data_5EW9 # _entry.id 5EW9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5EW9 WWPDB D_1000215572 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5EW9 _pdbx_database_status.recvd_initial_deposition_date 2015-11-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shiau, A.K.' 1 'Motamedi, A.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Front Oncol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2234-943X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 5 _citation.language ? _citation.page_first 285 _citation.page_last 285 _citation.title ;A Cell Biologist's Field Guide to Aurora Kinase Inhibitors. ; _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3389/fonc.2015.00285 _citation.pdbx_database_id_PubMed 26732741 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'de Groot, C.O.' 1 primary 'Hsia, J.E.' 2 primary 'Anzola, J.V.' 3 primary 'Motamedi, A.' 4 primary 'Yoon, M.' 5 primary 'Wong, Y.L.' 6 primary 'Jenkins, D.' 7 primary 'Lee, H.J.' 8 primary 'Martinez, M.B.' 9 primary 'Davis, R.L.' 10 primary 'Gahman, T.C.' 11 primary 'Desai, A.' 12 primary 'Shiau, A.K.' 13 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5EW9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.851 _cell.length_a_esd ? _cell.length_b 65.327 _cell.length_b_esd ? _cell.length_c 77.267 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5EW9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aurora kinase A' 31537.053 1 2.7.11.1 ? ? ? 2 non-polymer syn '4-(3-chloranyl-2-fluoranyl-phenoxy)-1-[[6-(1,3-thiazol-2-ylamino)pyridin-2-yl]methyl]cyclohexane-1-carboxylic acid' 461.937 1 ? ? ? ? 3 water nat water 18.015 74 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora 2, Aurora/IPL1-related kinase 1, hARK1, Breast tumor-amplified kinase, Serine/threonine-protein kinase 15, Serine/threonine-protein kinase 6, Serine/threonine-protein kinase aurora-A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GPGSKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGY FHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV HAPSSRR(TPO)(TPO)LCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDF VTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKP ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGY FHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV HAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDL ISRLLKHNPSQRPMLREVLEHPWITANSSKP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 LYS n 1 6 LYS n 1 7 ARG n 1 8 GLN n 1 9 TRP n 1 10 ALA n 1 11 LEU n 1 12 GLU n 1 13 ASP n 1 14 PHE n 1 15 GLU n 1 16 ILE n 1 17 GLY n 1 18 ARG n 1 19 PRO n 1 20 LEU n 1 21 GLY n 1 22 LYS n 1 23 GLY n 1 24 LYS n 1 25 PHE n 1 26 GLY n 1 27 ASN n 1 28 VAL n 1 29 TYR n 1 30 LEU n 1 31 ALA n 1 32 ARG n 1 33 GLU n 1 34 LYS n 1 35 GLN n 1 36 SER n 1 37 LYS n 1 38 PHE n 1 39 ILE n 1 40 LEU n 1 41 ALA n 1 42 LEU n 1 43 LYS n 1 44 VAL n 1 45 LEU n 1 46 PHE n 1 47 LYS n 1 48 ALA n 1 49 GLN n 1 50 LEU n 1 51 GLU n 1 52 LYS n 1 53 ALA n 1 54 GLY n 1 55 VAL n 1 56 GLU n 1 57 HIS n 1 58 GLN n 1 59 LEU n 1 60 ARG n 1 61 ARG n 1 62 GLU n 1 63 VAL n 1 64 GLU n 1 65 ILE n 1 66 GLN n 1 67 SER n 1 68 HIS n 1 69 LEU n 1 70 ARG n 1 71 HIS n 1 72 PRO n 1 73 ASN n 1 74 ILE n 1 75 LEU n 1 76 ARG n 1 77 LEU n 1 78 TYR n 1 79 GLY n 1 80 TYR n 1 81 PHE n 1 82 HIS n 1 83 ASP n 1 84 ALA n 1 85 THR n 1 86 ARG n 1 87 VAL n 1 88 TYR n 1 89 LEU n 1 90 ILE n 1 91 LEU n 1 92 GLU n 1 93 TYR n 1 94 ALA n 1 95 PRO n 1 96 LEU n 1 97 GLY n 1 98 THR n 1 99 VAL n 1 100 TYR n 1 101 ARG n 1 102 GLU n 1 103 LEU n 1 104 GLN n 1 105 LYS n 1 106 LEU n 1 107 SER n 1 108 LYS n 1 109 PHE n 1 110 ASP n 1 111 GLU n 1 112 GLN n 1 113 ARG n 1 114 THR n 1 115 ALA n 1 116 THR n 1 117 TYR n 1 118 ILE n 1 119 THR n 1 120 GLU