.text 'malignant melanoma, calcium binding, complex, covalent inhibitor, METAL BINDING PROTEIN-INHIBITOR complex' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? GLY A 20 ? SER A 1 GLY A 19 1 ? 19 HELX_P HELX_P2 AA2 LYS A 29 ? LEU A 41 ? LYS A 28 LEU A 40 1 ? 13 HELX_P HELX_P3 AA3 GLU A 50 ? ASP A 62 ? GLU A 49 ASP A 61 1 ? 13 HELX_P HELX_P4 AA4 ASP A 70 ? GLU A 90 ? ASP A 69 GLU A 89 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 19 O ? ? ? 1_555 B CA . CA ? ? A SER 18 A CA 101 1_555 ? ? ? ? ? ? ? 2.382 ? ? metalc2 metalc ? ? A GLU 22 O ? ? ? 1_555 B CA . CA ? ? A GLU 21 A CA 101 1_555 ? ? ? ? ? ? ? 2.445 ? ? metalc3 metalc ? ? A ASP 24 O ? ? ? 1_555 B CA . CA ? ? A ASP 23 A CA 101 1_555 ? ? ? ? ? ? ? 2.376 ? ? metalc4 metalc ? ? A LYS 27 O ? ? ? 1_555 B CA . CA ? ? A LYS 26 A CA 101 1_555 ? ? ? ? ? ? ? 2.439 ? ? metalc5 metalc ? ? A GLU 32 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 101 1_555 ? ? ? ? ? ? ? 2.431 ? ? metalc6 metalc ? ? A GLU 32 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 101 1_555 ? ? ? ? ? ? ? 2.515 ? ? metalc7 metalc ? ? A ASP 62 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 61 A CA 102 1_555 ? ? ? ? ? ? ? 2.311 ? ? metalc8 metalc ? ? A ASP 64 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 63 A CA 102 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc9 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 65 A CA 102 1_555 ? ? ? ? ? ? ? 2.383 ? ? metalc10 metalc ? ? A GLU 68 O ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 102 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc11 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 72 A CA 102 1_555 ? ? ? ? ? ? ? 2.404 ? ? metalc12 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 72 A CA 102 1_555 ? ? ? ? ? ? ? 2.597 ? ? metalc13 metalc ? ? B CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 101 A HOH 216 1_555 ? ? ? ? ? ? ? 2.349 ? ? metalc14 metalc ? ? C CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 102 A HOH 252 1_555 ? ? ? ? ? ? ? 2.414 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 101 ? 6 'binding site for residue CA A 101' AC2 Software A CA 102 ? 6 'binding site for residue CA A 102' AC3 Software A ET 103 ? 12 'binding site for residue ET A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER A 19 ? SER A 18 . ? 1_555 ? 2 AC1 6 GLU A 22 ? GLU A 21 . ? 1_555 ? 3 AC1 6 ASP A 24 ? ASP A 23 . ? 1_555 ? 4 AC1 6 LYS A 27 ? LYS A 26 . ? 1_555 ? 5 AC1 6 GLU A 32 ? GLU A 31 . ? 1_555 ? 6 AC1 6 HOH E . ? HOH A 216 . ? 1_555 ? 7 AC2 6 ASP A 62 ? ASP A 61 . ? 1_555 ? 8 AC2 6 ASP A 64 ? ASP A 63 . ? 1_555 ? 9 AC2 6 ASP A 66 ? ASP A 65 . ? 1_555 ? 10 AC2 6 GLU A 68 ? GLU A 67 . ? 1_555 ? 11 AC2 6 GLU A 73 ? GLU A 72 . ? 1_555 ? 12 AC2 6 HOH E . ? HOH A 252 . ? 1_555 ? 13 AC3 12 ILE A 12 ? ILE A 11 . ? 2_555 ? 14 AC3 12 ASP A 13 ? ASP A 12 . ? 2_555 ? 15 AC3 12 ASP A 13 ? ASP A 12 . ? 4_555 ? 16 AC3 12 HIS A 16 ? HIS A 15 . ? 4_555 ? 17 AC3 12 HIS A 16 ? HIS A 15 . ? 2_555 ? 18 AC3 12 HIS A 26 ? HIS A 25 . ? 4_555 ? 19 AC3 12 PHE A 89 ? PHE A 88 . ? 3_555 ? 20 AC3 12 PHE A 89 ? PHE A 88 . ? 1_555 ? 21 AC3 12 GLU A 90 ? GLU A 89 . ? 3_555 ? 22 AC3 12 GLU A 90 ? GLU A 89 . ? 1_555 ? 23 AC3 12 HOH E . ? HOH A 260 . ? 4_555 ? 24 AC3 12 HOH E . ? HOH A 260 . ? 