data_5F1D # _entry.id 5F1D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5F1D WWPDB D_1000215830 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2017-05-24 _pdbx_database_PDB_obs_spr.pdb_id 5VST _pdbx_database_PDB_obs_spr.replace_pdb_id 5F1D _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5F1D _pdbx_database_status.recvd_initial_deposition_date 2015-11-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Peng, G.' 1 'Yang, Y.' 2 'Pasquarella, J.R.' 3 'Xu, L.' 4 'Qian, Z.' 5 'Holmes, K.V.' 6 'Li, F.' 7 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 292 _citation.language ? _citation.page_first 2174 _citation.page_last 2181 _citation.title 'Structural and Molecular Evidence Suggesting Coronavirus-driven Evolution of Mouse Receptor.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M116.764266 _citation.pdbx_database_id_PubMed 28035001 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Peng, G.' 1 primary 'Yang, Y.' 2 primary 'Pasquarella, J.R.' 3 primary 'Xu, L.' 4 primary 'Qian, Z.' 5 primary 'Holmes, K.V.' 6 primary 'Li, F.' 7 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5F1D _cell.details ? _cell.formula_units_Z ? _cell.length_a 113.097 _cell.length_a_esd ? _cell.length_b 113.097 _cell.length_b_esd ? _cell.length_c 64.380 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5F1D _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Carcinoembryonic antigen family member protein' 23241.986 1 ? ? 'residues 35-236' ? 2 non-polymer man N-ACETYL-D-GLUCOSAMINE 221.208 2 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNPVSTNAEIVHFVTGTNKTTTGPAHSGRETVYSNGSLLIQRVTV KDTGVYTIEMTDENFRRTEATVQFHVHQPVTQPSLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQ NNSILRIDPIKREDAGEYQCEISNPVSVKRSNSIKLDIIFDPHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;EVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNPVSTNAEIVHFVTGTNKTTTGPAHSGRETVYSNGSLLIQRVTV KDTGVYTIEMTDENFRRTEATVQFHVHQPVTQPSLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQ NNSILRIDPIKREDAGEYQCEISNPVSVKRSNSIKLDIIFDPHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 VAL n 1 3 THR n 1 4 ILE n 1 5 GLU n 1 6 ALA n 1 7 VAL n 1 8 PRO n 1 9 PRO n 1 10 GLN n 1 11 VAL n 1 12 ALA n 1 13 GLU n 1 14 ASP n 1 15 ASN n 1 16 ASN n 1 17 VAL n 1 18 LEU n 1 19 LEU n 1 20 LEU n 1 21 VAL n 1 22 HIS n 1 23 ASN n 1 24 LEU n 1 25 PRO n 1 26 LEU n 1 27 ALA n 1 28 LEU n 1 29 GLY n 1 30 ALA n 1 31 PHE n 1 32 ALA n 1 33 TRP n 1 34 TYR n 1 35 LYS n 1 36 GLY n 1 37 ASN n 1 38 PRO n 1 39 VAL n 1 40 SER n 1 41 THR n 1 42 ASN n 1 43 ALA n 1 44 GLU n 1 45 ILE n 1 46 VAL n 1 47 HIS n 1 48 PHE n 1 49 VAL n 1 50 THR n 1 51 GLY n 1 52 THR n 1 53 ASN n 1 54 LYS n 1 55 THR n 1 56 THR n 1 57 THR n 1 58 GLY n 1 59 PRO n 1 60 ALA n 1 61 HIS n 1 62 SER n 1 63 GLY n 1 64 ARG n 1 65 GLU n 1 66 THR n 1 67 VAL n 1 68 TYR n 1 69 SER n 1 70 ASN n 1 71 GLY n 1 72 SER n 1 73 LEU n 1 74 LEU n 1 75 ILE n 1 76 GLN n 1 77 ARG n 1 78 VAL n 1 79 THR n 1 80 VAL n 1 81 LYS n 1 82 ASP n 1 83 THR n 1 84 GLY n 1 85 VAL n 1 86 TYR n 1 87 THR n 1 88 ILE n 1 89 GLU n 1 90 MET n 1 91 THR n 1 92 ASP n 1 93 GLU n 1 94 ASN n 1 95 PHE n 1 96 ARG n 1 97 ARG n 1 98 THR n 1 99 GLU n 1 100 ALA n 1 101 THR n 1 102 VAL n 1 103 GLN n 1 104 PHE n 1 105 HIS n 1 106 VAL n 1 107 HIS n 1 108 GLN n 1 109 PRO n 1 110 VAL n 1 111 THR n 1 112 GLN n 1 113 PRO n 1 114 SER n 1 115 LEU n 1 116 GLN n 1 117 VAL n 1 118 THR n 1 119 ASN n 1 120 THR n 1 121 THR n 1 122 VAL n 1 123 LYS n 1 124 GLU n 1 125 LEU n 1 126 ASP n 1 127 SER n 1 128 VAL n 1 129 THR n 1 130 LEU n 1 131 THR n 1 132 CYS n 1 133 LEU n 1 134 SER n 1 135 ASN n 1 136 ASP n 1 137 ILE n 1 138 GLY n 1 139 ALA n 1 140 ASN n 1 141 ILE n 1 142 GLN n 1 143 TRP