data_5F9G # _entry.id 5F9G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5F9G pdb_00005f9g 10.2210/pdb5f9g/pdb WWPDB D_1000214191 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5F9G _pdbx_database_status.recvd_initial_deposition_date 2015-12-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Remington, S.J.' _audit_author.pdbx_ordinal 1 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'pnGFP: circularly permuted green fluorescent protein' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Remington, S.J.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5F9G _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.258 _cell.length_a_esd ? _cell.length_b 57.258 _cell.length_b_esd ? _cell.length_c 185.392 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5F9G _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'pnGFP1.5-Y.Cro,Green fluorescent protein' 28927.461 1 ? 'circular permutation,circular permutation' 'UNP residues 145-238, UNP residues 2-144' ? 2 water nat water 18.015 16 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'circularly permuted green fluorescent protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGSSLYNSHKVYITADKQKNGIKANFQIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMV LLEFVTAAGITLGMDELHKVDGGSGGTGVSKGEELFTGVVPILVELDGDVNGHKFRVRGEGEGDATNGKLTLKFICTTGK LPVPWPTLVTTL(CRO)VQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGTYKTRAEVKFEGDTLVNRIELKGIDF KEDGNILGHKLEYNSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSLYNSHKVYITADKQKNGIKANFQIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMV LLEFVTAAGITLGMDELHKVDGGSGGTGVSKGEELFTGVVPILVELDGDVNGHKFRVRGEGEGDATNGKLTLKFICTTGK LPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKE DGNILGHKLEYNSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 LEU n 1 6 TYR n 1 7 ASN n 1 8 SER n 1 9 HIS n 1 10 LYS n 1 11 VAL n 1 12 TYR n 1 13 ILE n 1 14 THR n 1 15 ALA n 1 16 ASP n 1 17 LYS n 1 18 GLN n 1 19 LYS n 1 20 ASN n 1 21 GLY n 1 22 ILE n 1 23 LYS n 1 24 ALA n 1 25 ASN n 1 26 PHE n 1 27 GLN n 1 28 ILE n 1 29 ARG n 1 30 HIS n 1 31 ASN n 1 32 VAL n 1 33 GLU n 1 34 ASP n 1 35 GLY n 1 36 SER n 1 37 VAL n 1 38 GLN n 1 39 LEU n 1 40 ALA n 1 41 ASP n 1 42 HIS n 1 43 TYR n 1 44 GLN n 1 45 GLN n 1 46 ASN n 1 47 THR n 1 48 PRO n 1 49 ILE n 1 50 GLY n 1 51 ASP n 1 52 GLY n 1 53 PRO n 1 54 VAL n 1 55 LEU n 1 56 LEU n 1 57 PRO n 1 58 ASP n 1 59 ASN n 1 60 HIS n 1 61 TYR n 1 62 LEU n 1 63 SER n 1 64 THR n 1 65 GLN n 1 66 SER n 1 67 VAL n 1 68 LEU n 1 69 SER n 1 70 LYS n 1 71 ASP n 1 72 PRO n 1 73 ASN n 1 74 GLU n 1 75 LYS n 1 76 ARG n 1 77 ASP n 1 78 HIS n 1 79 MET n 1 80 VAL n 1 81 LEU n 1 82 LEU n 1 83 GLU n 1 84 PHE n 1 85 VAL n 1 86 THR n 1 87 ALA n 1 88 ALA n 1 89 GLY n 1 90 ILE n 1 91 THR n 1 92 LEU n 1 93 GLY n 1 94 MET n 1 95 ASP n 1 96 GLU n 1 97 LEU n 1 98 HIS n 1 99 LYS n 1 100 VAL n 1 101 ASP n 1 102 GLY n 1 103 GLY n 1 104 SER n 1 105 GLY n 1 106 GLY n 1 107 THR n 1 108 GLY n 1 109 VAL n 1 110 SER n 1 111 LYS n 1 112 GLY n 1 113 GLU n 1 114 GLU n 1 115 LEU n 1 116 PHE n 1 117 THR n 1 118 GLY n 1 119 VAL n 1 120 VAL n 1 121 PRO n 1 122 ILE n 1 123 LEU n 1 124 VAL n 1 125 GLU n 1 126 LEU n 1 127 ASP n 1 128 GLY n 1 129 ASP n 1 130 VAL n 1 131 ASN n 1 132 GLY n 1 133 HIS n 1 134 LYS n 1 135 PHE n 1 136 ARG n 1 137 VAL n 1 138 ARG n 1 139 GLY n 1 140 GLU n 1 141 GLY n 1 142 GLU n 1 143 GLY n 1 144 ASP n 1 145 ALA n 1 146 THR n 1 147 ASN n 1 148 GLY n 1 149 LYS n 1 150 LEU n 1 151 THR n 1 152 LEU n 1 153 LYS n 1 154 PHE n 1 155 ILE n 1 156 CYS n 1 157 THR n 1 158 THR n 1 159 GLY n 1 160 LYS n 1 161 LEU n 1 162 PRO n 1 163 VAL n 1 164 PRO n 1 165 TRP n 1 166 PRO n 1 167 THR n 1 168 LEU n 1 169 VAL n 1 170 THR n 1 171 THR n 1 172 LEU n 1 173 CRO n 1 174 VAL n 1 175 GLN n 1 176 CYS n 1 177 PHE n 1 178 SER n 1 179 ARG n 1 180 TYR n 1 181 PRO n 1 182 ASP n 1 183 HIS n 1 184 MET n 1 185 LYS n 1 186 GLN n 1 187 HIS n 1 188 ASP n 1 189 PHE n 1 190 PHE n 1 191 LYS n 1 192 SER n 1 193 ALA n 1 194 MET