data_5FBM # _entry.id 5FBM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5FBM pdb_00005fbm 10.2210/pdb5fbm/pdb WWPDB D_1000216341 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5FBM _pdbx_database_status.recvd_initial_deposition_date 2015-12-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lovell, S.' 1 ? 'Battaile, K.P.' 2 ? 'Mehzabeen, N.' 3 ? ;O'Neil, P. ; 4 ? 'Biswas, I.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr F Struct Biol Commun' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 72 _citation.language ? _citation.page_first 257 _citation.page_last 262 _citation.title 'Crystal structure of histone-like protein from Streptococcus mutans refined to 1.9 angstrom resolution.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X1600217X _citation.pdbx_database_id_PubMed 27050257 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary ;O'Neil, P. ; 1 ? primary 'Lovell, S.' 2 ? primary 'Mehzabeen, N.' 3 ? primary 'Battaile, K.' 4 ? primary 'Biswas, I.' 5 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 107.210 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5FBM _cell.details ? _cell.formula_units_Z ? _cell.length_a 32.458 _cell.length_a_esd ? _cell.length_b 76.333 _cell.length_b_esd ? _cell.length_c 36.933 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FBM _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA-binding protein HU' 10829.420 2 ? ? ? ? 2 water nat water 18.015 60 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MANKQDLIAKVAEATELTKKDSAAAVDAVFSAVSSYLAKGEKVQLIGFGNFEVRERAARKGRNPQTGEEIKIKASKVPAF KAGKALKDAVKHHHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MANKQDLIAKVAEATELTKKDSAAAVDAVFSAVSSYLAKGEKVQLIGFGNFEVRERAARKGRNPQTGEEIKIKASKVPAF KAGKALKDAVKHHHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ASN n 1 4 LYS n 1 5 GLN n 1 6 ASP n 1 7 LEU n 1 8 ILE n 1 9 ALA n 1 10 LYS n 1 11 VAL n 1 12 ALA n 1 13 GLU n 1 14 ALA n 1 15 THR n 1 16 GLU n 1 17 LEU n 1 18 THR n 1 19 LYS n 1 20 LYS n 1 21 ASP n 1 22 SER n 1 23 ALA n 1 24 ALA n 1 25 ALA n 1 26 VAL n 1 27 ASP n 1 28 ALA n 1 29 VAL n 1 30 PHE n 1 31 SER n 1 32 ALA n 1 33 VAL n 1 34 SER n 1 35 SER n 1 36 TYR n 1 37 LEU n 1 38 ALA n 1 39 LYS n 1 40 GLY n 1 41 GLU n 1 42 LYS n 1 43 VAL n 1 44 GLN n 1 45 LEU n 1 46 ILE n 1 47 GLY n 1 48 PHE n 1 49 GLY n 1 50 ASN n 1 51 PHE n 1 52 GLU n 1 53 VAL n 1 54 ARG n 1 55 GLU n 1 56 ARG n 1 57 ALA n 1 58 ALA n 1 59 ARG n 1 60 LYS n 1 61 GLY n 1 62 ARG n 1 63 ASN n 1 64 PRO n 1 65 GLN n 1 66 THR n 1 67 GLY n 1 68 GLU n 1 69 GLU n 1 70 ILE n 1 71 LYS n 1 72 ILE n 1 73 LYS n 1 74 ALA n 1 75 SER n 1 76 LYS n 1 77 VAL n 1 78 PRO n 1 79 ALA n 1 80 PHE n 1 81 LYS n 1 82 ALA n 1 83 GLY n 1 84 LYS n 1 85 ALA n 1 86 LEU n 1 87 LYS n 1 88 ASP n 1 89 ALA n 1 90 VAL n 1 91 LYS n 1 92 HIS n 1 93 HIS n 1 94 HIS n 1 95 HIS n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 99 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'hup, hlpA, SMU_589' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700610 / UA159' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details 'C-terminal hexahistidine tag' _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus mutans serotype c (strain ATCC 700610 / UA159)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 210007 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pIB-B39 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DBH_STRMU _struct_ref.pdbx_db_accession Q9XB21 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MANKQDLIAKVAEATELTKKDSAAAVDAVFSAVSSYLAKGEKVQLIGFGNFEVRERAARKGRNPQTGEEIKIKASKVPAF KAGKALKDAVK ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5FBM A 1 ? 91 ? Q9XB21 1 ? 91 ? 1 91 2 1 5FBM B 1 ? 91 ? Q9XB21 1 ? 91 ? 1 91 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FBM HIS A 92 ? UNP Q9XB21 ? ? 'expression tag' 92 1 1 5FBM HIS A 93 ? UNP Q9XB21 ? ? 'expression tag' 93 2 1 5FBM HIS A 94 ? UNP Q9XB21 ? ? 'expression tag' 94 3 1 5FBM HIS A 95 ? UNP Q9XB21 ? ? 'expression tag' 95 4 1 5FBM HIS A 96 ? UNP Q9XB21 ? ? 'expression tag' 96 5 1 5FBM HIS A 97 ? UNP Q9XB21 ? ? 'expression tag' 97 6 1 5FBM HIS A 98 ? UNP Q9XB21 ? ? 'expression tag' 98 7 1 5FBM HIS A 99 ? UNP Q9XB21 ? ? 'expression tag' 99 8 2 5FBM HIS B 92 ? UNP Q9XB21 ? ? 'expression tag' 92 9 2 5FBM HIS B 93 ? UNP Q9XB21 ? ? 'expression tag' 93 10 2 5FBM HIS B 94 ? UNP Q9XB21 ? ? 'expression tag' 94 11 2 5FBM HIS B 95 ? UNP Q9XB21 ? ? 'expression tag' 95 12 2 5FBM HIS B 96 ? UNP Q9XB21 ? ? 'expression tag' 96 13 2 5FBM HIS B 97 ? UNP Q9XB21 ? ? 'expression tag' 97 14 2 5FBM HIS B 98 ? UNP Q9XB21 ? ? 'expression tag' 98 15 2 5FBM HIS B 99 ? UNP Q9XB21 ? ? 'expression tag' 99 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5FBM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.25 _exptl_crystal.description Prism _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 10.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG 400 and 0.1M CAPS' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-07 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 29.030 _reflns.entry_id 5FBM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.900 _reflns.d_resolution_low 38.170 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13437 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.400 _reflns.pdbx_Rmerge_I_obs 0.051 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 3 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.033 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 45407 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.900 1.940 ? 1.900 2971 ? ? 882 ? 99.400 ? ? ? ? 0.714 ? ? ? ? ? ? ? ? 3.400 ? ? ? ? ? 0.454 0 1 1 0.710 ? 9.110 38.170 ? 40.100 391 ? ? 119 ? 87.000 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 3.300 ? ? ? ? ? 