data_5FDA # _entry.id 5FDA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5FDA pdb_00005fda 10.2210/pdb5fda/pdb WWPDB D_1000216398 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-30 2 'Structure model' 1 1 2018-01-24 3 'Structure model' 1 2 2023-09-27 4 'Structure model' 1 3 2023-11-15 5 'Structure model' 1 4 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation_author 2 2 'Structure model' pdbx_struct_oper_list 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' struct_ref 10 5 'Structure model' pdbx_entry_details 11 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation_author.name' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_chem_comp_atom.atom_id' 6 4 'Structure model' '_chem_comp_bond.atom_id_2' 7 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5FDA _pdbx_database_status.recvd_initial_deposition_date 2015-12-15 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.details . _pdbx_database_related.db_id CSGID-IDP90544 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chang, C.' 1 'Maltseva, N.' 2 'Kim, Y.' 3 'Makowska-Grzyska, M.' 4 'Mulligan, R.' 5 'Papazisi, L.' 6 'Anderson, W.F.' 7 'Joachimiak, A.' 8 'Center for Structural Genomics of Infectious Diseases (CSGID)' 9 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'structure of dihydrofolate reductase from Yersinia pestis complex with' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chang, C.' 1 ? primary 'Maltseva, N.' 2 ? primary 'Kim, Y.' 3 ? primary 'Makowska-Grzyska, M.' 4 ? primary 'Mulligan, R.' 5 ? primary 'Papazisi, L.' 6 ? primary 'Anderson, W.F.' 7 ? primary 'Joachimiak, A.' 8 ? primary 'Center for Structural Genomics of Infectious Diseases (CSGID)' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dihydrofolate reductase' 18678.918 1 1.5.1.3 ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 3 water nat water 18.015 187 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNA(MSE)IISLIAALAADRVIG(MSE)ENA(MSE)PWHLPADLAWFKRNTLNKPVI(MSE)GRKTFESIGRPLPGRLNI VISSQPGTDERVTWAASIEEALAFAGNAEEV(MSE)V(MSE)GGGRVYKQFLDRANR(MSE)YLTHIDAEVGGDTHFPDY EPDEWESVFSEFHDADEANSHSYCFEILERR ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLNIVISSQPGTDERVTWAA SIEEALAFAGNAEEVMVMGGGRVYKQFLDRANRMYLTHIDAEVGGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEIL ERR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CSGID-IDP90544 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MSE n 1 5 ILE n 1 6 ILE n 1 7 SER n 1 8 LEU n 1 9 ILE n 1 10 ALA n 1 11 ALA n 1 12 LEU n 1 13 ALA n 1 14 ALA n 1 15 ASP n 1 16 ARG n 1 17 VAL n 1 18 ILE n 1 19 GLY n 1 20 MSE n 1 21 GLU n 1 22 ASN