2_555 ? # _atom_sites.entry_id 5ER5 _atom_sites.fract_transf_matrix[1][1] 0.028234 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011328 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016916 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 GLU 3 2 2 GLU GLU A . n A 1 4 LEU 4 3 3 LEU LEU A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 ALA 7 6 6 ALA ALA A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 ALA 10 9 9 ALA ALA A . n A 1 11 LEU 11 10 10 LEU LEU A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 ASP 13 12 12 ASP ASP A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 PHE 15 14 14 PHE PHE A . n A 1 16 HIS 16 15 15 HIS HIS A . n A 1 17 GLN 17 16 16 GLN GLN A . n A 1 18 TYR 18 17 17 TYR TYR A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 GLY 20 19 19 GLY GLY A . n A 1 21 ARG 21 20 20 ARG ARG A . n A 1 22 GLU 22 21 21 GLU GLU A . n A 1 23 GLY 23 22 22 GLY GLY A . n A 1 24 ASP 24 23 23 ASP ASP A . n A 1 25 LYS 25 24 24 LYS LYS A . n A 1 26 HIS 26 25 25 HIS HIS A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 SER 31 30 30 SER SER A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 LYS 34 33 33 LYS LYS A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 ASN 38 37 37 ASN ASN A . n A 1 39 ASN 39 38 38 ASN ASN A . n A 1 40 GLU 40 39 39 GLU GLU A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 SER 42 41 41 SER SER A . n A 1 43 HIS 43 42 42 HIS HIS A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 GLU 46 45 45 GLU GLU A . n A 1 47 GLU 47 46 46 GLU GLU A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 GLN 51 50 50 GLN GLN A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 VAL 53 52 52 VAL VAL A . n A 1 54 VAL 54 53 53 VAL VAL A . n A 1 55 ASP 55 54 54 ASP ASP A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 VAL 57 56 56 VAL VAL A . n A 1 58 MET 58 57 57 MET MET A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 ASP 62 61 61 ASP ASP A . n A 1 63 SER 63 62 62 SER SER A . n A 1 64 ASP 64 63 63 ASP ASP A . n A 1 65 GLY 65 64 64 GLY GLY A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 GLY 67 66 66 GLY GLY A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 CYS 69 68 68 CYS CYS A . n A 1 70 ASP 70 69 69 ASP ASP A . n A 1 71 PHE 71 70 70 PHE PHE A . n A 1 72 GLN 72 71 71 GLN GLN A . n A 1 73 GLU 73 72 72 GLU GLU A . n A 1 74 PHE 74 73 73 PHE PHE A . n A 1 75 MET 75 74 74 MET MET A . n A 1 76 ALA 76 75 75 ALA ALA A . n A 1 77 PHE 77 76 76 PHE PHE A . n A 1 78 VAL 78 77 77 VAL VAL A . n A 1 79 ALA 79 78 78 ALA ALA A . n A 1 80 MET 80 79 79 MET MET A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 THR 82 81 81 THR THR A . n A 1 83 THR 83 82 82 THR THR A . n A 1 84 ALA 84 83 83 ALA ALA A . n A 1 85 CYS 85 84 84 CYS CYS A . n A 1 86 HIS 86 85 85 HIS HIS A . n A 1 87 GLU 87 86 86 GLU GLU A . n A 1 88 PHE 88 87 87 PHE PHE A . n A 1 89 PHE 89 88 88 PHE PHE A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 HIS 91 90 ? ? ? A . n A 1 92 GLU 92 91 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 101 100 CA CA A . C 2 CA 1 102 101 CA CA A . D 3 ET 1 103 1 ET ET A . E 4 HOH 1 201 141 HOH HOH A . E 4 HOH 2 202 126 HOH HOH A . E 4 HOH 3 203 105 HOH HOH A . E 4 HOH 4 204 162 HOH HOH A . E 4 HOH 5 205 84 HOH HOH A . E 4 HOH 6 206 54 HOH HOH A . E 4 HOH 7 207 81 HOH HOH A . E 4 HOH 8 208 43 HOH HOH A . E 4 HOH 9 209 122 HOH HOH A . E 4 HOH 10 210 19 HOH HOH A . E 4 HOH 11 211 117 HOH HOH A . E 4 HOH 12 212 58 HOH HOH A . E 4 HOH 13 213 60 HOH HOH A . E 4 HOH 14 214 36 HOH HOH A . E 4 HOH 15 215 22 HOH HOH A . E 4 HOH 16 216 2 HOH HOH A . E 4 HOH 17 217 69 HOH HOH A . E 4 HOH 18 218 75 HOH HOH A . E 4 HOH 19 219 49 HOH HOH A . E 4 HOH 20 220 18 HOH HOH A . E 4 HOH 21 221 85 HOH HOH A . E 4 HOH 22 222 149 HOH HOH A . E 4 HOH 23 223 131 HOH HOH A . E 