n 1 195 PRO n 1 196 GLU n 1 197 GLY n 1 198 TYR n 1 199 VAL n 1 200 GLN n 1 201 GLU n 1 202 ARG n 1 203 THR n 1 204 ILE n 1 205 PHE n 1 206 PHE n 1 207 LYS n 1 208 ASP n 1 209 ASP n 1 210 GLY n 1 211 THR n 1 212 TYR n 1 213 LYS n 1 214 THR n 1 215 ARG n 1 216 ALA n 1 217 GLU n 1 218 VAL n 1 219 LYS n 1 220 PHE n 1 221 GLU n 1 222 GLY n 1 223 ASP n 1 224 THR n 1 225 LEU n 1 226 VAL n 1 227 ASN n 1 228 ARG n 1 229 ILE n 1 230 GLU n 1 231 LEU n 1 232 LYS n 1 233 GLY n 1 234 ILE n 1 235 ASP n 1 236 PHE n 1 237 LYS n 1 238 GLU n 1 239 ASP n 1 240 GLY n 1 241 ASN n 1 242 ILE n 1 243 LEU n 1 244 GLY n 1 245 HIS n 1 246 LYS n 1 247 LEU n 1 248 GLU n 1 249 TYR n 1 250 ASN n 1 251 SER n 1 252 HIS n 1 253 HIS n 1 254 HIS n 1 255 HIS n 1 256 HIS n 1 257 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 109 Jellyfish ? GFP ? ? ? ? ? ? 'Aequorea victoria' 6100 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 110 257 Jellyfish ? GFP ? ? ? ? ? ? 'Aequorea victoria' 6100 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.db_code _struct_ref.db_name _struct_ref.details _struct_ref.entity_id _struct_ref.id _struct_ref.seq_align _struct_ref.seq_dif _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_align_end GFP_AEQVI UNP ? 1 1 ? ? P42212 ? ;YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFV TAAGITHGMDELYK ; 145 ? GFP_AEQVI UNP ? 1 2 ? ? P42212 ? ;SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQH DFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN ; 2 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5F9G A 6 ? 99 ? P42212 145 ? 238 ? 6 99 2 2 5F9G A 110 ? 250 ? P42212 2 ? 144 ? 110 250 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5F9G MET A 1 ? UNP P42212 ? ? 'initiating methionine' 1 1 1 5F9G GLY A 2 ? UNP P42212 ? ? 'expression tag' 2 2 1 5F9G SER A 3 ? UNP P42212 ? ? 'expression tag' 3 3 1 5F9G SER A 4 ? UNP P42212 ? ? 'expression tag' 4 4 1 5F9G LEU A 5 ? UNP P42212 ? ? 'expression tag' 5 5 1 5F9G LYS A 10 ? UNP P42212 ASN 149 conflict 10 6 1 5F9G THR A 14 ? UNP P42212 MET 153 conflict 14 7 1 5F9G ALA A 24 ? UNP P42212 VAL 163 conflict 24 8 1 5F9G GLN A 27 ? UNP P42212 LYS 166 conflict 27 9 1 5F9G VAL A 32 ? UNP P42212 ILE 171 conflict 32 10 1 5F9G VAL A 67 ? UNP P42212 ALA 206 conflict 67 11 1 5F9G LEU A 92 ? UNP P42212 HIS 231 conflict 92 12 1 5F9G HIS A 98 ? UNP P42212 TYR 237 conflict 98 13 1 5F9G VAL A 100 ? UNP P42212 ? ? linker 100 14 1 5F9G ASP A 101 ? UNP P42212 ? ? linker 101 15 1 5F9G GLY A 102 ? UNP P42212 ? ? linker 102 16 1 5F9G GLY A 103 ? UNP P42212 ? ? linker 103 17 1 5F9G SER A 104 ? UNP P42212 ? ? linker 104 18 1 5F9G GLY A 105 ? UNP P42212 ? ? linker 105 19 1 5F9G GLY A 106 ? UNP P42212 ? ? linker 106 20 1 5F9G THR A 107 ? UNP P42212 ? ? linker 107 21 1 5F9G GLY A 108 ? UNP P42212 ? ? linker 108 22 1 5F9G VAL A 109 ? UNP P42212 ? ? linker 109 23 2 5F9G ARG A 136 ? UNP P42212 SER 28 conflict 136 24 2 5F9G ARG A 138 ? UNP P42212 SER 30 conflict 138 25 2 5F9G ASN A 147 ? UNP P42212 TYR 39 conflict 147 26 2 5F9G LEU A 172 ? UNP P42212 PHE 64 conflict 172 27 2 5F9G CRO A 173 ? UNP P42212 SER 65 chromophore 173 28 2 5F9G CRO A 173 ? UNP P42212 TYR 66 chromophore 173 29 2 5F9G CRO A 173 ? UNP P42212 GLY 67 chromophore 173 30 2 5F9G THR A 211 ? UNP P42212 ASN 105 conflict 211 31 2 5F9G SER A 251 ? UNP P42212 ? ? 'expression tag' 251 32 2 5F9G HIS A 252 ? UNP P42212 ? ? 'expression tag' 252 33 2 5F9G HIS A 253 ? UNP P42212 ? ? 'expression tag' 253 34 2 5F9G HIS A 254 ? UNP P42212 ? ? 'expression tag' 254 35 2 5F9G HIS A 255 ? UNP P42212 ? ? 'expression tag' 255 36 2 5F9G HIS A 256 ? UNP P42212 ? ? 'expression tag' 256 37 2 5F9G HIS A 257 ? UNP P42212 ? ? 