n 1 144 LEU n 1 145 PHE n 1 146 ASN n 1 147 SER n 1 148 GLN n 1 149 SER n 1 150 LEU n 1 151 GLN n 1 152 LEU n 1 153 THR n 1 154 GLU n 1 155 ARG n 1 156 MET n 1 157 THR n 1 158 LEU n 1 159 SER n 1 160 GLN n 1 161 ASN n 1 162 ASN n 1 163 SER n 1 164 ILE n 1 165 LEU n 1 166 ARG n 1 167 ILE n 1 168 ASP n 1 169 PRO n 1 170 ILE n 1 171 LYS n 1 172 ARG n 1 173 GLU n 1 174 ASP n 1 175 ALA n 1 176 GLY n 1 177 GLU n 1 178 TYR n 1 179 GLN n 1 180 CYS n 1 181 GLU n 1 182 ILE n 1 183 SER n 1 184 ASN n 1 185 PRO n 1 186 VAL n 1 187 SER n 1 188 VAL n 1 189 LYS n 1 190 ARG n 1 191 SER n 1 192 ASN n 1 193 SER n 1 194 ILE n 1 195 LYS n 1 196 LEU n 1 197 ASP n 1 198 ILE n 1 199 ILE n 1 200 PHE n 1 201 ASP n 1 202 PRO n 1 203 HIS n 1 204 HIS n 1 205 HIS n 1 206 HIS n 1 207 HIS n 1 208 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 208 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Ceacam1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q99232_MOUSE _struct_ref.pdbx_db_accession Q99232 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNPVSTNAEIVHFVTGTNKTTTGPAHSGRETVYSNGSLLIQRVTV KDTGVYTIEMTDENFRRTEATVQFHVHQPVTQPSLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQ NNSILRIDPIKREDAGEYQCEISNPVSVKRSNSIKLDIIFDP ; _struct_ref.pdbx_align_begin 35 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5F1D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 202 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99232 _struct_ref_seq.db_align_beg 35 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 236 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 202 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5F1D HIS A 203 ? UNP Q99232 ? ? 'expression tag' 203 1 1 5F1D HIS A 204 ? UNP Q99232 ? ? 'expression tag' 204 2 1 5F1D HIS A 205 ? UNP Q99232 ? ? 'expression tag' 205 3 1 5F1D HIS A 206 ? UNP Q99232 ? ? 'expression tag' 206 4 1 5F1D HIS A 207 ? UNP Q99232 ? ? 'expression tag' 207 5 1 5F1D HIS A 208 ? UNP Q99232 ? ? 'expression tag' 208 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG D-saccharide . N-ACETYL-D-GLUCOSAMINE ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5F1D _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.11 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 75.95 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Tris-HCl, PEG4000, NaCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC HF-4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2009-10-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5F1D _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.098 _reflns.d_resolution_low 16.969 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8557 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.15 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5F1D _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.098 _refine.ls_d_res_low 16.969 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8556 _refine.ls_number_reflns_R_free 438 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.05 _refine.ls_percent_reflns_R_free 5.12 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2185 _refine.ls_R_factor_R_free 0.2731 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2158 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3R4D _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.11 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.50 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1541 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 1579 _refine_hist.d_res_high 3.098 _refine_hist.d_res_low 16.969 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 ? 1598 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.376 ? 