4 HOH 24 224 64 HOH HOH A . E 4 HOH 25 225 68 HOH HOH A . E 4 HOH 26 226 44 HOH HOH A . E 4 HOH 27 227 42 HOH HOH A . E 4 HOH 28 228 160 HOH HOH A . E 4 HOH 29 229 4 HOH HOH A . E 4 HOH 30 230 35 HOH HOH A . E 4 HOH 31 231 48 HOH HOH A . E 4 HOH 32 232 41 HOH HOH A . E 4 HOH 33 233 14 HOH HOH A . E 4 HOH 34 234 114 HOH HOH A . E 4 HOH 35 235 6 HOH HOH A . E 4 HOH 36 236 100 HOH HOH A . E 4 HOH 37 237 59 HOH HOH A . E 4 HOH 38 238 21 HOH HOH A . E 4 HOH 39 239 53 HOH HOH A . E 4 HOH 40 240 12 HOH HOH A . E 4 HOH 41 241 31 HOH HOH A . E 4 HOH 42 242 13 HOH HOH A . E 4 HOH 43 243 11 HOH HOH A . E 4 HOH 44 244 170 HOH HOH A . E 4 HOH 45 245 90 HOH HOH A . E 4 HOH 46 246 32 HOH HOH A . E 4 HOH 47 247 17 HOH HOH A . E 4 HOH 48 248 101 HOH HOH A . E 4 HOH 49 249 93 HOH HOH A . E 4 HOH 50 250 8 HOH HOH A . E 4 HOH 51 251 174 HOH HOH A . E 4 HOH 52 252 7 HOH HOH A . E 4 HOH 53 253 9 HOH HOH A . E 4 HOH 54 254 24 HOH HOH A . E 4 HOH 55 255 5 HOH HOH A . E 4 HOH 56 256 30 HOH HOH A . E 4 HOH 57 257 51 HOH HOH A . E 4 HOH 58 258 102 HOH HOH A . E 4 HOH 59 259 95 HOH HOH A . E 4 HOH 60 260 137 HOH HOH A . E 4 HOH 61 261 97 HOH HOH A . E 4 HOH 62 262 166 HOH HOH A . E 4 HOH 63 263 20 HOH HOH A . E 4 HOH 64 264 23 HOH HOH A . E 4 HOH 65 265 47 HOH HOH A . E 4 HOH 66 266 135 HOH HOH A . E 4 HOH 67 267 144 HOH HOH A . E 4 HOH 68 268 3 HOH HOH A . E 4 HOH 69 269 46 HOH HOH A . E 4 HOH 70 270 89 HOH HOH A . E 4 HOH 71 271 25 HOH HOH A . E 4 HOH 72 272 107 HOH HOH A . E 4 HOH 73 273 63 HOH HOH A . E 4 HOH 74 274 171 HOH HOH A . E 4 HOH 75 275 34 HOH HOH A . E 4 HOH 76 276 177 HOH HOH A . E 4 HOH 77 277 99 HOH HOH A . E 4 HOH 78 278 16 HOH HOH A . E 4 HOH 79 279 173 HOH HOH A . E 4 HOH 80 280 125 HOH HOH A . E 4 HOH 81 281 10 HOH HOH A . E 4 HOH 82 282 27 HOH HOH A . E 4 HOH 83 283 45 HOH HOH A . E 4 HOH 84 284 104 HOH HOH A . E 4 HOH 85 285 28 HOH HOH A . E 4 HOH 86 286 124 HOH HOH A . E 4 HOH 87 287 65 HOH HOH A . E 4 HOH 88 288 139 HOH HOH A . E 4 HOH 89 289 152 HOH HOH A . E 4 HOH 90 290 15 HOH HOH A . E 4 HOH 91 291 92 HOH HOH A . E 4 HOH 92 292 33 HOH HOH A . E 4 HOH 93 293 55 HOH HOH A . E 4 HOH 94 294 98 HOH HOH A . E 4 HOH 95 295 175 HOH HOH A . E 4 HOH 96 296 106 HOH HOH A . E 4 HOH 97 297 119 HOH HOH A . E 4 HOH 98 298 148 HOH HOH A . E 4 HOH 99 299 37 HOH HOH A . E 4 HOH 100 300 159 HOH HOH A . E 4 HOH 101 301 169 HOH HOH A . E 4 HOH 102 302 103 HOH HOH A . E 4 HOH 103 303 154 HOH HOH A . E 4 HOH 104 304 179 HOH HOH A . E 4 HOH 105 305 178 HOH HOH A . E 4 HOH 106 306 88 HOH HOH A . E 4 HOH 107 307 165 HOH HOH A . E 4 HOH 108 308 73 HOH HOH A . E 4 HOH 109 309 38 HOH HOH A . E 4 HOH 110 310 176 HOH HOH A . E 4 HOH 111 311 72 HOH HOH A . E 4 HOH 112 312 133 HOH HOH A . E 4 HOH 113 313 123 HOH HOH A . E 4 HOH 114 314 66 HOH HOH A . E 4 HOH 115 315 134 HOH HOH A . E 4 HOH 116 316 94 HOH HOH A . E 4 HOH 117 317 61 HOH HOH A . E 4 HOH 118 318 91 HOH HOH A . E 4 HOH 119 319 155 HOH HOH A . E 4 HOH 120 320 70 HOH HOH A . E 4 HOH 121 321 26 HOH HOH A . E 4 HOH 122 322 121 HOH HOH A . E 4 HOH 123 323 136 HOH HOH A . E 4 HOH 124 324 150 HOH HOH A . E 4 HOH 125 325 116 HOH HOH A . E 4 HOH 126 326 80 HOH HOH A . E 4 HOH 127 327 77 HOH HOH A . E 4 HOH 128 328 57 HOH HOH A . E 4 HOH 129 329 172 HOH HOH A . E 4 HOH 130 330 151 HOH HOH A . E 4 HOH 131 331 109 HOH HOH A . E 4 HOH 132 332 87 HOH HOH A . E 4 HOH 133 333 108 HOH HOH A . E 4 HOH 134 334 52 HOH HOH A . E 4 HOH 135 335 113 HOH HOH A . E 4 HOH 136 336 127 HOH HOH A . E 4 HOH 137 337 115 HOH HOH A . E 4 HOH 138 338 143 HOH HOH A . E 