n 1 121 LEU n 1 122 ALA n 1 123 ASN n 1 124 ALA n 1 125 LEU n 1 126 SER n 1 127 TYR n 1 128 CYS n 1 129 HIS n 1 130 SER n 1 131 LYS n 1 132 ARG n 1 133 VAL n 1 134 ILE n 1 135 HIS n 1 136 ARG n 1 137 ASP n 1 138 ILE n 1 139 LYS n 1 140 PRO n 1 141 GLU n 1 142 ASN n 1 143 LEU n 1 144 LEU n 1 145 LEU n 1 146 GLY n 1 147 SER n 1 148 ALA n 1 149 GLY n 1 150 GLU n 1 151 LEU n 1 152 LYS n 1 153 ILE n 1 154 ALA n 1 155 ASP n 1 156 PHE n 1 157 GLY n 1 158 TRP n 1 159 SER n 1 160 VAL n 1 161 HIS n 1 162 ALA n 1 163 PRO n 1 164 SER n 1 165 SER n 1 166 ARG n 1 167 ARG n 1 168 TPO n 1 169 TPO n 1 170 LEU n 1 171 CYS n 1 172 GLY n 1 173 THR n 1 174 LEU n 1 175 ASP n 1 176 TYR n 1 177 LEU n 1 178 PRO n 1 179 PRO n 1 180 GLU n 1 181 MET n 1 182 ILE n 1 183 GLU n 1 184 GLY n 1 185 ARG n 1 186 MET n 1 187 HIS n 1 188 ASP n 1 189 GLU n 1 190 LYS n 1 191 VAL n 1 192 ASP n 1 193 LEU n 1 194 TRP n 1 195 SER n 1 196 LEU n 1 197 GLY n 1 198 VAL n 1 199 LEU n 1 200 CYS n 1 201 TYR n 1 202 GLU n 1 203 PHE n 1 204 LEU n 1 205 VAL n 1 206 GLY n 1 207 LYS n 1 208 PRO n 1 209 PRO n 1 210 PHE n 1 211 GLU n 1 212 ALA n 1 213 ASN n 1 214 THR n 1 215 TYR n 1 216 GLN n 1 217 GLU n 1 218 THR n 1 219 TYR n 1 220 LYS n 1 221 ARG n 1 222 ILE n 1 223 SER n 1 224 ARG n 1 225 VAL n 1 226 GLU n 1 227 PHE n 1 228 THR n 1 229 PHE n 1 230 PRO n 1 231 ASP n 1 232 PHE n 1 233 VAL n 1 234 THR n 1 235 GLU n 1 236 GLY n 1 237 ALA n 1 238 ARG n 1 239 ASP n 1 240 LEU n 1 241 ILE n 1 242 SER n 1 243 ARG n 1 244 LEU n 1 245 LEU n 1 246 LYS n 1 247 HIS n 1 248 ASN n 1 249 PRO n 1 250 SER n 1 251 GLN n 1 252 ARG n 1 253 PRO n 1 254 MET n 1 255 LEU n 1 256 ARG n 1 257 GLU n 1 258 VAL n 1 259 LEU n 1 260 GLU n 1 261 HIS n 1 262 PRO n 1 263 TRP n 1 264 ILE n 1 265 THR n 1 266 ALA n 1 267 ASN n 1 268 SER n 1 269 SER n 1 270 LYS n 1 271 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 271 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta 2(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AURKA_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHD ATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAP SSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISR LLKHNPSQRPMLREVLEHPWITANSSKP ; _struct_ref.pdbx_align_begin 123 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5EW9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 271 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 123 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 390 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 123 _struct_ref_seq.pdbx_auth_seq_align_end 390 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5EW9 GLY A 1 ? UNP O14965 ? ? 'expression tag' 120 1 1 5EW9 PRO A 2 ? UNP O14965 ? ? 'expression tag' 121 2 1 5EW9 GLY A 3 ? UNP O14965 ? ? 'expression tag' 122 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 5VC non-polymer . '4-(3-chloranyl-2-fluoranyl-phenoxy)-1-[[6-(1,3-thiazol-2-ylamino)pyridin-2-yl]methyl]cyclohexane-1-carboxylic acid' MK-5108 'C22 H21 Cl F N3 O3 S' 461.937 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5EW9 _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.07 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG3350, 100 mM Bis-Tris' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-05-28 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.127085 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL7-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.127085 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL7-1 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5EW9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.18 _reflns.d_resolution_low 35.95 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 14214 _reflns.number_obs 14158 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.090 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.18 _reflns_shell.d_res_low 2.22 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 97.