0.017 0 2 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 104.740 _refine.B_iso_mean 41.2287 _refine.B_iso_min 16.900 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5FBM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9000 _refine.ls_d_res_low 38.1660 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13416 _refine.ls_number_reflns_R_free 664 _refine.ls_number_reflns_R_work 12752 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.6100 _refine.ls_percent_reflns_R_free 4.9500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1785 _refine.ls_R_factor_R_free 0.2167 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1766 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.050 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3RHI _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.8000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.9000 _refine_hist.d_res_low 38.1660 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 60 _refine_hist.number_atoms_total 1249 _refine_hist.pdbx_number_residues_total 166 _refine_hist.pdbx_B_iso_mean_solvent 43.81 _refine_hist.pdbx_number_atoms_protein 1189 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1197 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.962 ? 1606 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.052 ? 196 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 203 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.941 ? 424 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9001 2.0468 2694 . 145 2549 99.0000 . . . 0.3039 . 0.2403 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.0468 2.2527 2676 . 139 2537 99.0000 . . . 0.2312 . 0.1842 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.2527 2.5786 2709 . 122 2587 100.0000 . . . 0.2114 . 0.1686 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.5786 3.2486 2709 . 135 2574 99.0000 . . . 0.2335 . 0.1874 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.2486 38.1742 2628 . 123 2505 96.0000 . . . 0.1916 . 0.1626 . . . . . . 5 . . . # _struct.entry_id 5FBM _struct.title 'Crystal Structure of Histone Like Protein (HLP) from Streptococcus mutans Refined to 1.9 A Resolution' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5FBM _struct_keywords.text 'Histone-like protein, DNA binding, Dimerization, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 3 ? GLU A 16 ? ASN A 3 GLU A 16 1 ? 14 HELX_P HELX_P2 AA2 THR A 18 ? LYS A 39 ? THR A 18 LYS A 39 1 ? 22 HELX_P HELX_P3 AA3 GLY A 83 ? HIS A 92 ? GLY A 83 HIS A 92 1 ? 10 HELX_P HELX_P4 AA4 ASN B 3 ? THR B 15 ? ASN B 3 THR B 15 1 ? 13 HELX_P HELX_P5 AA5 THR B 18 ? LYS B 39 ? THR B 18 LYS B 39 1 ? 22 HELX_P HELX_P6 AA6 GLY B 83 ? LYS B 91 ? GLY B 83 LYS B 91 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 43 ? LEU A 45 ? VAL A 43 LEU A 45 AA1 2 GLY A 49 ? ARG A 56 ? GLY A 49 ARG A 56 AA1 3 SER A 75 ? ALA A 82 ? SER A 75 ALA A 82 AA2 1 VAL B 43 ? LEU B 45 ? VAL B 43 LEU B 45 AA2 2 GLY B 49 ? ARG B 56 ? GLY B 49 ARG B 56 AA2 3 SER B 75 ? ALA B 82 ? SER B 75 ALA B 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 43 ? N VAL A 43 O PHE A 51 ? O PHE A 51 AA1 2 3 N ARG A 54 ? N ARG A 54 O VAL A 77 ? O VAL A 77 AA2 1 2 N VAL B 43 ? N VAL B 43 O PHE B 51 ? O PHE B 51 AA2 2 3 N ARG B 54 ? N ARG B 54 O VAL B 77 ? O VAL B 77 # _atom_sites.entry_id 5FBM _atom_sites.fract_transf_matrix[1][1] 