'expression tag' 257 38 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CRO 'L-peptide linking' n '{2-[(1R,2R)-1-amino-2-hydroxypropyl]-4-(4-hydroxybenzylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 'PEPTIDE DERIVED CHROMOPHORE' 'C15 H17 N3 O5' 319.313 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5F9G _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.62 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.14 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;pnGFP1.5-Y.Cro in buffer 50mM Hepes pH 7.5, 0.3M NaCl, 1mM beta-mercaptoethanol, A280=52; Crystals were grown in drops of 1ul protein solution: 1ul well solution containing 20-22% PEG 3350, 0.25M potassium thiocyanate, 0.1M Tris pH 8.0 ; _exptl_crystal_grow.pdbx_pH_range 8.0 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details 'cryo:24% PEG 3350, .25M KSCN, .15M NaCl, 50mM Hepes 7.5 plus either 20% Ethylene glycol or 60% ethylene glycol and .8M NDSB-201' _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-03-29 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5F9G _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.75 _reflns.d_resolution_low 40 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14821 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 24.7 _reflns.pdbx_Rmerge_I_obs 0.089 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 80.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.968 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.75 _reflns_shell.d_res_low 2.80 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 8.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.92 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 27.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5F9G _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.772 _refine.ls_d_res_low 24.682 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8260 _refine.ls_number_reflns_R_free 410 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.88 _refine.ls_percent_reflns_R_free 4.96 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2075 _refine.ls_R_factor_R_free 0.2947 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2028 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1EMB _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.16 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.41 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1825 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 1841 _refine_hist.d_res_high 2.772 _refine_hist.d_res_low 24.682 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1880 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.442 ? 2537 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 17.380 ? 687 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.049 ? 274 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 331 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7719 3.1722 . . 128 2493 96.00 . . . 0.3395 . 0.2477 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1722 3.9939 . . 128 2582 98.00 . . . 0.3340 . 0.2443 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9939 24.6831 . . 154 2775 99.00 . . . 0.2709 . 0.1765 . . . . . . . . . . # _struct.entry_id 5F9G _struct.title 'pnGFP1.5-Y.Cro: circularly permuted green fluorescent protein (with a tyrosine-derived chromophore)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5F9G _struct_keywords.text 'green fluorescent protein, circularly permuted, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 164 ? VAL A 169 ? PRO A 164 VAL A 169 5 ? 6 HELX_P HELX_P2 AA2 VAL A 174 ? SER A 178 ? VAL A 174 SER A 178 5 ? 5 HELX_P HELX_P3 AA3 PRO A 181 ? HIS A 187 ? PRO A 181 HIS A 187 5 ? 7 HELX_P HELX_P4 AA4 ASP A 188 ? ALA A 193 ? ASP A 188 ALA A 193 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 172 C ? ? ? 1_555 A CRO 173 N1 ? ? A LEU 172 A CRO 173 1_555 ? ? ? ? ? ? ? 1.436 ? ? covale2 covale both ? A CRO 173 C3 ? ? ? 1_555 A VAL 174 N ? ? A CRO 173 A VAL 174 1_555 ? ? ? ? ? ? ? 1.435 ? ? covale3 covale none ? A CRO 173 O2 ? ? ? 1_555 A ARG 202 NH2 ? ? A CRO 173 A ARG 202 1_555 ? ? ? ? ? ? ? 