n 1 23 ALA n 1 24 MSE n 1 25 PRO n 1 26 TRP n 1 27 HIS n 1 28 LEU n 1 29 PRO n 1 30 ALA n 1 31 ASP n 1 32 LEU n 1 33 ALA n 1 34 TRP n 1 35 PHE n 1 36 LYS n 1 37 ARG n 1 38 ASN n 1 39 THR n 1 40 LEU n 1 41 ASN n 1 42 LYS n 1 43 PRO n 1 44 VAL n 1 45 ILE n 1 46 MSE n 1 47 GLY n 1 48 ARG n 1 49 LYS n 1 50 THR n 1 51 PHE n 1 52 GLU n 1 53 SER n 1 54 ILE n 1 55 GLY n 1 56 ARG n 1 57 PRO n 1 58 LEU n 1 59 PRO n 1 60 GLY n 1 61 ARG n 1 62 LEU n 1 63 ASN n 1 64 ILE n 1 65 VAL n 1 66 ILE n 1 67 SER n 1 68 SER n 1 69 GLN n 1 70 PRO n 1 71 GLY n 1 72 THR n 1 73 ASP n 1 74 GLU n 1 75 ARG n 1 76 VAL n 1 77 THR n 1 78 TRP n 1 79 ALA n 1 80 ALA n 1 81 SER n 1 82 ILE n 1 83 GLU n 1 84 GLU n 1 85 ALA n 1 86 LEU n 1 87 ALA n 1 88 PHE n 1 89 ALA n 1 90 GLY n 1 91 ASN n 1 92 ALA n 1 93 GLU n 1 94 GLU n 1 95 VAL n 1 96 MSE n 1 97 VAL n 1 98 MSE n 1 99 GLY n 1 100 GLY n 1 101 GLY n 1 102 ARG n 1 103 VAL n 1 104 TYR n 1 105 LYS n 1 106 GLN n 1 107 PHE n 1 108 LEU n 1 109 ASP n 1 110 ARG n 1 111 ALA n 1 112 ASN n 1 113 ARG n 1 114 MSE n 1 115 TYR n 1 116 LEU n 1 117 THR n 1 118 HIS n 1 119 ILE n 1 120 ASP n 1 121 ALA n 1 122 GLU n 1 123 VAL n 1 124 GLY n 1 125 GLY n 1 126 ASP n 1 127 THR n 1 128 HIS n 1 129 PHE n 1 130 PRO n 1 131 ASP n 1 132 TYR n 1 133 GLU n 1 134 PRO n 1 135 ASP n 1 136 GLU n 1 137 TRP n 1 138 GLU n 1 139 SER n 1 140 VAL n 1 141 PHE n 1 142 SER n 1 143 GLU n 1 144 PHE n 1 145 HIS n 1 146 ASP n 1 147 ALA n 1 148 ASP n 1 149 GLU n 1 150 ALA n 1 151 ASN n 1 152 SER n 1 153 HIS n 1 154 SER n 1 155 TYR n 1 156 CYS n 1 157 PHE n 1 158 GLU n 1 159 ILE n 1 160 LEU n 1 161 GLU n 1 162 ARG n 1 163 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 163 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'folA, AK38_2080' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Yersinia pestis CO92' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 214092 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 0 ALA ALA A . n A 1 4 MSE 4 1 1 MSE MSE A . n A 1 5 ILE 5 2 2 ILE ILE A . n A 1 6 ILE 6 3 3 ILE ILE A . n A 1 7 SER 7 4 4 SER SER A . n A 1 8 LEU 8 5 5 LEU LEU A . n A 1 9 ILE 9 6 6 ILE ILE A . n A 1 10 ALA 10 7 7 ALA ALA A . n A 1 11 ALA 11 8 8 ALA ALA A . n A 1 12 LEU 12 9 9 LEU LEU A . n A 1 13 ALA 13 10 10 ALA ALA A . n A 1 14 ALA 14 11 11 ALA ALA A . n A 1 15 ASP 15 12 12 ASP ASP A . n A 1 16 ARG 16 13 13 ARG ARG A . n A 1 17 VAL 17 14 14 VAL VAL A . n A 1 18 ILE 18 15 15 ILE ILE A . n A 1 19 GLY 19 16 16 GLY GLY A . n A 1 20 MSE 20 17 17 MSE MSE A . n A 1 21 GLU 21 18 18 GLU GLU A . n A 1 22 ASN 22 19 19 ASN ASN A . n A 1 23 ALA 23 20 20 ALA ALA A . n A 1 24 MSE 24 21 21 