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.659 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5EW9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.181 _refine.ls_d_res_low 33.254 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14155 _refine.ls_number_reflns_R_free 1418 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.62 _refine.ls_percent_reflns_R_free 10.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1907 _refine.ls_R_factor_R_free 0.2374 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1855 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entries 1MQ4, 2J4Z, 3FDN, 3LAU, & 4UYN' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.47 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.30 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2084 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.number_atoms_solvent 74 _refine_hist.number_atoms_total 2189 _refine_hist.d_res_high 2.181 _refine_hist.d_res_low 33.254 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 2178 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.108 ? 2965 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.046 ? 800 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.064 ? 320 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 376 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1813 2.2592 . . 140 1219 97.00 . . . 0.3355 . 0.2596 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2592 2.3497 . . 137 1238 100.00 . . . 0.3327 . 0.2329 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3497 2.4566 . . 139 1253 100.00 . . . 0.3016 . 0.2273 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4566 2.5861 . . 143 1277 100.00 . . . 0.2710 . 0.2187 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5861 2.7480 . . 138 1249 100.00 . . . 0.2563 . 0.2172 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7480 2.9601 . . 140 1263 100.00 . . . 0.2667 . 0.2150 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9601 3.2577 . . 143 1277 100.00 . . . 0.2556 . 0.1964 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2577 3.7286 . . 143 1288 100.00 . . . 0.2119 . 0.1823 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7286 4.6955 . . 144 1301 100.00 . . . 0.2052 . 0.1477 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.6955 33.2575 . . 151 1372 100.00 . . . 0.2134 . 0.1684 . . . . . . . . . . # _struct.entry_id 5EW9 _struct.title 'Crystal Structure of Aurora A Kinase Domain Bound to MK-5108' _struct.pdbx_descriptor 'Aurora kinase A (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5EW9 _struct_keywords.text 'Transferase, Protein Kinase, Inhibitor, Transferase-Transferase Inhibitor Complex' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 10 ? GLU A 12 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 AA2 LYS A 47 ? ALA A 53 ? LYS A 166 ALA A 172 1 ? 7 HELX_P HELX_P3 AA3 VAL A 55 ? SER A 67 ? VAL A 174 SER A 186 1 ? 13 HELX_P HELX_P4 AA4 THR A 98 ? SER A 107 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P5 AA5 ASP A 110 ? LYS A 131 ? ASP A 229 LYS A 250 1 ? 22 HELX_P HELX_P6 AA6 LYS A 139 ? GLU A 141 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P7 AA7 THR A 173 ? LEU A 177 ? THR A 292 LEU A 296 5 ? 5 HELX_P HELX_P8 AA8 PRO A 178 ? GLY A 184 ? PRO A 297 GLY A 303 1 ? 7 HELX_P HELX_P9 AA9 LYS A 190 ? GLY A 206 ? LYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P10 AB1 THR A 214 ? VAL A 225 ? THR A 333 VAL A 344 1 ? 