4 HOH 139 339 118 HOH HOH A . E 4 HOH 140 340 138 HOH HOH A . E 4 HOH 141 341 74 HOH HOH A . E 4 HOH 142 342 111 HOH HOH A . E 4 HOH 143 343 130 HOH HOH A . E 4 HOH 144 344 83 HOH HOH A . E 4 HOH 145 345 39 HOH HOH A . E 4 HOH 146 346 40 HOH HOH A . E 4 HOH 147 347 96 HOH HOH A . E 4 HOH 148 348 145 HOH HOH A . E 4 HOH 149 349 140 HOH HOH A . E 4 HOH 150 350 112 HOH HOH A . E 4 HOH 151 351 71 HOH HOH A . E 4 HOH 152 352 50 HOH HOH A . E 4 HOH 153 353 161 HOH HOH A . E 4 HOH 154 354 29 HOH HOH A . E 4 HOH 155 355 156 HOH HOH A . E 4 HOH 156 356 82 HOH HOH A . E 4 HOH 157 357 79 HOH HOH A . E 4 HOH 158 358 146 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3650 ? 1 MORE -83 ? 1 'SSA (A^2)' 10150 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A GLU 22 ? A GLU 21 ? 1_555 102.5 ? 2 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 23 ? 1_555 84.2 ? 3 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 23 ? 1_555 84.1 ? 4 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 89.1 ? 5 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 159.4 ? 6 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 80.2 ? 7 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 100.0 ? 8 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 117.6 ? 9 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 155.9 ? 10 O ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 76.2 ? 11 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 81.2 ? 12 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 75.2 ? 13 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 151.2 ? 14 O ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 123.9 ? 15 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 52.1 ? 16 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 216 ? 1_555 169.7 ? 17 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 216 ? 1_555 82.5 ? 18 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 216 ? 1_555 87.5 ? 19 O ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 216 ? 1_555 83.6 ? 20 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 216 ? 1_555 85.2 ? 21 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 216 ? 1_555 108.9 ? 22 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 82.9 ? 23 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 88.5 ? 24 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 79.7 ? 25 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 84.4 ? 26 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 155.5 ? 27 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 79.0 ? 28 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 109.4 ? 29 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 125.0 ? 30 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 150.0 ? 31 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 79.1 ? 32 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 89.4 ? 33 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 76.4 ? 34 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 156.2 ? 35 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 124.4 ? 36 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 51.4 ? 37 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 252 ? 1_555 166.7 ? 38 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 252 ? 1_555 87.9 ? 39 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 252 ? 1_555 80.3 ? 40 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 252 ? 1_555 100.4 ? 41 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 252 ? 1_555 83.8 ? 