MSE MSE A . n A 1 25 PRO 25 22 22 PRO PRO A . n A 1 26 TRP 26 23 23 TRP TRP A . n A 1 27 HIS 27 24 24 HIS HIS A . n A 1 28 LEU 28 25 25 LEU LEU A . n A 1 29 PRO 29 26 26 PRO PRO A . n A 1 30 ALA 30 27 27 ALA ALA A . n A 1 31 ASP 31 28 28 ASP ASP A . n A 1 32 LEU 32 29 29 LEU LEU A . n A 1 33 ALA 33 30 30 ALA ALA A . n A 1 34 TRP 34 31 31 TRP TRP A . n A 1 35 PHE 35 32 32 PHE PHE A . n A 1 36 LYS 36 33 33 LYS LYS A . n A 1 37 ARG 37 34 34 ARG ARG A . n A 1 38 ASN 38 35 35 ASN ASN A . n A 1 39 THR 39 36 36 THR THR A . n A 1 40 LEU 40 37 37 LEU LEU A . n A 1 41 ASN 41 38 38 ASN ASN A . n A 1 42 LYS 42 39 39 LYS LYS A . n A 1 43 PRO 43 40 40 PRO PRO A . n A 1 44 VAL 44 41 41 VAL VAL A . n A 1 45 ILE 45 42 42 ILE ILE A . n A 1 46 MSE 46 43 43 MSE MSE A . n A 1 47 GLY 47 44 44 GLY GLY A . n A 1 48 ARG 48 45 45 ARG ARG A . n A 1 49 LYS 49 46 46 LYS LYS A . n A 1 50 THR 50 47 47 THR THR A . n A 1 51 PHE 51 48 48 PHE PHE A . n A 1 52 GLU 52 49 49 GLU GLU A . n A 1 53 SER 53 50 50 SER SER A . n A 1 54 ILE 54 51 51 ILE ILE A . n A 1 55 GLY 55 52 52 GLY GLY A . n A 1 56 ARG 56 53 53 ARG ARG A . n A 1 57 PRO 57 54 54 PRO PRO A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 PRO 59 56 56 PRO PRO A . n A 1 60 GLY 60 57 57 GLY GLY A . n A 1 61 ARG 61 58 58 ARG ARG A . n A 1 62 LEU 62 59 59 LEU LEU A . n A 1 63 ASN 63 60 60 ASN ASN A . n A 1 64 ILE 64 61 61 ILE ILE A . n A 1 65 VAL 65 62 62 VAL VAL A . n A 1 66 ILE 66 63 63 ILE ILE A . n A 1 67 SER 67 64 64 SER SER A . n A 1 68 SER 68 65 65 SER SER A . n A 1 69 GLN 69 66 66 GLN GLN A . n A 1 70 PRO 70 67 67 PRO PRO A . n A 1 71 GLY 71 68 68 GLY GLY A . n A 1 72 THR 72 69 69 THR THR A . n A 1 73 ASP 73 70 70 ASP ASP A . n A 1 74 GLU 74 71 71 GLU GLU A . n A 1 75 ARG 75 72 72 ARG ARG A . n A 1 76 VAL 76 73 73 VAL VAL A . n A 1 77 THR 77 74 74 THR THR A . n A 1 78 TRP 78 75 75 TRP TRP A . n A 1 79 ALA 79 76 76 ALA ALA A . n A 1 80 ALA 80 77 77 ALA ALA A . n A 1 81 SER 81 78 78 SER SER A . n A 1 82 ILE 82 79 79 ILE ILE A . n A 1 83 GLU 83 80 80 GLU GLU A . n A 1 84 GLU 84 81 81 GLU GLU A . n A 1 85 ALA 85 82 82 ALA ALA A . n A 1 86 LEU 86 83 83 LEU LEU A . n A 1 87 ALA 87 84 84 ALA ALA A . n A 1 88 PHE 88 85 85 PHE PHE A . n A 1 89 ALA 89 86 86 ALA ALA A . n A 1 90 GLY 90 87 87 GLY GLY A . n A 1 91 ASN 91 88 88 ASN ASN A . n A 1 92 ALA 92 89 89 ALA ALA A . n A 1 93 GLU 93 90 90 GLU GLU A . n A 1 94 GLU 94 91 91 GLU GLU A . n A 1 95 VAL 95 92 92 VAL VAL A . n A 1 96 MSE 96 93 93 MSE MSE A . n A 1 97 VAL 97 94 94 VAL VAL A . n A 1 98 MSE 98 95 95 MSE MSE A . n A 1 99 GLY 99 96 96 GLY GLY A . n A 1 100 GLY 100 97 97 GLY GLY A . n A 1 101 