12 HELX_P HELX_P11 AB2 THR A 234 ? LEU A 245 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P12 AB3 ASN A 248 ? ARG A 252 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P13 AB4 MET A 254 ? GLU A 260 ? MET A 373 GLU A 379 1 ? 7 HELX_P HELX_P14 AB5 HIS A 261 ? SER A 268 ? HIS A 380 SER A 387 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A ARG 167 C ? ? ? 1_555 A TPO 168 N ? ? A ARG 286 A TPO 287 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale both ? A TPO 168 C ? ? ? 1_555 A TPO 169 N ? ? A TPO 287 A TPO 288 1_555 ? ? ? ? ? ? ? 1.328 ? covale3 covale both ? A TPO 169 C ? ? ? 1_555 A LEU 170 N ? ? A TPO 288 A LEU 289 1_555 ? ? ? ? ? ? ? 1.333 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 14 ? GLY A 23 ? PHE A 133 GLY A 142 AA1 2 GLY A 26 ? GLU A 33 ? GLY A 145 GLU A 152 AA1 3 ILE A 39 ? PHE A 46 ? ILE A 158 PHE A 165 AA1 4 ARG A 86 ? LEU A 91 ? ARG A 205 LEU A 210 AA1 5 LEU A 77 ? HIS A 82 ? LEU A 196 HIS A 201 AA2 1 LEU A 143 ? LEU A 145 ? LEU A 262 LEU A 264 AA2 2 LEU A 151 ? ILE A 153 ? LEU A 270 ILE A 272 AA3 1 VAL A 160 ? HIS A 161 ? VAL A 279 HIS A 280 AA3 2 LEU A 170 ? CYS A 171 ? LEU A 289 CYS A 290 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 15 ? N GLU A 134 O ARG A 32 ? O ARG A 151 AA1 2 3 N TYR A 29 ? N TYR A 148 O LEU A 42 ? O LEU A 161 AA1 3 4 N LEU A 45 ? N LEU A 164 O VAL A 87 ? O VAL A 206 AA1 4 5 O TYR A 88 ? O TYR A 207 N PHE A 81 ? N PHE A 200 AA2 1 2 N LEU A 144 ? N LEU A 263 O LYS A 152 ? O LYS A 271 AA3 1 2 N HIS A 161 ? N HIS A 280 O LEU A 170 ? O LEU A 289 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 5VC _struct_site.pdbx_auth_seq_id 1000 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'binding site for residue 5VC A 1000' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 ALA A 41 ? ALA A 160 . ? 1_555 ? 2 AC1 10 LEU A 91 ? LEU A 210 . ? 1_555 ? 3 AC1 10 GLU A 92 ? GLU A 211 . ? 1_555 ? 4 AC1 10 ALA A 94 ? ALA A 213 . ? 1_555 ? 5 AC1 10 GLY A 97 ? GLY A 216 . ? 1_555 ? 6 AC1 10 THR A 98 ? THR A 217 . ? 1_555 ? 7 AC1 10 GLU A 141 ? GLU A 260 . ? 1_555 ? 8 AC1 10 LEU A 144 ? LEU A 263 . ? 1_555 ? 9 AC1 10 ALA A 154 ? ALA A 273 . ? 1_555 ? 10 AC1 10 TRP A 158 ? TRP A 277 . ? 1_555 ? # _atom_sites.entry_id 5EW9 _atom_sites.fract_transf_matrix[1][1] 0.019286 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015308 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012942 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL F N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 120 ? ? ? A . n A 1 2 PRO 2 121 ? ? ? A . n A 1 3 GLY 3 122 ? ? ? A . n A 1 4 SER 4 123 ? ? ? A . n A 1 5 LYS 5 124 ? ? ? A . n A 1 6 LYS 6 125 ? ? ? A . n A 1 7 ARG 7 126 ? ? ? A . n A 1 8 GLN 8 127 127 GLN GLN A . n A 1 9 TRP 9 128 128 TRP TRP A . n A 1 10 ALA 10 129 129 ALA ALA A . n A 1 11 LEU 11 130 130 LEU LEU A . n A 1 12 GLU 12 131 131 GLU GLU A . n A 1 13 ASP 13 132 132 ASP ASP A . n A 1 14 PHE 14 133 133 PHE PHE A . n A 1 15 GLU 15 134 134 GLU GLU A . n A 1 16 ILE 16 135 135 ILE ILE A . n A 1 17 GLY 17 136 136 GLY GLY A . n A 1 18 ARG 18 137 137 ARG ARG A . n A 1 19 PRO 19 138 138 PRO PRO A . n A 1 20 LEU 20 139 139 LEU LEU A . n A 1 21 GLY 21 140 140 GLY GLY A . n A 1 22 LYS 22 141 141 LYS LYS A . n A 1 23 GLY 23 142 142 GLY GLY A . n A 1 24 LYS 24 143 143 LYS LYS A . n A 1 25 PHE 25 144 144 PHE PHE A . n A 1 26 GLY 26 145 145 GLY GLY A . n A 1 27 ASN 27 146 146 ASN ASN A . n A 1 28 VAL 28 147 147 VAL VAL A . n A 1 29 TYR 29 148 148 TYR TYR A . n A 1 30 LEU 30 149 149 LEU LEU A . n A 1 31 ALA 31 150 150 ALA ALA A . n A 1 32 ARG 32 151 151 ARG ARG A . n A 1 33 GLU 33 152 152 GLU GLU A . n A 1 34 LYS 34 153 153 LYS LYS A . n A 1 35 GLN 35 154 154 GLN GLN A . n A 1 36 SER 36 155 155 SER SER A . n A 1 37 LYS 37 156 156 LYS LYS A . n A 1 38 PHE 38 157 157 PHE PHE A . n A 1 39 ILE 39 158 158 ILE ILE