0.030809 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.009545 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013100 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.028346 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLY 61 61 ? ? ? A . n A 1 62 ARG 62 62 ? ? ? A . n A 1 63 ASN 63 63 ? ? ? A . n A 1 64 PRO 64 64 ? ? ? A . n A 1 65 GLN 65 65 ? ? ? A . n A 1 66 THR 66 66 ? ? ? A . n A 1 67 GLY 67 67 ? ? ? A . n A 1 68 GLU 68 68 ? ? ? A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 HIS 93 93 ? ? ? A . n A 1 94 HIS 94 94 ? ? ? A . n A 1 95 HIS 95 95 ? ? ? A . n A 1 96 HIS 96 96 ? ? ? A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 HIS 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 ALA 2 2 2 ALA ALA B . n B 1 3 ASN 3 3 3 ASN ASN B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 GLN 5 5 5 GLN GLN B . n B 1 6 ASP 6 6 6 ASP ASP B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 ILE 8 8 8 ILE ILE B . n B 1 9 ALA 9 9 9 ALA ALA B . n B 1 10 LYS 10 10 10 LYS LYS B . n B 1 11 VAL 11 11 11 VAL VAL B . n B 1 12 ALA 12 12 12 ALA ALA B . n B 1 13 GLU 13 13 13 GLU GLU B . n B 1 14 ALA 14 14 14 ALA ALA B . n B 1 15 THR 15 15 15 THR THR B . n B 1 16 GLU 16 16 16 GLU GLU B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 THR 18 18 18 THR THR B . n B 1 19 LYS 19 19 19 LYS LYS B . n B 1 20 LYS 20 20 20 LYS LYS B . n B 1 21 ASP 21 21 21 ASP ASP B . n B 1 22 SER 22 22 22 SER SER B . n B 1 23 ALA 23 23 23 ALA ALA B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 ALA 25 25 25 ALA ALA B . n B 1 26 VAL 26 26 26 VAL VAL B . n B 1 27 ASP 27 27 27 ASP ASP B . n B 1 28 ALA 28 28 28 ALA ALA B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 PHE 30 30 30 PHE PHE B . n B 1 31 SER 31 31 31 SER SER B . n B 1 32 ALA 32 32 32 ALA ALA B . n B 1 33 VAL 33 33 33 VAL VAL B . n B 1 34 SER 34 34 34 SER SER B . n B 1 35 SER 35 35 35 SER SER B . n B 1 36 TYR 36 36 36 TYR TYR B . n B 1 37 LEU 37 37 37 LEU LEU B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 LYS 39 39 39 LYS LYS B . n B 1 40 GLY 40 40 40 GLY GLY B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 LYS 42 42 42 LYS LYS B . n B 1 43 VAL 43 43 43 VAL VAL B . n B 1 44 GLN 44 44 44 GLN GLN B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 ILE 46 46 46 ILE ILE B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 PHE 48 48 48 PHE PHE B . n B 1 49 GLY 49 49 49 GLY GLY B . n B 1 50 ASN 50 50 50 ASN ASN B . n B 1 51 PHE 51 51 51 PHE PHE B . n B 1 52 GLU 52 52 52 GLU GLU B . n B 1 53 VAL 53 53 53 VAL VAL B . n B 1 54 ARG 54 54 54 ARG ARG B . n B 1 55 GLU 55 55 55 GLU GLU B . n B 1 56 ARG 56 56 56 ARG ARG B . n B 1 57 ALA 57 57 57 ALA ALA B . n B 1 58 ALA 58 58 58 ALA ALA B . n B 1 59 ARG 59 59 59 ARG ARG B . n B 1 60 LYS 60 60 60 LYS LYS B . n B 1 61 GLY 61 61 ? ? ? B . n B 1 62 ARG 62 62 ? ? ? B . n B 1 63 ASN 63 63 ? ? ? B . n B 1 64 PRO 64 64 ? ? ? B . n B 1 65 GLN 65 65 ? ? ? B . n B 1 66 THR 66 66 ? ? ? B . n B 1 67 GLY 67 67 ? ? ? B . n B 1 68 GLU 68 68 68 GLU GLU B . n