GLY 101 98 98 GLY GLY A . n A 1 102 ARG 102 99 99 ARG ARG A . n A 1 103 VAL 103 100 100 VAL VAL A . n A 1 104 TYR 104 101 101 TYR TYR A . n A 1 105 LYS 105 102 102 LYS LYS A . n A 1 106 GLN 106 103 103 GLN GLN A . n A 1 107 PHE 107 104 104 PHE PHE A . n A 1 108 LEU 108 105 105 LEU LEU A . n A 1 109 ASP 109 106 106 ASP ASP A . n A 1 110 ARG 110 107 107 ARG ARG A . n A 1 111 ALA 111 108 108 ALA ALA A . n A 1 112 ASN 112 109 109 ASN ASN A . n A 1 113 ARG 113 110 110 ARG ARG A . n A 1 114 MSE 114 111 111 MSE MSE A . n A 1 115 TYR 115 112 112 TYR TYR A . n A 1 116 LEU 116 113 113 LEU LEU A . n A 1 117 THR 117 114 114 THR THR A . n A 1 118 HIS 118 115 115 HIS HIS A . n A 1 119 ILE 119 116 116 ILE ILE A . n A 1 120 ASP 120 117 117 ASP ASP A . n A 1 121 ALA 121 118 118 ALA ALA A . n A 1 122 GLU 122 119 119 GLU GLU A . n A 1 123 VAL 123 120 120 VAL VAL A . n A 1 124 GLY 124 121 121 GLY GLY A . n A 1 125 GLY 125 122 122 GLY GLY A . n A 1 126 ASP 126 123 123 ASP ASP A . n A 1 127 THR 127 124 124 THR THR A . n A 1 128 HIS 128 125 125 HIS HIS A . n A 1 129 PHE 129 126 126 PHE PHE A . n A 1 130 PRO 130 127 127 PRO PRO A . n A 1 131 ASP 131 128 128 ASP ASP A . n A 1 132 TYR 132 129 129 TYR TYR A . n A 1 133 GLU 133 130 130 GLU GLU A . n A 1 134 PRO 134 131 131 PRO PRO A . n A 1 135 ASP 135 132 132 ASP ASP A . n A 1 136 GLU 136 133 133 GLU GLU A . n A 1 137 TRP 137 134 134 TRP TRP A . n A 1 138 GLU 138 135 135 GLU GLU A . n A 1 139 SER 139 136 136 SER SER A . n A 1 140 VAL 140 137 137 VAL VAL A . n A 1 141 PHE 141 138 138 PHE PHE A . n A 1 142 SER 142 139 139 SER SER A . n A 1 143 GLU 143 140 140 GLU GLU A . n A 1 144 PHE 144 141 141 PHE PHE A . n A 1 145 HIS 145 142 142 HIS HIS A . n A 1 146 ASP 146 143 143 ASP ASP A . n A 1 147 ALA 147 144 144 ALA ALA A . n A 1 148 ASP 148 145 145 ASP ASP A . n A 1 149 GLU 149 146 146 GLU GLU A . n A 1 150 ALA 150 147 147 ALA ALA A . n A 1 151 ASN 151 148 148 ASN ASN A . n A 1 152 SER 152 149 149 SER SER A . n A 1 153 HIS 153 150 150 HIS HIS A . n A 1 154 SER 154 151 151 SER SER A . n A 1 155 TYR 155 152 152 TYR TYR A . n A 1 156 CYS 156 153 153 CYS CYS A . n A 1 157 PHE 157 154 154 PHE PHE A . n A 1 158 GLU 158 155 155 GLU GLU A . n A 1 159 ILE 159 156 156 ILE ILE A . n A 1 160 LEU 160 157 157 LEU LEU A . n A 1 161 GLU 161 158 158 GLU GLU A . n A 1 162 ARG 162 159 159 ARG ARG A . n A 1 163 ARG 163 160 160 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 201 201 CL CL A . C 2 CL 1 202 202 CL CL A . D 2 CL 1 203 203 CL CL A . E 3 HOH 1 301 165 HOH HOH A . E 3 HOH 2 302 175 HOH HOH A . E 3 HOH 3 303 186 HOH HOH A . E 3 HOH 4 304 170 HOH HOH A . E 3 HOH 5 305 122 HOH HOH A . E 3 HOH 6 306 125 HOH HOH A . E 3 HOH 7 307 172 HOH HOH A . E 3 HOH 8 308 96 HOH HOH A . E 3 HOH 9 309 24 HOH HOH A . E 3 HOH 10 310 37 HOH HOH A . E 3 HOH 11 311 67 HOH HOH A . E 3 HOH 12 312 138 HOH HOH A . E 3 HOH 13 313 16 HOH HOH A . E 3 HOH 14 314 112 HOH HOH A . E 3 HOH 15 315 184 HOH HOH A . E 3 HOH 16 316 157 HOH HOH A . E 3 HOH 17 317 53 HOH HOH A . E 3 HOH 18 318 42 HOH HOH A . E 3 HOH 19 319 70 HOH HOH A . E 3 HOH 20 320 46 HOH HOH A . E 3 HOH 21 321 109 HOH HOH A . E 3 HOH 22 322 94 HOH HOH A . E 3 HOH 23 323 28 HOH HOH A . E 3 HOH 24 324 57 HOH HOH A . E 3 HOH 25 325 143 HOH HOH A . E 3 HOH 26 326 180 HOH HOH A . E 3 HOH 27 327 17 HOH HOH A . E 3 HOH 28 328 26 HOH HOH A . E 3 HOH 29 329 102 HOH HOH A . E 3 HOH 30 330 173 HOH HOH A . E 3 HOH 31 331 66 HOH HOH A . E 3 HOH 32 332 72 HOH HOH A . E 3 HOH 33 333 78 HOH HOH A . E 3 HOH 34 334 76 HOH HOH A . E 3 HOH 35 335 77 HOH HOH A . E 3 HOH 36 336 30 HOH HOH A . E 3 HOH 37 337 71 HOH HOH A . E 3 HOH 38 338 51 HOH HOH A . E 3 HOH 39 339 85 HOH HOH A . E 3 HOH 40 340 134 HOH HOH A . E 3 HOH 41 341 14 HOH HOH A . E 3 HOH 42 342 110 HOH HOH A . E 3 HOH 43 343 132 HOH HOH A . E 3 HOH 44 344 25 HOH HOH A . E 3 HOH 45 345 93 HOH HOH A . E 3 HOH 46 346 49 HOH HOH A . E 3 HOH 47 347 144 HOH HOH A . E 3 HOH 48 348 22 HOH HOH A . E 3 HOH 49 349 140 HOH HOH A . E 3 HOH 50 350 64 HOH HOH A . E 3 HOH 51 351 100 HOH HOH A . E 3 HOH 52 352 65 HOH HOH A . E 3 HOH 53 353 79 HOH HOH A . E 3 HOH 54 354 104 HOH HOH A . E 3 HOH 55 355 9 HOH HOH A . E 3 HOH 56 356 137 HOH HOH A . E 3 HOH 57 357 12 HOH HOH A . E 3 HOH 58 358 1 HOH HOH A . E 3 HOH 59 359 106 HOH HOH A . E 3 HOH 60 360 84 HOH HOH A . E 3 HOH 61 361 56 HOH HOH A . E 3 HOH 62 362 163 HOH HOH A . E 3 HOH 63 363 48 HOH HOH A . E 3 HOH 64 364 34 HOH HOH A . E 3 HOH 65 365 2 HOH HOH A . E 3 HOH 66 366 18 HOH HOH A . E 3 HOH 67 367 124 HOH HOH A . E 3 HOH 68 368 4 HOH HOH A . E 3 HOH 69 369 135 HOH HOH A . E 3 HOH 70 370 21 HOH HOH A . E 3 HOH 71 371 99 HOH HOH A . E 3 HOH 72 372 89 HOH HOH A . E 3 HOH 73 373 166 HOH HOH A . E 3 HOH 74 374 90 HOH HOH A . E 3 HOH 75 375 136 HOH HOH A . E 3 HOH 76 376 40 HOH HOH A . E 3 HOH 77 377 10 HOH HOH A . E 3 HOH 78 378 43 HOH HOH A . E 3 HOH 79 379 91 HOH HOH A . E 3 HOH 80 380 111 HOH HOH A . E 3 HOH 81 381 31 HOH HOH A . E 3 HOH 82 382 61 HOH HOH A . E 3 HOH 83 383 73 HOH HOH A . E 3 HOH 84 384 81 HOH HOH A . E 3 HOH 85 385 141 HOH HOH A . E 3 HOH 86 386 97 HOH HOH A . E 3 HOH 87 387 92 HOH HOH A . E 3 HOH 88 388 35 HOH HOH A . E 3 HOH 89 389 54 HOH HOH A . E 3 HOH 90 390 80 HOH HOH A . E 3 HOH 91 391 