A . n A 1 40 LEU 40 159 159 LEU LEU A . n A 1 41 ALA 41 160 160 ALA ALA A . n A 1 42 LEU 42 161 161 LEU LEU A . n A 1 43 LYS 43 162 162 LYS LYS A . n A 1 44 VAL 44 163 163 VAL VAL A . n A 1 45 LEU 45 164 164 LEU LEU A . n A 1 46 PHE 46 165 165 PHE PHE A . n A 1 47 LYS 47 166 166 LYS LYS A . n A 1 48 ALA 48 167 167 ALA ALA A . n A 1 49 GLN 49 168 168 GLN GLN A . n A 1 50 LEU 50 169 169 LEU LEU A . n A 1 51 GLU 51 170 170 GLU GLU A . n A 1 52 LYS 52 171 171 LYS LYS A . n A 1 53 ALA 53 172 172 ALA ALA A . n A 1 54 GLY 54 173 173 GLY GLY A . n A 1 55 VAL 55 174 174 VAL VAL A . n A 1 56 GLU 56 175 175 GLU GLU A . n A 1 57 HIS 57 176 176 HIS HIS A . n A 1 58 GLN 58 177 177 GLN GLN A . n A 1 59 LEU 59 178 178 LEU LEU A . n A 1 60 ARG 60 179 179 ARG ARG A . n A 1 61 ARG 61 180 180 ARG ARG A . n A 1 62 GLU 62 181 181 GLU GLU A . n A 1 63 VAL 63 182 182 VAL VAL A . n A 1 64 GLU 64 183 183 GLU GLU A . n A 1 65 ILE 65 184 184 ILE ILE A . n A 1 66 GLN 66 185 185 GLN GLN A . n A 1 67 SER 67 186 186 SER SER A . n A 1 68 HIS 68 187 187 HIS HIS A . n A 1 69 LEU 69 188 188 LEU LEU A . n A 1 70 ARG 70 189 189 ARG ARG A . n A 1 71 HIS 71 190 190 HIS HIS A . n A 1 72 PRO 72 191 191 PRO PRO A . n A 1 73 ASN 73 192 192 ASN ASN A . n A 1 74 ILE 74 193 193 ILE ILE A . n A 1 75 LEU 75 194 194 LEU LEU A . n A 1 76 ARG 76 195 195 ARG ARG A . n A 1 77 LEU 77 196 196 LEU LEU A . n A 1 78 TYR 78 197 197 TYR TYR A . n A 1 79 GLY 79 198 198 GLY GLY A . n A 1 80 TYR 80 199 199 TYR TYR A . n A 1 81 PHE 81 200 200 PHE PHE A . n A 1 82 HIS 82 201 201 HIS HIS A . n A 1 83 ASP 83 202 202 ASP ASP A . n A 1 84 ALA 84 203 203 ALA ALA A . n A 1 85 THR 85 204 204 THR THR A . n A 1 86 ARG 86 205 205 ARG ARG A . n A 1 87 VAL 87 206 206 VAL VAL A . n A 1 88 TYR 88 207 207 TYR TYR A . n A 1 89 LEU 89 208 208 LEU LEU A . n A 1 90 ILE 90 209 209 ILE ILE A . n A 1 91 LEU 91 210 210 LEU LEU A . n A 1 92 GLU 92 211 211 GLU GLU A . n A 1 93 TYR 93 212 212 TYR TYR A . n A 1 94 ALA 94 213 213 ALA ALA A . n A 1 95 PRO 95 214 214 PRO PRO A . n A 1 96 LEU 96 215 215 LEU LEU A . n A 1 97 GLY 97 216 216 GLY GLY A . n A 1 98 THR 98 217 217 THR THR A . n A 1 99 VAL 99 218 218 VAL VAL A . n A 1 100 TYR 100 219 219 TYR TYR A . n A 1 101 ARG 101 220 220 ARG ARG A . n A 1 102 GLU 102 221 221 GLU GLU A . n A 1 103 LEU 103 222 222 LEU LEU A . n A 1 104 GLN 104 223 223 GLN GLN A . n A 1 105 LYS 105 224 224 LYS LYS A . n A 1 106 LEU 106 225 225 LEU LEU A . n A 1 107 SER 107 226 226 SER SER A . n A 1 108 LYS 108 227 227 LYS LYS A . n A 1 109 PHE 109 228 228 PHE PHE A . n A 1 110 ASP 110 229 229 ASP ASP A . n A 1 111 GLU 111 230 230 GLU GLU A . n A 1 112 GLN 112 231 231 GLN GLN A . n A 1 113 ARG 113 232 232 ARG ARG A . n A 1 114 THR 114 233 233 THR THR A . n A 1 115 ALA 115 234 234 ALA ALA A . n A 1 116 THR 116 235 235 THR THR A . n A 1 117 TYR 117 236 236 TYR TYR A . n A 1 118 ILE 118 237 237 ILE ILE A . n A 1 119 THR 119 238 238 THR THR A . n A 1 120 GLU 120 239 239 GLU GLU A . n A 1 121 LEU 121 240 240 LEU LEU A . n A 1 122 ALA 122 241 241 ALA ALA A . n A 1 123 ASN 123 242 242 ASN ASN A . n A 1 124 ALA 124 243 243 ALA ALA A . n A 1 125 LEU 125 244 244 LEU LEU A . n A 1 126 SER 126 245 245 SER SER A . n A 1 127 TYR 127 246 246 TYR TYR A . n A 1 128 CYS 128 247 247 CYS CYS A . n A 1 129 HIS 129 248 248 HIS HIS A . n A 1 130 SER 130 249 249 SER SER A . n A 1 131 LYS 131 250 250 LYS LYS A . n A 1 132 ARG 132 251 251 ARG ARG A . n A 1 133 VAL 133 252 252 VAL VAL A . n A 1 134 ILE 134 253 253 ILE ILE A . n A 1 135 HIS 135 254 254 HIS HIS A . n A 1 136 ARG 136 255 255 ARG ARG A . n A 1 137 ASP 137 256 256 ASP ASP A . n A 1 138 ILE 138 257 257 ILE ILE A . n A 1 139 LYS 139 258 258 LYS LYS A . n A 1 140 PRO 140 259 259 PRO PRO A . n A 1 141 GLU 