B 1 69 GLU 69 69 69 GLU GLU B . n B 1 70 ILE 70 70 70 ILE ILE B . n B 1 71 LYS 71 71 71 LYS LYS B . n B 1 72 ILE 72 72 72 ILE ILE B . n B 1 73 LYS 73 73 73 LYS LYS B . n B 1 74 ALA 74 74 74 ALA ALA B . n B 1 75 SER 75 75 75 SER SER B . n B 1 76 LYS 76 76 76 LYS LYS B . n B 1 77 VAL 77 77 77 VAL VAL B . n B 1 78 PRO 78 78 78 PRO PRO B . n B 1 79 ALA 79 79 79 ALA ALA B . n B 1 80 PHE 80 80 80 PHE PHE B . n B 1 81 LYS 81 81 81 LYS LYS B . n B 1 82 ALA 82 82 82 ALA ALA B . n B 1 83 GLY 83 83 83 GLY GLY B . n B 1 84 LYS 84 84 84 LYS LYS B . n B 1 85 ALA 85 85 85 ALA ALA B . n B 1 86 LEU 86 86 86 LEU LEU B . n B 1 87 LYS 87 87 87 LYS LYS B . n B 1 88 ASP 88 88 88 ASP ASP B . n B 1 89 ALA 89 89 89 ALA ALA B . n B 1 90 VAL 90 90 90 VAL VAL B . n B 1 91 LYS 91 91 91 LYS LYS B . n B 1 92 HIS 92 92 ? ? ? B . n B 1 93 HIS 93 93 ? ? ? B . n B 1 94 HIS 94 94 ? ? ? B . n B 1 95 HIS 95 95 ? ? ? B . n B 1 96 HIS 96 96 ? ? ? B . n B 1 97 HIS 97 97 ? ? ? B . n B 1 98 HIS 98 98 ? ? ? B . n B 1 99 HIS 99 99 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 101 22 HOH HOH A . C 2 HOH 2 102 34 HOH HOH A . C 2 HOH 3 103 20 HOH HOH A . C 2 HOH 4 104 37 HOH HOH A . C 2 HOH 5 105 56 HOH HOH A . C 2 HOH 6 106 55 HOH HOH A . C 2 HOH 7 107 44 HOH HOH A . C 2 HOH 8 108 29 HOH HOH A . C 2 HOH 9 109 38 HOH HOH A . C 2 HOH 10 110 13 HOH HOH A . C 2 HOH 11 111 2 HOH HOH A . C 2 HOH 12 112 12 HOH HOH A . C 2 HOH 13 113 4 HOH HOH A . C 2 HOH 14 114 51 HOH HOH A . C 2 HOH 15 115 35 HOH HOH A . C 2 HOH 16 116 9 HOH HOH A . C 2 HOH 17 117 28 HOH HOH A . C 2 HOH 18 118 31 HOH HOH A . C 2 HOH 19 119 36 HOH HOH A . C 2 HOH 20 120 25 HOH HOH A . C 2 HOH 21 121 46 HOH HOH A . C 2 HOH 22 122 8 HOH HOH A . C 2 HOH 23 123 33 HOH HOH A . C 2 HOH 24 124 57 HOH HOH A . C 2 HOH 25 125 47 HOH HOH A . C 2 HOH 26 126 53 HOH HOH A . C 2 HOH 27 127 59 HOH HOH A . C 2 HOH 28 128 14 HOH HOH A . C 2 HOH 29 129 52 HOH HOH A . C 2 HOH 30 130 58 HOH HOH A . C 2 HOH 31 131 32 HOH HOH A . C 2 HOH 32 132 42 HOH HOH A . C 2 HOH 33 133 15 HOH HOH A . C 2 HOH 34 134 60 HOH HOH A . D 2 HOH 1 101 19 HOH HOH B . D 2 HOH 2 102 40 HOH HOH B . D 2 HOH 3 103 5 HOH HOH B . D 2 HOH 4 104 18 HOH HOH B . D 2 HOH 5 105 23 HOH HOH B . D 2 HOH 6 106 50 HOH HOH B . D 2 HOH 7 107 49 HOH HOH B . D 2 HOH 8 108 43 HOH HOH B . D 2 HOH 9 109 1 HOH HOH B . D 2 HOH 10 110 21 HOH HOH B . D 2 HOH 11 111 26 HOH HOH B . D 2 HOH 12 112 48 HOH HOH B . D 2 HOH 13 113 11 HOH HOH B . D 2 HOH 14 114 3 HOH HOH B . D 2 HOH 15 115 27 HOH HOH B . D 2 HOH 16 116 30 HOH HOH B . D 2 HOH 17 117 6 HOH HOH B . D 2 HOH 18 118 16 HOH HOH B . D 2 HOH 19 119 45 HOH HOH B . D 2 HOH 20 120 39 HOH HOH B . D 2 HOH 21 121 10 HOH HOH B . D 2 HOH 22 122 7 HOH HOH B . D 2 HOH 23 123 17 HOH HOH B . D 2 HOH 24 124 41 HOH HOH B . D 2 HOH 25 125 54 HOH HOH B . D 2 HOH 26 126 24 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3640 ? 1 MORE -37 ? 