1.353 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 194 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 194 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 195 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 195 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.48 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 9 ? ASP A 16 ? HIS A 9 ASP A 16 AA1 2 GLY A 21 ? ASN A 31 ? GLY A 21 ASN A 31 AA1 3 VAL A 37 ? PRO A 48 ? VAL A 37 PRO A 48 AA1 4 TYR A 198 ? PHE A 206 ? TYR A 198 PHE A 206 AA1 5 THR A 211 ? GLU A 221 ? THR A 211 GLU A 221 AA1 6 THR A 224 ? ILE A 234 ? THR A 224 ILE A 234 AA1 7 VAL A 120 ? VAL A 130 ? VAL A 120 VAL A 130 AA1 8 HIS A 133 ? ASP A 144 ? HIS A 133 ASP A 144 AA1 9 LYS A 149 ? ILE A 155 ? LYS A 149 ILE A 155 AA1 10 HIS A 78 ? ALA A 88 ? HIS A 78 ALA A 88 AA1 11 HIS A 60 ? SER A 69 ? HIS A 60 SER A 69 AA1 12 HIS A 9 ? ASP A 16 ? HIS A 9 ASP A 16 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 16 ? N ASP A 16 O GLY A 21 ? O GLY A 21 AA1 2 3 N PHE A 26 ? N PHE A 26 O HIS A 42 ? O HIS A 42 AA1 3 4 N GLN A 45 ? N GLN A 45 O GLU A 201 ? O GLU A 201 AA1 4 5 N GLN A 200 ? N GLN A 200 O ALA A 216 ? O ALA A 216 AA1 5 6 N ARG A 215 ? N ARG A 215 O GLU A 230 ? O GLU A 230 AA1 6 7 O LEU A 225 ? O LEU A 225 N LEU A 123 ? N LEU A 123 AA1 7 8 N VAL A 124 ? N VAL A 124 O GLY A 139 ? O GLY A 139 AA1 8 9 N ARG A 138 ? N ARG A 138 O ILE A 155 ? O ILE A 155 AA1 9 10 O PHE A 154 ? O PHE A 154 N MET A 79 ? N MET A 79 AA1 10 11 O VAL A 80 ? O VAL A 80 N SER A 69 ? N SER A 69 AA1 11 12 O LEU A 62 ? O LEU A 62 N VAL A 11 ? N VAL A 11 # _atom_sites.entry_id 5F9G _atom_sites.fract_transf_matrix[1][1] 0.017465 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017465 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005394 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 THR 91 91 ? ? ? A . n A 1 92 LEU 92 92 ? ? ? A . n A 1 93 GLY 93 93 ? ? ? A . n A 1 94 MET 94 94 ? ? ? A . n A 1 95 ASP 95 95 ? ? ? A . n A 1 96 GLU 96 96 ? ? ? A . n A 1 97 LEU 97 97 ? ? ? A . n A 1 98 HIS 98 98 ? ? ? A . n A 1 99 LYS 99 99 ? ? ? A . n A 1 100 VAL 100 100 ? ? ? A . n A 1 101 ASP 101 101 ? ? ? A . n A 1 102 GLY 102 102 ? ? ? A . n A 1 103 GLY 103 103 ? ? ? A . n A 1 104 SER 104 104 ? ? ? A . n A 1 105 GLY 105 105 ? ? ? A . n A 1 106 GLY 106 106 ? ? ? A . n A 1 107 THR 107 107 ? ? ? A . n A 1 108 GLY 108 108 ? ? ? A . n A 1 109 VAL 109 109 ? ? ? A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 CYS 156 156 156 CYS CYS A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 TRP 165 165 165 TRP TRP A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 CRO 173 173 173 CRO CRO A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 CYS 176 176 176 CYS CYS A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 PRO 181 181 181 PRO PRO A . n A 1 182 ASP 182 182 182 ASP ASP A . n A 1 183 HIS 183 183 183 HIS HIS A . n A 1 184 MET 184 184 184 MET MET A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 GLN 186 186 186 GLN GLN A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 ASP 188 188 188 ASP ASP A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 PHE 190 190 190 PHE PHE A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 MET 194 194 194 MET MET A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 GLU 196 196 196 GLU GLU A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 TYR 198 198 198 TYR TYR A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 GLN 200 200 200 GLN GLN A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 ILE 204 204 204 ILE ILE A . n A 1 205 PHE 205 205 205 PHE PHE A . n A 1 206 PHE 206 206 206 PHE PHE A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 THR 214 214 214 THR THR A . n A 1 215 ARG 215 215 215 ARG ARG A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 PHE 220 220 220 PHE PHE A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 GLY 222 222 222 GLY GLY A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 ASN 227 227 227 ASN ASN A . n A 1 228 ARG 228 228 228 ARG ARG A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 LYS 232 232 232 LYS LYS