141 260 260 GLU GLU A . n A 1 142 ASN 142 261 261 ASN ASN A . n A 1 143 LEU 143 262 262 LEU LEU A . n A 1 144 LEU 144 263 263 LEU LEU A . n A 1 145 LEU 145 264 264 LEU LEU A . n A 1 146 GLY 146 265 265 GLY GLY A . n A 1 147 SER 147 266 266 SER SER A . n A 1 148 ALA 148 267 267 ALA ALA A . n A 1 149 GLY 149 268 268 GLY GLY A . n A 1 150 GLU 150 269 269 GLU GLU A . n A 1 151 LEU 151 270 270 LEU LEU A . n A 1 152 LYS 152 271 271 LYS LYS A . n A 1 153 ILE 153 272 272 ILE ILE A . n A 1 154 ALA 154 273 273 ALA ALA A . n A 1 155 ASP 155 274 274 ASP ASP A . n A 1 156 PHE 156 275 275 PHE PHE A . n A 1 157 GLY 157 276 276 GLY GLY A . n A 1 158 TRP 158 277 277 TRP TRP A . n A 1 159 SER 159 278 278 SER SER A . n A 1 160 VAL 160 279 279 VAL VAL A . n A 1 161 HIS 161 280 280 HIS HIS A . n A 1 162 ALA 162 281 ? ? ? A . n A 1 163 PRO 163 282 ? ? ? A . n A 1 164 SER 164 283 ? ? ? A . n A 1 165 SER 165 284 ? ? ? A . n A 1 166 ARG 166 285 ? ? ? A . n A 1 167 ARG 167 286 286 ARG ARG A . n A 1 168 TPO 168 287 287 TPO TPO A . n A 1 169 TPO 169 288 288 TPO TPO A . n A 1 170 LEU 170 289 289 LEU LEU A . n A 1 171 CYS 171 290 290 CYS CYS A . n A 1 172 GLY 172 291 291 GLY GLY A . n A 1 173 THR 173 292 292 THR THR A . n A 1 174 LEU 174 293 293 LEU LEU A . n A 1 175 ASP 175 294 294 ASP ASP A . n A 1 176 TYR 176 295 295 TYR TYR A . n A 1 177 LEU 177 296 296 LEU LEU A . n A 1 178 PRO 178 297 297 PRO PRO A . n A 1 179 PRO 179 298 298 PRO PRO A . n A 1 180 GLU 180 299 299 GLU GLU A . n A 1 181 MET 181 300 300 MET MET A . n A 1 182 ILE 182 301 301 ILE ILE A . n A 1 183 GLU 183 302 302 GLU GLU A . n A 1 184 GLY 184 303 303 GLY GLY A . n A 1 185 ARG 185 304 304 ARG ARG A . n A 1 186 MET 186 305 305 MET MET A . n A 1 187 HIS 187 306 306 HIS HIS A . n A 1 188 ASP 188 307 307 ASP ASP A . n A 1 189 GLU 189 308 308 GLU GLU A . n A 1 190 LYS 190 309 309 LYS LYS A . n A 1 191 VAL 191 310 310 VAL VAL A . n A 1 192 ASP 192 311 311 ASP ASP A . n A 1 193 LEU 193 312 312 LEU LEU A . n A 1 194 TRP 194 313 313 TRP TRP A . n A 1 195 SER 195 314 314 SER SER A . n A 1 196 LEU 196 315 315 LEU LEU A . n A 1 197 GLY 197 316 316 GLY GLY A . n A 1 198 VAL 198 317 317 VAL VAL A . n A 1 199 LEU 199 318 318 LEU LEU A . n A 1 200 CYS 200 319 319 CYS CYS A . n A 1 201 TYR 201 320 320 TYR TYR A . n A 1 202 GLU 202 321 321 GLU GLU A . n A 1 203 PHE 203 322 322 PHE PHE A . n A 1 204 LEU 204 323 323 LEU LEU A . n A 1 205 VAL 205 324 324 VAL VAL A . n A 1 206 GLY 206 325 325 GLY GLY A . n A 1 207 LYS 207 326 326 LYS LYS A . n A 1 208 PRO 208 327 327 PRO PRO A . n A 1 209 PRO 209 328 328 PRO PRO A . n A 1 210 PHE 210 329 329 PHE PHE A . n A 1 211 GLU 211 330 330 GLU GLU A . n A 1 212 ALA 212 331 331 ALA ALA A . n A 1 213 ASN 213 332 332 ASN ASN A . n A 1 214 THR 214 333 333 THR THR A . n A 1 215 TYR 215 334 334 TYR TYR A . n A 1 216 GLN 216 335 335 GLN GLN A . n A 1 217 GLU 217 336 336 GLU GLU A . n A 1 218 THR 218 337 337 THR THR A . n A 1 219 TYR 219 338 338 TYR TYR A . n A 1 220 LYS 220 339 339 LYS LYS A . n A 1 221 ARG 221 340 340 ARG ARG A . n A 1 222 ILE 222 341 341 ILE ILE A . n A 1 223 SER 223 342 342 SER SER A . n A 1 224 ARG 224 343 343 ARG ARG A . n A 1 225 VAL 225 344 344 VAL VAL A . n A 1 226 GLU 226 345 345 GLU GLU A . n A 1 227 PHE 227 346 346 PHE PHE A . n A 1 228 THR 228 347 347 THR THR A . n A 1 229 PHE 229 348 348 PHE PHE A . n A 1 230 PRO 230 349 349 PRO PRO A . n A 1 231 ASP 231 350 350 ASP ASP A . n A 1 232 PHE 232 351 351 PHE PHE A . n A 1 233 VAL 233 352 352 VAL VAL A . n A 1 234 THR 234 353 353 THR THR A . n A 1 235 GLU 235 354 354 GLU GLU A . n A 1 236 GLY 236 355 355 GLY GLY A . n A 1 237 ALA 237 356 356 ALA ALA A . n A 1 238 ARG 238 357 357 ARG ARG A . n A 1 239 ASP 239 358 358 ASP ASP A . n A 1 240 LEU 