42 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 252 ? 1_555 97.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-08 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2018-04-18 4 'Structure model' 1 3 2019-12-04 5 'Structure model' 1 4 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_struct_oper_list 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' pdbx_audit_support 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 3 'Structure model' '_citation.country' 4 3 'Structure model' '_citation.journal_abbrev' 5 3 'Structure model' '_citation.journal_id_ASTM' 6 3 'Structure model' '_citation.journal_id_ISSN' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.pdbx_database_id_PubMed' 9 3 'Structure model' '_citation.title' 10 4 'Structure model' '_pdbx_audit_support.funding_organization' 11 5 'Structure model' '_database_2.pdbx_DOI' 12 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.1.26 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 86 ? ? O A HOH 201 ? ? 2.01 2 1 OE1 A GLU 89 ? ? O A HOH 202 ? ? 2.04 3 1 O A HOH 341 ? ? O A HOH 354 ? ? 2.04 4 1 O A HOH 300 ? ? O A HOH 303 ? ? 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 310 ? ? 1_555 O A HOH 327 ? ? 4_555 1.91 2 1 O A HOH 214 ? ? 1_555 O A HOH 214 ? ? 3_554 1.94 3 1 O A HOH 202 ? ? 1_555 O A HOH 304 ? ? 4_555 1.95 4 1 O A HOH 346 ? ? 1_555 O A HOH 346 ? ? 3_554 2.01 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 VAL _pdbx_validate_rmsd_bond.auth_seq_id_1 13 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CG1 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 VAL _pdbx_validate_rmsd_bond.auth_seq_id_2 13 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.383 _pdbx_validate_rmsd_bond.bond_target_value 1.524 _pdbx_validate_rmsd_bond.bond_deviation -0.141 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.021 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 356 ? 5.91 . 2 1 O ? A HOH 357 ? 6.54 . 3 1 O ? A HOH 358 ? 6.89 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 90 ? A HIS 91 2 1 Y 1 A GLU 91 ? A GLU 92 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 ET C1 C Y N 89 ET C2 C Y N 90 ET C3 C Y N 91 ET C4 C Y N 92 ET N5 N Y N 93 ET C6 C Y N 94 ET C7 C Y N 95 ET C8 C Y N 96 ET C9 C Y N 97 ET C10 C Y N 98 ET C11 C Y N 99 ET C12 C Y N 100 ET C13 C Y N 101 ET C14 C Y N 102 ET C15 C Y N 103 ET C16 C Y N 104 ET C17 C Y N 105 ET C18 C Y N 106 ET C19 C Y N 107 ET C20 C Y N 108 ET C21 C N N 109 ET C22 C N N 110 ET N23 N N N 111 ET N24 N N N 112 ET H1 H N N 113 ET H2 H N N 114 ET H4 H N N 115 ET H7 H N N 116 ET H9 H N N 117 ET H10 H N N 118 ET H16 H N N 119 ET H17 H N N 120 ET H18 H N N 121 ET H19 H N N 122 ET H20 H N N 123 ET H211 H N N 124 ET H212 H N N 125 ET H221 H N N 126 ET H222 H N N 127 ET H223 H N N 128 ET H231 H N N 129 ET H232 H N N 130 ET H241 H N N 131 ET H242 H N N 132 GLN N N N N 133 GLN CA C N S 134 GLN C C N N 135 GLN O O N N 136 GLN CB C N N 137 GLN CG C N N 138 GLN CD C N N 139 GLN OE1 O N N 140 GLN NE2 N N N 141 GLN OXT O N N 142 GLN H H N N 143 GLN H2 H N N 144 GLN HA H N N 145 GLN HB2 H N N 146 GLN HB3 H N N 147 GLN HG2 H N N 148 GLN HG3 H N N 149 GLN HE21 H N N 150 GLN HE22 H N N 151 GLN HXT H N N 152 GLU N N N N 153 GLU CA C N S 154 GLU C C N N 155 GLU O O N N 156 GLU CB C N N 157 GLU CG C N N 158 GLU CD C N N 159 GLU OE1 O N N 160 GLU OE2 O N N 161 GLU OXT O N N 162 GLU H H N N 163 GLU H2 H N N 164 GLU HA H N N 165 GLU HB2 H N N 166 GLU HB3 H N N 167 GLU HG2 H N N 168 GLU HG3 H N N 169 GLU HE2 H N N 170 GLU HXT H N N 171 