A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 PHE 236 236 236 PHE PHE A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 GLY 240 240 240 GLY GLY A . n A 1 241 ASN 241 241 241 ASN ASN A . n A 1 242 ILE 242 242 242 ILE ILE A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 GLY 244 244 244 GLY GLY A . n A 1 245 HIS 245 245 245 HIS HIS A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 GLU 248 248 248 GLU GLU A . n A 1 249 TYR 249 249 249 TYR TYR A . n A 1 250 ASN 250 250 250 ASN ASN A . n A 1 251 SER 251 251 ? ? ? A . n A 1 252 HIS 252 252 ? ? ? A . n A 1 253 HIS 253 253 ? ? ? A . n A 1 254 HIS 254 254 ? ? ? A . n A 1 255 HIS 255 255 ? ? ? A . n A 1 256 HIS 256 256 ? ? ? A . n A 1 257 HIS 257 257 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 15 HOH HOH A . B 2 HOH 2 302 2 HOH HOH A . B 2 HOH 3 303 5 HOH HOH A . B 2 HOH 4 304 8 HOH HOH A . B 2 HOH 5 305 1 HOH HOH A . B 2 HOH 6 306 6 HOH HOH A . B 2 HOH 7 307 17 HOH HOH A . B 2 HOH 8 308 3 HOH HOH A . B 2 HOH 9 309 12 HOH HOH A . B 2 HOH 10 310 9 HOH HOH A . B 2 HOH 11 311 13 HOH HOH A . B 2 HOH 12 312 10 HOH HOH A . B 2 HOH 13 313 11 HOH HOH A . B 2 HOH 14 314 16 HOH HOH A . B 2 HOH 15 315 4 HOH HOH A . B 2 HOH 16 316 14 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CRO _pdbx_struct_mod_residue.label_seq_id 173 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CRO _pdbx_struct_mod_residue.auth_seq_id 173 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLY _pdbx_struct_mod_residue.details chromophore # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-02-03 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2019-11-27 4 'Structure model' 1 3 2023-09-27 5 'Structure model' 1 4 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Refinement description' 8 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_struct_oper_list 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' diffrn_radiation_wavelength 8 4 'Structure model' pdbx_initial_refinement_model 9 4 'Structure model' struct_conn 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 3 'Structure model' '_pdbx_audit_support.funding_organization' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_struct_conn.pdbx_dist_value' 7 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 14 5 'Structure model' '_chem_comp_atom.atom_id' 15 5 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 314 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 316 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 36 ? ? -78.78 -168.27 2 1 LEU A 55 ? ? -68.48 96.50 3 1 ASN A 59 ? ? -56.93 104.54 4 1 ASN A 73 ? ? -64.47 -71.36 5 1 GLU A 74 ? ? -38.10 128.05 6 1 LYS A 111 ? ? -153.18 71.05 7 1 GLU A 113 ? ? -59.74 -3.56 8 1 PHE A 116 ? ? -82.87 41.93 9 1 LYS A 185 ? ? -44.51 -19.54 10 1 ASP A 209 ? ? -160.30 -155.44 11 1 GLU A 238 ? ? -63.59 33.71 12 1 ASP A 239 ? ? -167.46 -9.82 13 1 HIS A 245 ? ? 33.60 58.54 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 23 ? CD ? A LYS 23 CD 2 1 Y 1 A LYS 23 ? CE ? A LYS 23 CE 3 1 Y 1 A LYS 23 ? NZ ? A LYS 23 NZ 4 1 Y 1 A ILE 90 ? CG1 ? A ILE 90 CG1 5 1 Y 1 A ILE 90 ? CG2 ? A ILE 90 CG2 6 1 Y 1 A ILE 90 ? CD1 ? A ILE 90 CD1 7 1 Y 1 A SER 110 ? OG ? A SER 110 OG 8 1 Y 1 A CRO 173 ? CG1 ? A CRO 173 CG1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A THR 91 ? A THR 91 4 1 Y 1 A LEU 92 ? A LEU 92 5 1 Y 1 A GLY 93 ? A GLY 93 6 1 Y 1 A MET 94 ? A MET 94 7 1 Y 1 A ASP 95 ? A ASP 95 8 1 Y 1 A GLU 96 ? A GLU 96 9 1 Y 1 A LEU 97 ? A LEU 97 10 1 Y 1 A HIS 98 ? A HIS 98 11 1 Y 1 A LYS 99 ? A LYS 99 12 1 Y 1 A VAL 100 ? A VAL 100 13 1 Y 1 A ASP 101 ? A ASP 101 14 1 Y 1 A GLY 102 ? A GLY 102 15 1 Y 1 A GLY 103 ? A GLY 103 16 1 Y 1 A SER 104 ? A SER 104 17 1 Y 1 A GLY 105 ? A GLY 105 18 1 Y 1 A GLY 106 ? A GLY 106 19 1 Y 1 A THR 107 ? A THR 107 20 1 Y 1 A GLY 108 ? A GLY 108 21 1 Y 1 A VAL 109 ? A VAL 109 22 1 Y 1 A SER 251 ? A SER 251 23 1 Y 1 A HIS 252 ? A HIS 252 24 1 Y 1 A HIS 253 ? A HIS 253 25 1 Y 1 A HIS 254 ? A HIS 254 26 1 Y 1 A HIS 