2187 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 18.055 ? 965 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.074 ? 272 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 281 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.0983 3.5431 . . 160 2575 95.00 . . . 0.3630 . 0.2790 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5431 4.4506 . . 137 2753 99.00 . . . 0.2635 . 0.2056 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4506 16.9696 . . 141 2790 97.00 . . . 0.2321 . 0.1958 . . . . . . . . . . # _struct.entry_id 5F1D _struct.title 'Crystal structure of murine CEACAM1b' _struct.pdbx_descriptor 'Carcinoembryonic antigen family member protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5F1D _struct_keywords.text 'coronavirus, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 79 ? THR A 83 ? THR A 79 THR A 83 5 ? 5 HELX_P HELX_P2 AA2 LYS A 171 ? ALA A 175 ? LYS A 171 ALA A 175 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 132 SG ? ? ? 1_555 A CYS 180 SG ? ? A CYS 132 A CYS 180 1_555 ? ? ? ? ? ? ? 2.062 ? covale1 covale one ? A ASN 70 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 70 A NAG 301 1_555 ? ? ? ? ? ? ? 1.459 ? covale2 covale both ? B NAG . O4 ? ? ? 1_555 C NAG . C1 ? ? A NAG 301 A NAG 302 1_555 ? ? ? ? ? ? ? 1.450 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 1 -4.58 2 ASN 37 A . ? ASN 37 A PRO 38 A ? PRO 38 A 1 0.00 3 GLU 93 A . ? GLU 93 A ASN 94 A ? ASN 94 A 1 -5.11 4 ASP 168 A . ? ASP 168 A PRO 169 A ? PRO 169 A 1 -1.99 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? AA3 ? 4 ? AA4 ? 5 ? AA5 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA5 1 2 ? parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 3 ? VAL A 7 ? THR A 3 VAL A 7 AA1 2 ASN A 16 ? HIS A 22 ? ASN A 16 HIS A 22 AA1 3 LEU A 73 ? GLN A 76 ? LEU A 73 GLN A 76 AA1 4 GLU A 65 ? VAL A 67 ? GLU A 65 VAL A 67 AA2 1 GLN A 10 ? ALA A 12 ? GLN A 10 ALA A 12 AA2 2 ARG A 96 ? HIS A 107 ? ARG A 96 HIS A 107 AA2 3 GLY A 84 ? THR A 91 ? GLY A 84 THR A 91 AA2 4 ALA A 30 ? LYS A 35 ? ALA A 30 LYS A 35 AA2 5 GLU A 44 ? VAL A 49 ? GLU A 44 VAL A 49 AA2 6 LYS A 54 ? THR A 57 ? LYS A 54 THR A 57 AA3 1 SER A 114 ? VAL A 117 ? SER A 114 VAL A 117 AA3 2 VAL A 128 ? LEU A 133 ? VAL A 128 LEU A 133 AA3 3 ILE A 164 ? ILE A 167 ? ILE A 164 ILE A 167 AA3 4 MET A 156 ? SER A 159 ? MET A 156 SER A 159 AA4 1 THR A 121 ? VAL A 122 ? THR A 121 VAL A 122 AA4 2 ILE A 194 ? ILE A 198 ? ILE A 194 ILE A 198 AA4 3 GLY A 176 ? ASN A 184 ? GLY A 176 ASN A 184 AA4 4 ASN A 140 ? PHE A 145 ? ASN A 140 PHE A 145 AA4 5 GLN A 148 ? SER A 149 ? GLN A 148 SER A 149 AA5 1 THR A 121 ? VAL A 122 ? THR A 121 VAL A 122 AA5 2 ILE A 194 ? ILE A 198 ? ILE A 194 ILE A 198 AA5 3 GLY A 176 ? ASN A 184 ? GLY A 176 ASN A 184 AA5 4 SER A 187 ? ARG A 190 ? SER A 187 ARG A 190 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 3 ? N THR A 3 O HIS A 22 ? O HIS A 22 AA1 2 3 N LEU A 19 ? N LEU A 19 O LEU A 73 ? O LEU A 73 AA1 3 4 O LEU A 74 ? O LEU A 74 N THR A 66 ? N THR A 66 AA2 1 2 N VAL A 11 ? N VAL A 11 O HIS A 105 ? O HIS A 105 AA2 2 3 O ARG A 97 ? O ARG A 97 N MET A 90 ? N MET A 90 AA2 3 4 O THR A 87 ? O THR A 87 N TYR A 34 ? N TYR A 34 AA2 4 5 N TRP A 33 ? N TRP A 33 O ILE A 45 ? O ILE A 45 AA2 5 6 N HIS A 47 ? N HIS A 47 O THR A 56 ? O THR A 56 AA3 1 2 N GLN A 116 ? N GLN A 116 O THR A 131 ? O THR A 131 AA3 2 3 N LEU A 130 ? N LEU A 130 O LEU A 165 ? O LEU A 165 AA3 3 4 O ILE A 164 ? O ILE A 164 N SER A 159 ? N SER A 159 AA4 1 2 N VAL A 122 ? N VAL A 122 O ASP A 197 ? O ASP A 197 AA4 2 3 O ILE A 194 ? O ILE A 194 N TYR A 178 ? N TYR A 178 AA4 3 4 O GLN A 179 ? O GLN A 179 N LEU A 144 ? N LEU A 144 AA4 4 5 N PHE A 145 ? N PHE A 145 O GLN A 148 ? O GLN A 148 AA5 1 2 N VAL A 122 ? N VAL A 122 O ASP A 197 ? O ASP A 197 AA5 2 3 O ILE A 194 ? O ILE A 194 N TYR A 178 ? N TYR A 178 AA5 3 4 N ILE A 182 ? N ILE A 182 O LYS A 189 ? O LYS A 189 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ASN _struct_site.pdbx_auth_seq_id 70 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for Poly-Saccharide residues NAG A 301 through NAG A 302 bound to ASN A 70' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LEU A 18 ? LEU A 18 . ? 