GLY N N N N 172 GLY CA C N N 173 GLY C C N N 174 GLY O O N N 175 GLY OXT O N N 176 GLY H H N N 177 GLY H2 H N N 178 GLY HA2 H N N 179 GLY HA3 H N N 180 GLY HXT H N N 181 HIS N N N N 182 HIS CA C N S 183 HIS C C N N 184 HIS O O N N 185 HIS CB C N N 186 HIS CG C Y N 187 HIS ND1 N Y N 188 HIS CD2 C Y N 189 HIS CE1 C Y N 190 HIS NE2 N Y N 191 HIS OXT O N N 192 HIS H H N N 193 HIS H2 H N N 194 HIS HA H N N 195 HIS HB2 H N N 196 HIS HB3 H N N 197 HIS HD1 H N N 198 HIS HD2 H N N 199 HIS HE1 H N N 200 HIS HE2 H N N 201 HIS HXT H N N 202 HOH O O N N 203 HOH H1 H N N 204 HOH H2 H N N 205 ILE N N N N 206 ILE CA C N S 207 ILE C C N N 208 ILE O O N N 209 ILE CB C N S 210 ILE CG1 C N N 211 ILE CG2 C N N 212 ILE CD1 C N N 213 ILE OXT O N N 214 ILE H H N N 215 ILE H2 H N N 216 ILE HA H N N 217 ILE HB H N N 218 ILE HG12 H N N 219 ILE HG13 H N N 220 ILE HG21 H N N 221 ILE HG22 H N N 222 ILE HG23 H N N 223 ILE HD11 H N N 224 ILE HD12 H N N 225 ILE HD13 H N N 226 ILE HXT H N N 227 LEU N N N N 228 LEU CA C N S 229 LEU C C N N 230 LEU O O N N 231 LEU CB C N N 232 LEU CG C N N 233 LEU CD1 C N N 234 LEU CD2 C N N 235 LEU OXT O N N 236 LEU H H N N 237 LEU H2 H N N 238 LEU HA H N N 239 LEU HB2 H N N 240 LEU HB3 H N N 241 LEU HG H N N 242 LEU HD11 H N N 243 LEU HD12 H N N 244 LEU HD13 H N N 245 LEU HD21 H N N 246 LEU HD22 H N N 247 LEU HD23 H N N 248 LEU HXT H N N 249 LYS N N N N 250 LYS CA C N S 251 LYS C C N N 252 LYS O O N N 253 LYS CB C N N 254 LYS CG C N N 255 LYS CD C N N 256 LYS CE C N N 257 LYS NZ N N N 258 LYS OXT O N N 259 LYS H H N N 260 LYS H2 H N N 261 LYS HA H N N 262 LYS HB2 H N N 263 LYS HB3 H N N 264 LYS HG2 H N N 265 LYS HG3 H N N 266 LYS HD2 H N N 267 LYS HD3 H N N 268 LYS HE2 H N N 269 LYS HE3 H N N 270 LYS HZ1 H N N 271 LYS HZ2 H N N 272 LYS HZ3 H N N 273 LYS HXT H N N 274 MET N N N N 275 MET CA C N S 276 MET C C N N 277 MET O O N N 278 MET CB C N N 279 MET CG C N N 280 MET SD S N N 281 MET CE C N N 282 MET OXT O N N 283 MET H H N N 284 MET H2 H N N 285 MET HA H N N 286 MET HB2 H N N 287 MET HB3 H N N 288 MET HG2 H N N 289 MET HG3 H N N 290 MET HE1 H N N 291 MET HE2 H N N 292 MET HE3 H N N 293 MET HXT H N N 294 PHE N N N N 295 PHE CA C N S 296 PHE C C N N 297 PHE O O N N 298 PHE CB C N N 299 PHE CG C Y N 300 PHE CD1 C Y N 301 PHE CD2 C Y N 302 PHE CE1 C Y N 303 PHE CE2 C Y N 304 PHE CZ C Y N 305 PHE OXT O N N 306 PHE H H N N 307 PHE H2 H N N 308 PHE HA H N N 309 PHE HB2 H N N 310 PHE HB3 H N N 311 PHE HD1 H N N 312 PHE HD2 H N N 313 PHE HE1 H N N 314 PHE HE2 H N N 315 PHE HZ H N N 316 PHE HXT H N N 317 SER N N N N 318 SER CA C N S 319 SER C C N N 320 SER O O N N 321 SER CB C N N 322 SER OG O N N 323 SER OXT O N N 324 SER H H N N 325 SER H2 H N N 326 SER HA H N N 327 SER HB2 H N N 328 SER HB3 H N N 329 SER HG H N N 330 SER HXT H N N 331 THR N N N N 332 THR CA C N S 333 THR C C N N 334 THR O O N N 335 THR CB C N R 336 THR OG1 O N N 337 THR CG2 C N N 338 THR OXT O N N 339 THR H H N N 340 THR H2 H N N 341 THR HA H N N 342 THR HB H N N 343 THR HG1 H N N 344 THR HG21 H N N 345 THR HG22 H N N 346 THR HG23 H N N 347 THR HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 ET C1 C2 doub Y N 83 ET C1 C13 sing Y N 84 ET C1 H1 sing N N 85 ET C2 C3 sing Y N 86 ET C2 H2 sing N N 87 ET C3 C4 doub Y N 88 ET C3 N23 sing N N 89 ET C4 C14 sing Y N 90 ET C4 H4 sing N N 91 ET N5 C6 doub Y N 92 ET N5 C14 sing Y N 93 ET N5 C21 sing N N 94 ET C6 C11 sing Y N 95 ET C6 C15 sing Y N 96 ET C7 C8 doub Y N 97 ET C7 C11 sing Y N 98 ET C7 H7 sing N N 99 ET C8 C9 sing Y N 100 ET C8 N24 sing N N 101 ET