255 ? A HIS 255 27 1 Y 1 A HIS 256 ? A HIS 256 28 1 Y 1 A HIS 257 ? A HIS 257 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CRO N1 N N N 74 CRO CA1 C N R 75 CRO CB1 C N R 76 CRO CG1 C N N 77 CRO OG1 O N N 78 CRO C1 C N N 79 CRO N2 N N N 80 CRO N3 N N N 81 CRO C2 C N N 82 CRO O2 O N N 83 CRO CA2 C N N 84 CRO CA3 C N N 85 CRO C3 C N N 86 CRO O3 O N N 87 CRO CB2 C N N 88 CRO CG2 C Y N 89 CRO CD1 C Y N 90 CRO CD2 C Y N 91 CRO CE1 C Y N 92 CRO CE2 C Y N 93 CRO CZ C Y N 94 CRO OH O N N 95 CRO OXT O N N 96 CRO H H N N 97 CRO H2 H N N 98 CRO HA1 H N N 99 CRO HB1 H N N 100 CRO HG11 H N N 101 CRO HG12 H N N 102 CRO HG13 H N N 103 CRO HOG1 H N N 104 CRO HA31 H N N 105 CRO HA32 H N N 106 CRO HXT H N N 107 CRO HB2 H N N 108 CRO HD1 H N N 109 CRO HD2 H N N 110 CRO HE1 H N N 111 CRO HE2 H N N 112 CRO HOH H N N 113 CYS N N N N 114 CYS CA C N R 115 CYS C C N N 116 CYS O O N N 117 CYS CB C N N 118 CYS SG S N N 119 CYS OXT O N N 120 CYS H H N N 121 CYS H2 H N N 122 CYS HA H N N 123 CYS HB2 H N N 124 CYS HB3 H N N 125 CYS HG H N N 126 CYS HXT H N N 127 GLN N N N N 128 GLN CA C N S 129 GLN C C N N 130 GLN O O N N 131 GLN CB C N N 132 GLN CG C N N 133 GLN CD C N N 134 GLN OE1 O N N 135 GLN NE2 N N N 136 GLN OXT O N N 137 GLN H H N N 138 GLN H2 H N N 139 GLN HA H N N 140 GLN HB2 H N N 141 GLN HB3 H N N 142 GLN HG2 H N N 143 GLN HG3 H N N 144 GLN HE21 H N N 145 GLN HE22 H N N 146 GLN HXT H N N 147 GLU N N N N 148 GLU CA C N S 149 GLU C C N N 150 GLU O O N N 151 GLU CB C N N 152 GLU CG C N N 153 GLU CD C N N 154 GLU OE1 O N N 155 GLU OE2 O N N 156 GLU OXT O N N 157 GLU H H N N 158 GLU H2 H N N 159 GLU HA H N N 160 GLU HB2 H N N 161 GLU HB3 H N N 162 GLU HG2 H N N 163 GLU HG3 H N N 164 GLU HE2 H N N 165 GLU HXT H N N 166 GLY N N N N 167 GLY CA C N N 168 GLY C C N N 169 GLY O O N N 170 GLY OXT O N N 171 GLY H H N N 172 GLY H2 H N N 173 GLY HA2 H N N 174 GLY HA3 H N N 175 GLY HXT H N N 176 HIS N N N N 177 HIS CA C N S 178 HIS C C N N 179 HIS O O N N 180 HIS CB C N N 181 HIS CG C Y N 182 HIS ND1 N Y N 183 HIS CD2 C Y N 184 HIS CE1 C Y N 185 HIS NE2 N Y N 186 HIS OXT O N N 187 HIS H H N N 188 HIS H2 H N N 189 HIS HA H N N 190 HIS HB2 H N N 191 HIS HB3 H N N 192 HIS HD1 H N N 193 HIS HD2 H N N 194 HIS HE1 H N N 195 HIS HE2 H N N 196 HIS HXT H N N 197 HOH O O N N 198 HOH H1 H N N 199 HOH H2 H N N 200 ILE N N N N 201 ILE CA C N S 202 ILE C C N N 203 ILE O O N N 204 ILE CB C N S 205 ILE CG1 C N N 206 ILE CG2 C N N 207 ILE CD1 C N N 208 ILE OXT O N N 209 ILE H H N N 210 ILE H2 H N N 211 ILE HA H N N 212 ILE HB H N N 213 ILE HG12 H N N 214 ILE HG13 H N N 215 ILE HG21 H N N 216 ILE HG22 H N N 217 ILE HG23 H N N 218 ILE HD11 H N N 219 ILE HD12 H N N 220 ILE HD13 H N N 221 ILE HXT H N N 222 LEU N N N N 223 LEU CA C N S 224 LEU C C N N 225 LEU O O N N 226 LEU CB C N N 227 LEU CG C N N 228 LEU CD1 C N N 229 LEU CD2 C N N 230 LEU OXT O N N 231 LEU H H N N 232 LEU H2 H N N 233 LEU HA H N N 234 LEU HB2 H N N 235 LEU HB3 H N N 236 LEU HG H N N 237 LEU HD11 H N N 238 LEU HD12 H N N 239 LEU HD13 H N N 240 LEU HD21 H N N 241 LEU HD22 H N N 242 LEU HD23 H N N 243 LEU HXT H N N 244 LYS N N N N 245 LYS CA C N S 246 LYS C C N N 247 LYS O O N N 248 LYS CB C N N 249 LYS CG C N N 250 LYS CD C N N 251 LYS CE C N N 252 LYS NZ N N N 253 LYS OXT O N N 254 LYS H H N N 255 LYS H2 H N N 256 LYS HA H N N 257 LYS HB2 H N N 258 LYS HB3 H N N 259 LYS HG2 H N N 260 LYS HG3 H N N 261 LYS HD2 H N N 262 LYS HD3 H N N 263 LYS HE2 H N N 264 LYS HE3 H N N 265 LYS HZ1 H N N 266 LYS HZ2 H N N 267 LYS HZ3 H N N 268 LYS HXT H N N 269 MET N N N N 270 MET CA C N S 271 MET C C N N 272 MET O O N N 273 MET CB C N N 274 MET CG C N N 275 MET SD S N N 276 MET CE C N N 277 MET OXT O N N 278 MET H H N N 279 MET H2 H N N 280 MET HA H N N 281 MET HB2 H N N 282 MET HB3 H N N 283 MET HG2 H N N 284 MET HG3 H N N 285 MET HE1 H N N 286 MET HE2 H N N 287 MET HE3 H N N 288 MET HXT H N N 289 PHE N N N N 290 PHE CA C N S 291 PHE C C N N 292 PHE O O N N 293 PHE CB C N N 294 PHE