240 359 359 LEU LEU A . n A 1 241 ILE 241 360 360 ILE ILE A . n A 1 242 SER 242 361 361 SER SER A . n A 1 243 ARG 243 362 362 ARG ARG A . n A 1 244 LEU 244 363 363 LEU LEU A . n A 1 245 LEU 245 364 364 LEU LEU A . n A 1 246 LYS 246 365 365 LYS LYS A . n A 1 247 HIS 247 366 366 HIS HIS A . n A 1 248 ASN 248 367 367 ASN ASN A . n A 1 249 PRO 249 368 368 PRO PRO A . n A 1 250 SER 250 369 369 SER SER A . n A 1 251 GLN 251 370 370 GLN GLN A . n A 1 252 ARG 252 371 371 ARG ARG A . n A 1 253 PRO 253 372 372 PRO PRO A . n A 1 254 MET 254 373 373 MET MET A . n A 1 255 LEU 255 374 374 LEU LEU A . n A 1 256 ARG 256 375 375 ARG ARG A . n A 1 257 GLU 257 376 376 GLU GLU A . n A 1 258 VAL 258 377 377 VAL VAL A . n A 1 259 LEU 259 378 378 LEU LEU A . n A 1 260 GLU 260 379 379 GLU GLU A . n A 1 261 HIS 261 380 380 HIS HIS A . n A 1 262 PRO 262 381 381 PRO PRO A . n A 1 263 TRP 263 382 382 TRP TRP A . n A 1 264 ILE 264 383 383 ILE ILE A . n A 1 265 THR 265 384 384 THR THR A . n A 1 266 ALA 266 385 385 ALA ALA A . n A 1 267 ASN 267 386 386 ASN ASN A . n A 1 268 SER 268 387 387 SER SER A . n A 1 269 SER 269 388 388 SER SER A . n A 1 270 LYS 270 389 389 LYS LYS A . n A 1 271 PRO 271 390 390 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 5VC 1 1000 1000 5VC SMD A . C 3 HOH 1 1101 56 HOH HOH A . C 3 HOH 2 1102 59 HOH HOH A . C 3 HOH 3 1103 39 HOH HOH A . C 3 HOH 4 1104 15 HOH HOH A . C 3 HOH 5 1105 16 HOH HOH A . C 3 HOH 6 1106 7 HOH HOH A . C 3 HOH 7 1107 12 HOH HOH A . C 3 HOH 8 1108 34 HOH HOH A . C 3 HOH 9 1109 42 HOH HOH A . C 3 HOH 10 1110 71 HOH HOH A . C 3 HOH 11 1111 29 HOH HOH A . C 3 HOH 12 1112 1 HOH HOH A . C 3 HOH 13 1113 41 HOH HOH A . C 3 HOH 14 1114 62 HOH HOH A . C 3 HOH 15 1115 10 HOH HOH A . C 3 HOH 16 1116 74 HOH HOH A . C 3 HOH 17 1117 32 HOH HOH A . C 3 HOH 18 1118 4 HOH HOH A . C 3 HOH 19 1119 5 HOH HOH A . C 3 HOH 20 1120 23 HOH HOH A . C 3 HOH 21 1121 11 HOH HOH A . C 3 HOH 22 1122 17 HOH HOH A . C 3 HOH 23 1123 65 HOH HOH A . C 3 HOH 24 1124 2 HOH HOH A . C 3 HOH 25 1125 52 HOH HOH A . C 3 HOH 26 1126 3 HOH HOH A . C 3 HOH 27 1127 37 HOH HOH A . C 3 HOH 28 1128 6 HOH HOH A . C 3 HOH 29 1129 55 HOH HOH A . C 3 HOH 30 1130 72 HOH HOH A . C 3 HOH 31 1131 9 HOH HOH A . C 3 HOH 32 1132 18 HOH HOH A . C 3 HOH 33 1133 8 HOH HOH A . C 3 HOH 34 1134 24 HOH HOH A . C 3 HOH 35 1135 50 HOH HOH A . C 3 HOH 36 1136 13 HOH HOH A . C 3 HOH 37 1137 25 HOH HOH A . C 3 HOH 38 1138 31 HOH HOH A . C 3 HOH 39 1139 33 HOH HOH A . C 3 HOH 40 1140 14 HOH HOH A . C 3 HOH 41 1141 53 HOH HOH A . C 3 HOH 42 1142 48 HOH HOH A . C 3 HOH 43 1143 22 HOH HOH A . C 3 HOH 44 1144 30 HOH HOH A . C 3 HOH 45 1145 26 HOH HOH A . C 3 HOH 46 1146 45 HOH HOH A . C 3 HOH 47 1147 46 HOH HOH A . C 3 HOH 48 1148 40 HOH HOH A . C 3 HOH 49 1149 51 HOH HOH A . C 3 HOH 50 1150 27 HOH HOH A . C 3 HOH 51 1151 28 HOH HOH A . C 3 HOH 52 1152 68 HOH HOH A . C 3 HOH 53 1153 57 HOH HOH A . C 3 HOH 54 1154 73 HOH HOH A . C 3 HOH 55 1155 19 HOH HOH A . C 3 HOH 56 1156 60 HOH HOH A . C 3 HOH 57 1157 66 HOH HOH A . C 3 HOH 58 1158 47 HOH HOH A . C 3 HOH 59 1159 20 HOH HOH A . C 3 HOH 60 1160 35 HOH HOH A . C 3 HOH 61 1161 70 HOH HOH A . C 3 HOH 62 1162 58 HOH HOH A . C 3 HOH 63 1163 21 HOH HOH A . C 3 HOH 64 1164 38 HOH HOH A . C 3 HOH 65 1165 67 HOH HOH A . C 3 HOH 66 1166 49 HOH HOH A . C 3 HOH 67 1167 69 HOH HOH A . C 3 HOH 68 1168 44 HOH HOH A . C 3 HOH 69 1169 36 HOH HOH A . C 3 HOH 70 1170 64 HOH HOH A . C 3 HOH 71 1171 61 HOH HOH A . C 3 HOH 72 1172 54 HOH HOH A . C 3 HOH 73 1173 63 HOH HOH A . C 3 HOH 74 1174 43 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A TPO 168 A TPO 287 ? THR 'modified residue' 2 A TPO 169 A TPO 288 ? THR 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12580 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2016-01-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -8.1057 21.2316 14.0527 0.3936 ? -0.0930 ? -0.0224 ? 