C9 C10 doub Y N 102 ET C9 H9 sing N N 103 ET C10 C12 sing Y N 104 ET C10 H10 sing N N 105 ET C11 C12 doub Y N 106 ET C12 C13 sing Y N 107 ET C13 C14 doub Y N 108 ET C15 C16 doub Y N 109 ET C15 C20 sing Y N 110 ET C16 C17 sing Y N 111 ET C16 H16 sing N N 112 ET C17 C18 doub Y N 113 ET C17 H17 sing N N 114 ET C18 C19 sing Y N 115 ET C18 H18 sing N N 116 ET C19 C20 doub Y N 117 ET C19 H19 sing N N 118 ET C20 H20 sing N N 119 ET C21 C22 sing N N 120 ET C21 H211 sing N N 121 ET C21 H212 sing N N 122 ET C22 H221 sing N N 123 ET C22 H222 sing N N 124 ET C22 H223 sing N N 125 ET N23 H231 sing N N 126 ET N23 H232 sing N N 127 ET N24 H241 sing N N 128 ET N24 H242 sing N N 129 GLN N CA sing N N 130 GLN N H sing N N 131 GLN N H2 sing N N 132 GLN CA C sing N N 133 GLN CA CB sing N N 134 GLN CA HA sing N N 135 GLN C O doub N N 136 GLN C OXT sing N N 137 GLN CB CG sing N N 138 GLN CB HB2 sing N N 139 GLN CB HB3 sing N N 140 GLN CG CD sing N N 141 GLN CG HG2 sing N N 142 GLN CG HG3 sing N N 143 GLN CD OE1 doub N N 144 GLN CD NE2 sing N N 145 GLN NE2 HE21 sing N N 146 GLN NE2 HE22 sing N N 147 GLN OXT HXT sing N N 148 GLU N CA sing N N 149 GLU N H sing N N 150 GLU N H2 sing N N 151 GLU CA C sing N N 152 GLU CA CB sing N N 153 GLU CA HA sing N N 154 GLU C O doub N N 155 GLU C OXT sing N N 156 GLU CB CG sing N N 157 GLU CB HB2 sing N N 158 GLU CB HB3 sing N N 159 GLU CG CD sing N N 160 GLU CG HG2 sing N N 161 GLU CG HG3 sing N N 162 GLU CD OE1 doub N N 163 GLU CD OE2 sing N N 164 GLU OE2 HE2 sing N N 165 GLU OXT HXT sing N N 166 GLY N CA sing N N 167 GLY N H sing N N 168 GLY N H2 sing N N 169 GLY CA C sing N N 170 GLY CA HA2 sing N N 171 GLY CA HA3 sing N N 172 GLY C O doub N N 173 GLY C OXT sing N N 174 GLY OXT HXT sing N N 175 HIS N CA sing N N 176 HIS N H sing N N 177 HIS N H2 sing N N 178 HIS CA C sing N N 179 HIS CA CB sing N N 180 HIS CA HA sing N N 181 HIS C O doub N N 182 HIS C OXT sing N N 183 HIS CB CG sing N N 184 HIS CB HB2 sing N N 185 HIS CB HB3 sing N N 186 HIS CG ND1 sing Y N 187 HIS CG CD2 doub Y N 188 HIS ND1 CE1 doub Y N 189 HIS ND1 HD1 sing N N 190 HIS CD2 NE2 sing Y N 191 HIS CD2 HD2 sing N N 192 HIS CE1 NE2 sing Y N 193 HIS CE1 HE1 sing N N 194 HIS NE2 HE2 sing N N 195 HIS OXT HXT sing N N 196 HOH O H1 sing N N 197 HOH O H2 sing N N 198 ILE N CA sing N N 199 ILE N H sing N N 200 ILE N H2 sing N N 201 ILE CA C sing N N 202 ILE CA CB sing N N 203 ILE CA HA sing N N 204 ILE C O doub N N 205 ILE C OXT sing N N 206 ILE CB CG1 sing N N 207 ILE CB CG2 sing N N 208 ILE CB HB sing N N 209 ILE CG1 CD1 sing N N 210 ILE CG1 HG12 sing N N 211 ILE CG1 HG13 sing N N 212 ILE CG2 HG21 sing N N 213 ILE CG2 HG22 sing N N 214 ILE CG2 HG23 sing N N 215 ILE CD1 HD11 sing N N 216 ILE CD1 HD12 sing N N 217 ILE CD1 HD13 sing N N 218 ILE OXT HXT sing N N 219 LEU N CA sing N N 220 LEU N H sing N N 221 LEU N H2 sing N N 222 LEU CA C sing N N 223 LEU CA CB sing N N 224 LEU CA HA sing N N 225 LEU C O doub N N 226 LEU C OXT sing N N 227 LEU CB CG sing N N 228 LEU CB HB2 sing N N 229 LEU CB HB3 sing N N 230 LEU CG CD1 sing N N 231 LEU CG CD2 sing N N 232 LEU CG HG sing N N 233 LEU CD1 HD11 sing N N 234 LEU CD1 HD12 sing N N 235 LEU CD1 HD13 sing N N 236 LEU CD2 HD21 sing N N 237 LEU CD2 HD22 sing N N 238 LEU CD2 HD23 sing N N 239 LEU OXT HXT sing N N 240 LYS N CA sing N N 241 LYS N H sing N N 242 LYS N H2 sing N N 243 LYS CA C sing N N 244 LYS CA CB sing N N 245 LYS CA HA sing N N 246 LYS C O doub N N 247 LYS C OXT sing N N 248 LYS CB CG sing N N 249 LYS CB HB2 sing N N 250 LYS CB HB3 sing N N 