CG C Y N 295 PHE CD1 C Y N 296 PHE CD2 C Y N 297 PHE CE1 C Y N 298 PHE CE2 C Y N 299 PHE CZ C Y N 300 PHE OXT O N N 301 PHE H H N N 302 PHE H2 H N N 303 PHE HA H N N 304 PHE HB2 H N N 305 PHE HB3 H N N 306 PHE HD1 H N N 307 PHE HD2 H N N 308 PHE HE1 H N N 309 PHE HE2 H N N 310 PHE HZ H N N 311 PHE HXT H N N 312 PRO N N N N 313 PRO CA C N S 314 PRO C C N N 315 PRO O O N N 316 PRO CB C N N 317 PRO CG C N N 318 PRO CD C N N 319 PRO OXT O N N 320 PRO H H N N 321 PRO HA H N N 322 PRO HB2 H N N 323 PRO HB3 H N N 324 PRO HG2 H N N 325 PRO HG3 H N N 326 PRO HD2 H N N 327 PRO HD3 H N N 328 PRO HXT H N N 329 SER N N N N 330 SER CA C N S 331 SER C C N N 332 SER O O N N 333 SER CB C N N 334 SER OG O N N 335 SER OXT O N N 336 SER H H N N 337 SER H2 H N N 338 SER HA H N N 339 SER HB2 H N N 340 SER HB3 H N N 341 SER HG H N N 342 SER HXT H N N 343 THR N N N N 344 THR CA C N S 345 THR C C N N 346 THR O O N N 347 THR CB C N R 348 THR OG1 O N N 349 THR CG2 C N N 350 THR OXT O N N 351 THR H H N N 352 THR H2 H N N 353 THR HA H N N 354 THR HB H N N 355 THR HG1 H N N 356 THR HG21 H N N 357 THR HG22 H N N 358 THR HG23 H N N 359 THR HXT H N N 360 TRP N N N N 361 TRP CA C N S 362 TRP C C N N 363 TRP O O N N 364 TRP CB C N N 365 TRP CG C Y N 366 TRP CD1 C Y N 367 TRP CD2 C Y N 368 TRP NE1 N Y N 369 TRP CE2 C Y N 370 TRP CE3 C Y N 371 TRP CZ2 C Y N 372 TRP CZ3 C Y N 373 TRP CH2 C Y N 374 TRP OXT O N N 375 TRP H H N N 376 TRP H2 H N N 377 TRP HA H N N 378 TRP HB2 H N N 379 TRP HB3 H N N 380 TRP HD1 H N N 381 TRP HE1 H N N 382 TRP HE3 H N N 383 TRP HZ2 H N N 384 TRP HZ3 H N N 385 TRP HH2 H N N 386 TRP HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CRO CG1 CB1 sing N N 70 CRO OG1 CB1 sing N N 71 CRO CB1 CA1 sing N N 72 CRO N1 CA1 sing N N 73 CRO OH CZ sing N N 74 CRO CE1 CZ doub Y N 75 CRO CE1 CD1 sing Y N 76 CRO CA1 C1 sing N N 77 CRO CZ CE2 sing Y N 78 CRO CD1 CG2 doub Y N 79 CRO N2 C1 doub N N 80 CRO N2 CA2 sing N N 81 CRO C1 N3 sing N N 82 CRO CE2 CD2 doub Y N 83 CRO CG2 CD2 sing Y N 84 CRO CG2 CB2 sing N N 85 CRO N3 CA3 sing N N 86 CRO N3 C2 sing N N 87 CRO CA2 CB2 doub N Z 88 CRO CA2 C2 sing N N 89 CRO CA3 C3 sing N N 90 CRO OXT C3 sing N N 91 CRO C3 O3 doub N N 92 CRO C2 O2 doub N N 93 CRO N1 H sing N N 94 CRO N1 H2 sing N N 95 CRO CA1 HA1 sing N N 96 CRO CB1 HB1 sing N N 97 CRO CG1 HG11 sing N N 98 CRO CG1 HG12 sing N N 99 CRO CG1 HG13 sing N N 100 CRO OG1 HOG1 sing N N 101 CRO CA3 HA31 sing N N 102 CRO CA3 HA32 sing N N 103 CRO OXT HXT sing N N 104 CRO CB2 HB2 sing N N 105 CRO CD1 HD1 sing N N 106 CRO CD2 HD2 sing N N 107 CRO CE1 HE1 sing N N 108 CRO CE2 HE2 sing N N 109 CRO OH HOH sing N N 110 CYS N CA sing N N 111 CYS N H sing N N 112 CYS N H2 sing N N 113 CYS CA C sing N N 114 CYS CA CB sing N N 115 CYS CA HA sing N N 116 CYS C O doub N N 117 CYS C OXT sing N N 118 CYS CB SG sing N N 119 CYS CB HB2 sing N N 120 CYS CB HB3 sing N N 121 CYS SG HG sing N N 122 CYS OXT HXT sing N N 123 GLN N CA sing N N 124 GLN N H sing N N 125 GLN N H2 sing N N 126 GLN CA C sing N N 127 GLN CA CB sing N N 128 GLN CA HA sing N N 129 GLN C O doub N N 130 GLN C OXT sing N N 131 GLN CB CG sing N N 132 GLN CB HB2 sing N N 133 GLN CB HB3 sing N N 134 GLN CG CD sing N N 135 GLN CG HG2 sing N N 136 GLN CG HG3 sing N N 137 GLN CD OE1 doub N N 138 GLN CD NE2 sing N N 139 GLN NE2 HE21 sing N N 140 GLN NE2 HE22 sing N N 141 GLN OXT HXT sing N N 142 GLU N CA sing N N 143 GLU N H sing N N 144 GLU N H2 sing N N 145 GLU CA C sing N N 146 GLU CA CB sing N N 147 GLU CA HA sing N N 148 GLU C O doub N N 149 GLU C OXT sing N N 150 GLU CB CG sing N N 151 GLU CB HB2 sing N N 152 GLU CB HB3 sing N N 153 GLU CG CD sing N N 154 GLU CG HG2 sing N N 155 GLU CG HG3 sing N N 156 GLU CD OE1 doub N N 157 GLU CD OE2 sing N N 158 GLU OE2 HE2 sing N N 159 GLU OXT HXT sing N N 160 GLY N CA sing N N 161 GLY N H sing N N 162 GLY N H2 sing N N 163 GLY CA C sing N N 164 GLY CA HA2 sing N N 165 GLY CA HA3 sing N N 166 GLY C O doub N N 167 GLY C OXT sing N N 