1_555 ? 2 AC1 6 LEU A 20 ? LEU A 20 . ? 1_555 ? 3 AC1 6 VAL A 21 ? VAL A 21 . ? 1_555 ? 4 AC1 6 ASN A 23 ? ASN A 23 . ? 6_555 ? 5 AC1 6 ASN A 70 ? ASN A 70 . ? 1_555 ? 6 AC1 6 SER A 72 ? SER A 72 . ? 1_555 ? # _atom_sites.entry_id 5F1D _atom_sites.fract_transf_matrix[1][1] 0.008842 _atom_sites.fract_transf_matrix[1][2] 0.005105 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010210 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015533 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 CYS 132 132 132 CYS CYS A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 TRP 143 143 143 TRP TRP A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 MET 156 156 156 MET MET A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 GLN 179 179 179 GLN GLN A . n A 1 180 CYS 180 180 180 CYS CYS A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 ASN 184 184 184 ASN ASN A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 PHE 200 200 ? ? ? A . n A 1 201 ASP 201 201 ? ? ? A . n A 1 202 PRO 202 202 ? ? ? A . n A 1 203 HIS 203 203 ? ? ? A . n A 1 204 HIS 204 204 ? ? ? A . n A 1 205 HIS 205 205 ? ? ? A . n A 1 206 HIS 206 206 ? ? ? A . n A 1 207 HIS 207 207 ? ? ? A . n A 1 208 HIS 208 208 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 301 370 NAG NAG A . C 2 NAG 2 302 371 NAG NAG A . D 3 HOH 1 401 6 HOH HOH A . D 3 HOH 2 402 9 HOH HOH A . D 3 HOH 3 403 7 HOH HOH A . D 3 HOH 4 404 8 HOH HOH A . D 3 HOH 5 405 1 HOH HOH A . D 3 HOH 6 406 10 HOH HOH A . D 3 HOH 7 407 2 HOH HOH A . D 3 HOH 8 408 3 HOH HOH A . D 3 HOH 9 409 4 HOH HOH A . D 3 HOH 10 410 5 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-11-30 2 'Structure model' 1 1 2017-01-11 3 'Structure model' 1 2 2017-02-22 4 'Structure model' 1 3 2017-05-24 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 4 'Structure model' repository Obsolete ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' Advisory # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG1 A ILE 88 ? ? CB A ILE 88 ? ? CG2 A ILE 88 ? ? 95.17 111.40 -16.23 2.20 N 2 1 C A ASP 168 ? ? N A PRO 169 ? ? CD A PRO 169 ? ? 136.53 120.60 15.93 2.20 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 27 ? ? -106.32 42.24 2 1 ASP A 92 ? ? -97.21 -106.68 3 1 SER A 147 ? ? 64.46 -1.76 4 1 ASN A 162 ? ? 83.82 0.91 5 1 ARG A 172 ? ? -32.94 -38.87 6 1 PRO A 185 ? ? -54.86 5.21 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ARG A 97 ? ? THR A 98 ? ? -137.67 2 1 THR A 98 ? ? GLU A 99 ? ? -119.95 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 98 ? OG1 ? A THR 98 OG1 2 1 Y 1 A THR 98 ? CG2 ? A THR 98 CG2 3 1 Y 1 A ARG 172 ? CG ? A ARG 172 CG 4 1 Y 1 A ARG 172 ? CD ? A ARG 172 CD 5 1 Y 1 A ARG 172 ? NE ? A ARG 172 NE 6 1 Y 1 A ARG 172 ? CZ ? A ARG 172 CZ 7 1 Y 1 A ARG 172 ? NH1 ? A ARG 172 NH1 8 1 Y 1 A ARG 172 ? NH2 ? A ARG 172 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PHE 200 ? A PHE 200 2 1 Y 1 A ASP 201 ? A ASP 201 3 1 Y 1 A PRO 202 ? A PRO 202 4 1 Y 1 A HIS 203 ? A HIS 203 5 1 Y 1 A HIS 204 ? A HIS 204 6 1 Y 1 A HIS 205 ? A HIS 205 7 1 Y 1 A HIS 206 ? A HIS 206 8 1 Y 1 A HIS 207 ? A HIS 207 9 1 Y 1 A HIS 208 ? A HIS 208 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 N-ACETYL-D-GLUCOSAMINE NAG 3 water HOH #