1 'SSA (A^2)' 9330 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-04-06 2 'Structure model' 1 1 2018-04-18 3 'Structure model' 1 2 2019-12-11 4 'Structure model' 1 3 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Database references' 4 2 'Structure model' 'Derived calculations' 5 2 'Structure model' 'Structure summary' 6 3 'Structure model' 'Author supporting evidence' 7 4 'Structure model' 'Data collection' 8 4 'Structure model' 'Database references' 9 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation 3 2 'Structure model' citation_author 4 2 'Structure model' pdbx_audit_support 5 2 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' pdbx_audit_support 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' database_2 10 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.name' 6 2 'Structure model' '_pdbx_audit_support.funding_organization' 7 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 8 3 'Structure model' '_pdbx_audit_support.funding_organization' 9 4 'Structure model' '_database_2.pdbx_DOI' 10 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -0.3571 17.7223 16.9672 0.2663 ? 0.0068 ? 0.0186 ? 0.3812 ? 0.0245 ? 0.2488 ? 0.5766 ? -0.0045 ? 0.4462 ? 0.1247 ? -0.1029 ? 0.3446 ? 0.1025 ? -0.6355 ? -0.2503 ? 0.1214 ? 0.1302 ? 0.1675 ? 0.0355 ? -0.7551 ? 0.0151 ? 2 'X-RAY DIFFRACTION' ? refined 9.3937 21.9129 5.9109 0.2658 ? -0.0170 ? 0.0054 ? 0.2558 ? 0.0343 ? 0.2233 ? 0.5641 ? -0.3691 ? 0.4450 ? 0.2328 ? -0.3411 ? 0.3911 ? -0.1386 ? -0.0254 ? 0.0942 ? 0.0680 ? -0.0696 ? -0.0728 ? -0.0748 ? 0.7885 ? -0.0024 ? 3 'X-RAY DIFFRACTION' ? refined 2.4272 27.9122 -14.5987 0.4160 ? 0.2576 ? -0.1220 ? 0.2900 ? -0.1298 ? 0.3284 ? 0.4355 ? 0.5946 ? -0.5648 ? 1.1626 ? -0.7294 ? 0.7973 ? -0.0388 ? -0.1356 ? 0.2488 ? -0.2182 ? -0.6367 ? 0.0876 ? -0.2376 ? -0.0554 ? -0.9285 ? 4 'X-RAY DIFFRACTION' ? refined 1.0375 13.9705 -4.8300 0.2996 ? -0.0099 ? -0.0088 ? 0.2452 ? -0.0118 ? 0.3227 ? 0.2614 ? -0.1899 ? -0.2912 ? 0.1189 ? 0.1768 ? 0.3089 ? -0.3658 ? 0.4567 ? -0.0017 ? -0.0394 ? 0.3229 ? 0.4267 ? 0.1611 ? -0.4476 ? -0.0293 ? 5 'X-RAY DIFFRACTION' ? refined 15.6667 19.4561 10.9657 0.2073 ? -0.0628 ? -0.0302 ? 0.3610 ? -0.0019 ? 0.3999 ? 0.4250 ? -0.7022 ? 0.5439 ? 1.2758 ? -0.9557 ? 0.7242 ? 0.1429 ? 0.1314 ? 0.4616 ? -0.1496 ? -0.4804 ? -0.1436 ? 0.0100 ? 0.8577 ? -0.1176 ? 6 'X-RAY DIFFRACTION' ? refined 4.7391 13.4755 10.5050 0.2088 ? -0.0131 ? 0.0011 ? 0.2273 ? 0.0217 ? 0.2329 ? 0.0566 ? -0.0225 ? -0.1164 ? 0.0000 ? 0.0271 ? 0.2223 ? 0.0085 ? 0.1706 ? -0.2076 ? 0.0667 ? -0.0059 ? -0.0124 ? 0.1398 ? 0.2572 ? 0.0000 ? 7 'X-RAY DIFFRACTION' ? refined -5.2890 21.2345 5.2939 0.2605 ? -0.0165 ? -0.0225 ? 0.3446 ? -0.0215 ? 0.2862 ? 0.3161 ? 0.0785 ? -0.2957 ? 0.0739 ? -0.0659 ? 0.2760 ? 0.3394 ? 0.2396 ? -0.1749 ? 0.2932 ? 0.0422 ? 0.1541 ? -0.0510 ? -0.7590 ? 0.0185 ? 8 'X-RAY DIFFRACTION' ? refined -6.8867 17.0010 -3.5255 0.2895 ? 0.0448 ? -0.0804 ? 0.3712 ? -0.0264 ? 0.2526 ? 0.3619 ? 0.4245 ? 0.0309 ? 0.5589 ? 0.0424 ? 0.0134 ? 0.4182 ? -0.2658 ? 0.0305 ? -0.2039 ? -0.4677 ? 0.1840 ? 0.1177 ? -0.4400 ? 0.0258 ? 9 'X-RAY DIFFRACTION' ? refined -14.2910 3.7874 -16.9716 0.3923 ? -0.0864 ? -0.0708 ? 