168 GLY OXT HXT sing N N 169 HIS N CA sing N N 170 HIS N H sing N N 171 HIS N H2 sing N N 172 HIS CA C sing N N 173 HIS CA CB sing N N 174 HIS CA HA sing N N 175 HIS C O doub N N 176 HIS C OXT sing N N 177 HIS CB CG sing N N 178 HIS CB HB2 sing N N 179 HIS CB HB3 sing N N 180 HIS CG ND1 sing Y N 181 HIS CG CD2 doub Y N 182 HIS ND1 CE1 doub Y N 183 HIS ND1 HD1 sing N N 184 HIS CD2 NE2 sing Y N 185 HIS CD2 HD2 sing N N 186 HIS CE1 NE2 sing Y N 187 HIS CE1 HE1 sing N N 188 HIS NE2 HE2 sing N N 189 HIS OXT HXT sing N N 190 HOH O H1 sing N N 191 HOH O H2 sing N N 192 ILE N CA sing N N 193 ILE N H sing N N 194 ILE N H2 sing N N 195 ILE CA C sing N N 196 ILE CA CB sing N N 197 ILE CA HA sing N N 198 ILE C O doub N N 199 ILE C OXT sing N N 200 ILE CB CG1 sing N N 201 ILE CB CG2 sing N N 202 ILE CB HB sing N N 203 ILE CG1 CD1 sing N N 204 ILE CG1 HG12 sing N N 205 ILE CG1 HG13 sing N N 206 ILE CG2 HG21 sing N N 207 ILE CG2 HG22 sing N N 208 ILE CG2 HG23 sing N N 209 ILE CD1 HD11 sing N N 210 ILE CD1 HD12 sing N N 211 ILE CD1 HD13 sing N N 212 ILE OXT HXT sing N N 213 LEU N CA sing N N 214 LEU N H sing N N 215 LEU N H2 sing N N 216 LEU CA C sing N N 217 LEU CA CB sing N N 218 LEU CA HA sing N N 219 LEU C O doub N N 220 LEU C OXT sing N N 221 LEU CB CG sing N N 222 LEU CB HB2 sing N N 223 LEU CB HB3 sing N N 224 LEU CG CD1 sing N N 225 LEU CG CD2 sing N N 226 LEU CG HG sing N N 227 LEU CD1 HD11 sing N N 228 LEU CD1 HD12 sing N N 229 LEU CD1 HD13 sing N N 230 LEU CD2 HD21 sing N N 231 LEU CD2 HD22 sing N N 232 LEU CD2 HD23 sing N N 233 LEU OXT HXT sing N N 234 LYS N CA sing N N 235 LYS N H sing N N 236 LYS N H2 sing N N 237 LYS CA C sing N N 238 LYS CA CB sing N N 239 LYS CA HA sing N N 240 LYS C O doub N N 241 LYS C OXT sing N N 242 LYS CB CG sing N N 243 LYS CB HB2 sing N N 244 LYS CB HB3 sing N N 245 LYS CG CD sing N N 246 LYS CG HG2 sing N N 247 LYS CG HG3 sing N N 248 LYS CD CE sing N N 249 LYS CD HD2 sing N N 250 LYS CD HD3 sing N N 251 LYS CE NZ sing N N 252 LYS CE HE2 sing N N 253 LYS CE HE3 sing N N 254 LYS NZ HZ1 sing N N 255 LYS NZ HZ2 sing N N 256 LYS NZ HZ3 sing N N 257 LYS OXT HXT sing N N 258 MET N CA sing N N 259 MET N H sing N N 260 MET N H2 sing N N 261 MET CA C sing N N 262 MET CA CB sing N N 263 MET CA HA sing N N 264 MET C O doub N N 265 MET C OXT sing N N 266 MET CB CG sing N N 267 MET CB HB2 sing N N 268 MET CB HB3 sing N N 269 MET CG SD sing N N 270 MET CG HG2 sing N N 271 MET CG HG3 sing N N 272 MET SD CE sing N N 273 MET CE HE1 sing N N 274 MET CE HE2 sing N N 275 MET CE HE3 sing N N 276 MET OXT HXT sing N N 277 PHE N CA sing N N 278 PHE N H sing N N 279 PHE N H2 sing N N 280 PHE CA C sing N N 281 PHE CA CB sing N N 282 PHE CA HA sing N N 283 PHE C O doub N N 284 PHE C OXT sing N N 285 PHE CB CG sing N N 286 PHE CB HB2 sing N N 287 PHE CB HB3 sing N N 288 PHE CG CD1 doub Y N 289 PHE CG CD2 sing Y N 290 PHE CD1 CE1 sing Y N 291 PHE CD1 HD1 sing N N 292 PHE CD2 CE2 doub Y N 293 PHE CD2 HD2 sing N N 294 PHE CE1 CZ doub Y N 295 PHE CE1 HE1 sing N N 296 PHE CE2 CZ sing Y N 297 PHE CE2 HE2 sing N N 298 PHE CZ HZ sing N N 299 PHE OXT HXT sing N N 300 PRO N CA sing N N 301 PRO N CD sing N N 302 PRO N H sing N N 303 PRO CA C sing N N 304 PRO CA CB sing N N 305 PRO CA HA sing N N 306 PRO C O doub N N 307 PRO C OXT sing N N 308 PRO CB CG sing N N 309 PRO CB HB2 sing N N 310 PRO CB HB3 sing N N 311 PRO CG CD sing N N 312 PRO CG HG2 sing N N 313 PRO CG HG3 sing N N 314 PRO CD HD2 sing N N 315 PRO CD HD3 sing N N 316 PRO OXT HXT sing N N 317 SER N CA sing N N 318 SER N H sing N N 319 SER N H2 sing N N 320 SER CA C sing N N 321 SER CA CB sing N N 322 SER CA HA sing N N 323 SER C O doub N N 324 SER C OXT sing N N 325 SER CB OG sing N N 326 SER CB HB2 sing N N 327 SER CB HB3 sing N N 328 SER OG HG sing N N 329 SER OXT HXT sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number CHE-1351933 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1EMB _pdbx_initial_refinement_model.details ? #