251 LYS CG CD sing N N 252 LYS CG HG2 sing N N 253 LYS CG HG3 sing N N 254 LYS CD CE sing N N 255 LYS CD HD2 sing N N 256 LYS CD HD3 sing N N 257 LYS CE NZ sing N N 258 LYS CE HE2 sing N N 259 LYS CE HE3 sing N N 260 LYS NZ HZ1 sing N N 261 LYS NZ HZ2 sing N N 262 LYS NZ HZ3 sing N N 263 LYS OXT HXT sing N N 264 MET N CA sing N N 265 MET N H sing N N 266 MET N H2 sing N N 267 MET CA C sing N N 268 MET CA CB sing N N 269 MET CA HA sing N N 270 MET C O doub N N 271 MET C OXT sing N N 272 MET CB CG sing N N 273 MET CB HB2 sing N N 274 MET CB HB3 sing N N 275 MET CG SD sing N N 276 MET CG HG2 sing N N 277 MET CG HG3 sing N N 278 MET SD CE sing N N 279 MET CE HE1 sing N N 280 MET CE HE2 sing N N 281 MET CE HE3 sing N N 282 MET OXT HXT sing N N 283 PHE N CA sing N N 284 PHE N H sing N N 285 PHE N H2 sing N N 286 PHE CA C sing N N 287 PHE CA CB sing N N 288 PHE CA HA sing N N 289 PHE C O doub N N 290 PHE C OXT sing N N 291 PHE CB CG sing N N 292 PHE CB HB2 sing N N 293 PHE CB HB3 sing N N 294 PHE CG CD1 doub Y N 295 PHE CG CD2 sing Y N 296 PHE CD1 CE1 sing Y N 297 PHE CD1 HD1 sing N N 298 PHE CD2 CE2 doub Y N 299 PHE CD2 HD2 sing N N 300 PHE CE1 CZ doub Y N 301 PHE CE1 HE1 sing N N 302 PHE CE2 CZ sing Y N 303 PHE CE2 HE2 sing N N 304 PHE CZ HZ sing N N 305 PHE OXT HXT sing N N 306 SER N CA sing N N 307 SER N H sing N N 308 SER N H2 sing N N 309 SER CA C sing N N 310 SER CA CB sing N N 311 SER CA HA sing N N 312 SER C O doub N N 313 SER C OXT sing N N 314 SER CB OG sing N N 315 SER CB HB2 sing N N 316 SER CB HB3 sing N N 317 SER OG HG sing N N 318 SER OXT HXT sing N N 319 THR N CA sing N N 320 THR N H sing N N 321 THR N H2 sing N N 322 THR CA C sing N N 323 THR CA CB sing N N 324 THR CA HA sing N N 325 THR C O doub N N 326 THR C OXT sing N N 327 THR CB OG1 sing N N 328 THR CB CG2 sing N N 329 THR CB HB sing N N 330 THR OG1 HG1 sing N N 331 THR CG2 HG21 sing N N 332 THR CG2 HG22 sing N N 333 THR CG2 HG23 sing N N 334 THR OXT HXT sing N N 335 TYR N CA sing N N 336 TYR N H sing N N 337 TYR N H2 sing N N 338 TYR CA C sing N N 339 TYR CA CB sing N N 340 TYR CA HA sing N N 341 TYR C O doub N N 342 TYR C OXT sing N N 343 TYR CB CG sing N N 344 TYR CB HB2 sing N N 345 TYR CB HB3 sing N N 346 TYR CG CD1 doub Y N 347 TYR CG CD2 sing Y N 348 TYR CD1 CE1 sing Y N 349 TYR CD1 HD1 sing N N 350 TYR CD2 CE2 doub Y N 351 TYR CD2 HD2 sing N N 352 TYR CE1 CZ doub Y N 353 TYR CE1 HE1 sing N N 354 TYR CE2 CZ sing Y N 355 TYR CE2 HE2 sing N N 356 TYR CZ OH sing N N 357 TYR OH HH sing N N 358 TYR OXT HXT sing N N 359 VAL N CA sing N N 360 VAL N H sing N N 361 VAL N H2 sing N N 362 VAL CA C sing N N 363 VAL CA CB sing N N 364 VAL CA HA sing N N 365 VAL C O doub N N 366 VAL C OXT sing N N 367 VAL CB CG1 sing N N 368 VAL CB CG2 sing N N 369 VAL CB HB sing N N 370 VAL CG1 HG11 sing N N 371 VAL CG1 HG12 sing N N 372 VAL CG1 HG13 sing N N 373 VAL CG2 HG21 sing N N 374 VAL CG2 HG22 sing N N 375 VAL CG2 HG23 sing N N 376 VAL OXT HXT sing N N 377 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' CA107331 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM58888 2 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' CA154274 3 'National Institutes of Health/National Institute of Arthritis and Musculoskeletal and Skin Diseases (NIH/NIAMS)' 'United States' AR007592 4 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' P41GM103393 5 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 ETHIDIUM ET 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1MHO _pdbx_initial_refinement_model.details ? #