0.3546 ? 0.0045 ? 0.3511 ? 4.0706 ? 0.3901 ? 0.3324 ? 2.7850 ? 0.5178 ? 5.4229 ? 0.0290 ? -0.4022 ? 0.5044 ? -0.0786 ? -0.1719 ? 0.1792 ? -0.9459 ? 0.5543 ? 0.0869 ? 2 'X-RAY DIFFRACTION' ? refined -8.0876 -0.4392 1.8677 0.4688 ? 0.1014 ? -0.1370 ? 0.3406 ? -0.0582 ? 0.3229 ? 1.7906 ? -1.3661 ? 0.6582 ? 3.6874 ? -0.9747 ? 3.0319 ? 0.4609 ? 0.2746 ? -0.2877 ? -0.7325 ? -0.3809 ? 0.3577 ? 0.6254 ? 0.2713 ? -0.0271 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and ( resid 127 through 212 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and ( resid 213 through 390 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.2_1309 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 144 ? ? 74.79 -7.76 2 1 ASP A 202 ? ? -123.55 -155.81 3 1 SER A 226 ? ? 77.46 -42.02 4 1 ILE A 257 ? ? -95.31 30.65 5 1 ASP A 307 ? ? -128.89 -154.13 6 1 LEU A 364 ? ? -91.56 57.67 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 141 ? CG ? A LYS 22 CG 2 1 Y 1 A LYS 141 ? CD ? A LYS 22 CD 3 1 Y 1 A LYS 141 ? CE ? A LYS 22 CE 4 1 Y 1 A LYS 141 ? NZ ? A LYS 22 NZ 5 1 Y 1 A GLN 154 ? CG ? A GLN 35 CG 6 1 Y 1 A GLN 154 ? CD ? A GLN 35 CD 7 1 Y 1 A GLN 154 ? OE1 ? A GLN 35 OE1 8 1 Y 1 A GLN 154 ? NE2 ? A GLN 35 NE2 9 1 Y 1 A LYS 156 ? CG ? A LYS 37 CG 10 1 Y 1 A LYS 156 ? CD ? A LYS 37 CD 11 1 Y 1 A LYS 156 ? CE ? A LYS 37 CE 12 1 Y 1 A LYS 156 ? NZ ? A LYS 37 NZ 13 1 Y 1 A GLU 170 ? CG ? A GLU 51 CG 14 1 Y 1 A GLU 170 ? CD ? A GLU 51 CD 15 1 Y 1 A GLU 170 ? OE1 ? A GLU 51 OE1 16 1 Y 1 A GLU 170 ? OE2 ? A GLU 51 OE2 17 1 Y 1 A LYS 171 ? CG ? A LYS 52 CG 18 1 Y 1 A LYS 171 ? CD ? A LYS 52 CD 19 1 Y 1 A LYS 171 ? CE ? A LYS 52 CE 20 1 Y 1 A LYS 171 ? NZ ? A LYS 52 NZ 21 1 Y 1 A ARG 189 ? CG ? A ARG 70 CG 22 1 Y 1 A ARG 189 ? CD ? A ARG 70 CD 23 1 Y 1 A ARG 189 ? NE ? A ARG 70 NE 24 1 Y 1 A ARG 189 ? CZ ? A ARG 70 CZ 25 1 Y 1 A ARG 189 ? NH1 ? A ARG 70 NH1 26 1 Y 1 A ARG 189 ? NH2 ? A ARG 70 NH2 27 1 Y 1 A ARG 304 ? CG ? A ARG 185 CG 28 1 Y 1 A ARG 304 ? CD ? A ARG 185 CD 29 1 Y 1 A ARG 304 ? NE ? A ARG 185 NE 30 1 Y 1 A ARG 304 ? CZ ? A ARG 185 CZ 31 1 Y 1 A ARG 304 ? NH1 ? A ARG 185 NH1 32 1 Y 1 A ARG 304 ? NH2 ? A ARG 185 NH2 33 1 Y 1 A LYS 309 ? CG ? A LYS 190 CG 34 1 Y 1 A LYS 309 ? CD ? A LYS 190 CD 35 1 Y 1 A LYS 309 ? CE ? A LYS 190 CE 36 1 Y 1 A LYS 309 ? NZ ? A LYS 190 NZ 37 1 Y 1 A LYS 339 ? CG ? A LYS 220 CG 38 1 Y 1 A LYS 339 ? CD ? A LYS 220 CD 39 1 Y 1 A LYS 339 ? CE ? A LYS 220 CE 40 1 Y 1 A LYS 339 ? NZ ? A LYS 220 NZ 41 1 Y 1 A GLU 354 ? CG ? A GLU 235 CG 42 1 Y 1 A GLU 354 ? CD ? A GLU 235 CD 43 1 Y 1 A GLU 354 ? OE1 ? A GLU 235 OE1 44 1 Y 1 A GLU 354 ? OE2 ? A GLU 235 OE2 45 1 Y 1 A LYS 365 ? CG ? A LYS 246 CG 46 1 Y 1 A LYS 365 ? CD ? A LYS 246 CD 47 1 Y 1 A LYS 365 ? CE ? A LYS 246 CE 48 1 Y 1 A LYS 365 ? NZ ? A LYS 246 NZ 49 1 Y 1 A ARG 375 ? CG ? A ARG 256 CG 50 1 Y 1 A ARG 375 ? CD ? A ARG 256 CD 51 1 Y 1 A ARG 375 ? NE ? A ARG 256 NE 52 1 Y 1 A ARG 375 ? CZ ? A ARG 256 CZ 53 1 Y 1 A ARG 375 ? NH1 ? A ARG 256 NH1 54 1 Y 1 A ARG 375 ? NH2 ? A ARG 256 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 120 ? A GLY 1 2 1 Y 1 A PRO 121 ? A PRO 2 3 1 Y 1 A GLY 122 ? A GLY 3 4 1 Y 1 A SER 123 ? A SER 4 5 1 Y 1 A LYS 124 ? A LYS 5 6 1 Y 1 A LYS 125 ? A LYS 6 7 1 Y 1 A ARG 126 ? A ARG 7 8 1 Y 1 A ALA 281 ? A ALA 162 9 1 Y 1 A PRO 282 ? A PRO 163 10 1 Y 1 A SER 283 ? A SER 164 11 1 Y 1 A SER 284 ? A SER 165 12 1 Y 1 A ARG 285 ? A ARG 166 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-(3-chloranyl-2-fluoranyl-phenoxy)-1-[[6-(1,3-thiazol-2-ylamino)pyridin-2-yl]methyl]cyclohexane-1-carboxylic acid' 5VC 3 water HOH #