0.2307 ? -0.0194 ? 0.3710 ? 0.0360 ? 0.0084 ? -0.0092 ? 0.0259 ? -0.0185 ? 0.0156 ? 0.1745 ? 0.0100 ? -0.3260 ? -0.1311 ? 0.1796 ? 0.2907 ? -0.0963 ? 0.0591 ? 0.0026 ? 10 'X-RAY DIFFRACTION' ? refined 0.0608 25.4968 -3.6111 0.3389 ? 0.0186 ? 0.0656 ? 0.1553 ? 0.0133 ? 0.2611 ? 0.0970 ? 0.0457 ? -0.0380 ? 0.0460 ? -0.1200 ? 0.5673 ? -0.0226 ? 0.3709 ? 0.0055 ? -0.4867 ? 0.2300 ? -0.3531 ? -0.2466 ? -0.3006 ? 0.1213 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 2 through 18 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 19 through 48 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 49 through 74 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 75 through 92 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? B 0 ? ? B 0 ? ;chain 'B' and (resid 2 through 18 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? B 0 ? ? B 0 ? ;chain 'B' and (resid 19 through 38 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? B 0 ? ? B 0 ? ;chain 'B' and (resid 39 through 48 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? B 0 ? ? B 0 ? ;chain 'B' and (resid 49 through 56 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? B 0 ? ? B 0 ? ;chain 'B' and (resid 57 through 74 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? B 0 ? ? B 0 ? ;chain 'B' and (resid 75 through 91 ) ; # _pdbx_phasing_MR.entry_id 5FBM _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 3.040 _pdbx_phasing_MR.d_res_low_rotation 38.170 _pdbx_phasing_MR.d_res_high_translation 3.040 _pdbx_phasing_MR.d_res_low_translation 38.170 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.2.14 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.5 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 48 ? ? -135.58 -68.50 2 1 PHE B 48 ? ? -138.31 -67.48 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 10 ? CE ? A LYS 10 CE 2 1 Y 1 A LYS 10 ? NZ ? A LYS 10 NZ 3 1 Y 1 A ARG 56 ? NE ? A ARG 56 NE 4 1 Y 1 A ARG 56 ? CZ ? A ARG 56 CZ 5 1 Y 1 A ARG 56 ? NH1 ? A ARG 56 NH1 6 1 Y 1 A ARG 56 ? NH2 ? A ARG 56 NH2 7 1 Y 1 A LYS 60 ? CG ? A LYS 60 CG 8 1 Y 1 A LYS 60 ? CD ? A LYS 60 CD 9 1 Y 1 A LYS 60 ? CE ? A LYS 60 CE 10 1 Y 1 A LYS 60 ? NZ ? A LYS 60 NZ 11 1 Y 1 A GLU 69 ? CG ? A GLU 69 CG 12 1 Y 1 A GLU 69 ? CD ? A GLU 69 CD 13 1 Y 1 A GLU 69 ? OE1 ? A GLU 69 OE1 14 1 Y 1 A GLU 69 ? OE2 ? A GLU 69 OE2 15 1 Y 1 A LYS 71 ? CD ? A LYS 71 CD 16 1 Y 1 A LYS 71 ? CE ? A LYS 71 CE 17 1 Y 1 A LYS 71 ? NZ ? A LYS 71 NZ 18 1 Y 1 A LYS 73 ? CG ? A LYS 73 CG 19 1 Y 1 A LYS 73 ? CD ? A LYS 73 CD 20 1 Y 1 A LYS 73 ? CE ? A LYS 73 CE 21 1 Y 1 A LYS 73 ? NZ ? A LYS 73 NZ 22 1 Y 1 A LYS 91 ? CG ? A LYS 91 CG 23 1 Y 1 A LYS 91 ? CD ? A LYS 91 CD 24 1 Y 1 A LYS 91 ? CE ? A LYS 91 CE 25 1 Y 1 A LYS 91 ? NZ ? A LYS 91 NZ 26 1 Y 1 A HIS 92 ? CG ? A HIS 92 CG 27 1 Y 1 A HIS 92 ? ND1 ? A HIS 92 ND1 28 1 Y 1 A HIS 92 ? CD2 ? A HIS 92 CD2 29 1 Y 1 A HIS 92 ? CE1 ? A HIS 92 CE1 30 1 Y 1 A HIS 92 ? NE2 ? A HIS 92 NE2 31 1 Y 1 B GLU 16 ? CG ? B GLU 16 CG 32 1 Y 1 B GLU 16 ? CD ? B GLU 16 CD 33 1 Y 1 B GLU 16 ? OE1 ? B GLU 16 OE1 34 1 Y 1 B GLU 16 ? OE2 ? B GLU 16 OE2 35 1 Y 1 B LYS 20 ? CD ? B LYS 20 CD 36 1 Y 1 B LYS 20 ? CE ? B LYS 20 CE 37 1 Y 1 B LYS 20 ? NZ ? B LYS 20 NZ 38 1 Y 1 B ARG 54 ? NE ? B ARG 54 NE 39 1 Y 1 B ARG 54 ? CZ ? B ARG 54 CZ 40 1 Y 1 B ARG 54 ? NH1 ? B ARG 54 NH1 41 1 Y 1 B ARG 54 ? NH2 ? B ARG 54 NH2 42 1 Y 1 B GLU 68 ? CG ? B GLU 68 CG 43 1 Y 1 B GLU 68 ? CD ? B GLU 68 CD 44 1 Y 1 B GLU 68 ? OE1 ? B GLU 68 OE1 45 1 Y 1 B GLU 68 ? OE2 ? B GLU 68 OE2 46 1 Y 1 B GLU 69 ? CG ? B GLU 69 CG 47 1 Y 1 B GLU 69 ? CD ? B GLU 69 CD 48 1 Y 1 B GLU 69 ? OE1 ? B GLU 69 OE1 49 1 Y 1 B GLU 69 ? OE2 ? B GLU 69 OE2 50 1 Y 1 B LYS 76 ? CG ? B LYS 76 CG 51 1 Y 1 B LYS 76 ? CD ? B LYS 76 CD 52 1 Y 1 B LYS 76 ? CE ? B LYS 76 CE 53 1 Y 1 B LYS 76 ? NZ ? B LYS 76 NZ 54 1 Y 1 B LYS 81 ? CD ? B LYS 81 CD 55 1 Y 1 B LYS 81 ? CE ? B LYS 81 CE 56 1 Y 1 B LYS 81 ? NZ ? B LYS 81 NZ 57 1 Y 1 B LYS 91 ? CG ? B LYS 91 CG 58 1 Y 1 B LYS 91 ? CD ? B LYS 91 CD 59 1 Y 1 B LYS 91 ? CE ? B LYS 91 CE 60 1 Y 1 B LYS 91 ? NZ ? B LYS 91 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 61 ? A GLY 61 3 1 Y 1 A ARG 62 ? A ARG 62 4 1 Y 1 A ASN 63 ? A ASN 63 5 1 Y 1 A PRO 64 ? A PRO 64 6 1 Y 1 A GLN 65 ? A GLN 65 7 1 Y 1 A THR 66 ? A THR 66 8 1 Y 1 A GLY 67 ? A GLY 67 9 1 Y 1 A GLU 68 ? A GLU 68 10 1 Y 1 A HIS 93 ? A HIS 93 11 1 Y 1 A HIS 94 ? A HIS 94 12 1 Y 1 A HIS 95 ? A HIS 95 13 1 Y 1 A HIS 96 ? A HIS 96 14 1 Y 1 A HIS 97 ? A HIS 97 15 1 Y 1 A HIS 98 ? A HIS 98 16 1 Y 1 A HIS 99 ? A HIS 99 17 1 Y 1 B MET 1 ? B MET 1 18 1 Y 1 B GLY 61 ? B GLY 61 19 1 Y 1 B ARG 62 ? B ARG 62 20 1 Y 1 B ASN 63 ? B ASN 63 21 1 Y 1 B PRO 64 ? B PRO 64 22 1 Y 1 B GLN 65 ? B GLN 65 23 1 Y 1 B THR 66 ? B THR 66 24 1 Y 1 B GLY 67 ? B GLY 67 25 1 Y 1 B HIS 92 ? B HIS 92 26 1 Y 1 B HIS 93 ? B HIS 93 27 1 Y 1 B HIS 94 ? B HIS 94 28 1 Y 1 B HIS 95 ? B HIS 95 29 1 Y 1 B HIS 96 ? B HIS 96 30 1 Y 1 B HIS 97 ? B HIS 97 31 1 Y 1 B HIS 98 ? B HIS 98 32 1 Y 1 B HIS 99 ? B HIS 99 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TYR N N N N 307 TYR CA C N S 308 TYR C C N N 309 TYR O O N N 310 TYR CB C N N 311 TYR CG C Y N 312 TYR CD1 C Y N 313 TYR CD2 C Y N 314 TYR CE1 C Y N 315 TYR CE2 C Y N 316 TYR CZ C Y N 317 TYR OH O N N 318 TYR OXT O N N 319 TYR H H N N 320 TYR H2 H N N 321 TYR HA H N N 322 TYR HB2 H N N 323 TYR HB3 H N N 324 TYR HD1 H N N 325 TYR HD2 H N N 326 TYR HE1 H N N 327 TYR HE2 H N N 328 TYR HH H N N 329 TYR HXT H N N 330 VAL N N N N 331 VAL CA C N S 332 VAL C C N N 333 VAL O O N N 334 VAL CB C N N 335 VAL CG1 C N N 336 VAL CG2 C N N 337 VAL OXT O N N 338 VAL H H N N 339 VAL H2 H N N 340 VAL HA H N N 341 VAL HB H N N 342 VAL HG11 H N N 343 VAL HG12 H N N 344 VAL HG13 H N N 345 VAL HG21 H N N 346 VAL HG22 H N N 347 VAL HG23 H N N 348 VAL HXT H N N 349 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of Dental and Craniofacial Research (NIH/NIDCR)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number DE021664 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3RHI _pdbx_initial_refinement_model.details ? #