5 HOH HOH A . E 3 HOH 92 392 179 HOH HOH A . E 3 HOH 93 393 32 HOH HOH A . E 3 HOH 94 394 39 HOH HOH A . E 3 HOH 95 395 19 HOH HOH A . E 3 HOH 96 396 113 HOH HOH A . E 3 HOH 97 397 82 HOH HOH A . E 3 HOH 98 398 29 HOH HOH A . E 3 HOH 99 399 58 HOH HOH A . E 3 HOH 100 400 45 HOH HOH A . E 3 HOH 101 401 87 HOH HOH A . E 3 HOH 102 402 60 HOH HOH A . E 3 HOH 103 403 52 HOH HOH A . E 3 HOH 104 404 47 HOH HOH A . E 3 HOH 105 405 15 HOH HOH A . E 3 HOH 106 406 8 HOH HOH A . E 3 HOH 107 407 41 HOH HOH A . E 3 HOH 108 408 11 HOH HOH A . E 3 HOH 109 409 115 HOH HOH A . E 3 HOH 110 410 83 HOH HOH A . E 3 HOH 111 411 130 HOH HOH A . E 3 HOH 112 412 6 HOH HOH A . E 3 HOH 113 413 119 HOH HOH A . E 3 HOH 114 414 7 HOH HOH A . E 3 HOH 115 415 139 HOH HOH A . E 3 HOH 116 416 151 HOH HOH A . E 3 HOH 117 417 23 HOH HOH A . E 3 HOH 118 418 44 HOH HOH A . E 3 HOH 119 419 20 HOH HOH A . E 3 HOH 120 420 86 HOH HOH A . E 3 HOH 121 421 69 HOH HOH A . E 3 HOH 122 422 129 HOH HOH A . E 3 HOH 123 423 150 HOH HOH A . E 3 HOH 124 424 63 HOH HOH A . E 3 HOH 125 425 177 HOH HOH A . E 3 HOH 126 426 145 HOH HOH A . E 3 HOH 127 427 50 HOH HOH A . E 3 HOH 128 428 108 HOH HOH A . E 3 HOH 129 429 114 HOH HOH A . E 3 HOH 130 430 123 HOH HOH A . E 3 HOH 131 431 13 HOH HOH A . E 3 HOH 132 432 68 HOH HOH A . E 3 HOH 133 433 128 HOH HOH A . E 3 HOH 134 434 38 HOH HOH A . E 3 HOH 135 435 148 HOH HOH A . E 3 HOH 136 436 74 HOH HOH A . E 3 HOH 137 437 182 HOH HOH A . E 3 HOH 138 438 142 HOH HOH A . E 3 HOH 139 439 88 HOH HOH A . E 3 HOH 140 440 169 HOH HOH A . E 3 HOH 141 441 36 HOH HOH A . E 3 HOH 142 442 154 HOH HOH A . E 3 HOH 143 443 3 HOH HOH A . E 3 HOH 144 444 75 HOH HOH A . E 3 HOH 145 445 178 HOH HOH A . E 3 HOH 146 446 171 HOH HOH A . E 3 HOH 147 447 126 HOH HOH A . E 3 HOH 148 448 121 HOH HOH A . E 3 HOH 149 449 107 HOH HOH A . E 3 HOH 150 450 118 HOH HOH A . E 3 HOH 151 451 185 HOH HOH A . E 3 HOH 152 452 101 HOH HOH A . E 3 HOH 153 453 153 HOH HOH A . E 3 HOH 154 454 116 HOH HOH A . E 3 HOH 155 455 59 HOH HOH A . E 3 HOH 156 456 127 HOH HOH A . E 3 HOH 157 457 176 HOH HOH A . E 3 HOH 158 458 105 HOH HOH A . E 3 HOH 159 459 62 HOH HOH A . E 3 HOH 160 460 156 HOH HOH A . E 3 HOH 161 461 187 HOH HOH A . E 3 HOH 162 462 167 HOH HOH A . E 3 HOH 163 463 27 HOH HOH A . E 3 HOH 164 464 33 HOH HOH A . E 3 HOH 165 465 120 HOH HOH A . E 3 HOH 166 466 164 HOH HOH A . E 3 HOH 167 467 162 HOH HOH A . E 3 HOH 168 468 98 HOH HOH A . E 3 HOH 169 469 149 HOH HOH A . E 3 HOH 170 470 131 HOH HOH A . E 3 HOH 171 471 174 HOH HOH A . E 3 HOH 172 472 152 HOH HOH A . E 3 HOH 173 473 117 HOH HOH A . E 3 HOH 174 474 161 HOH HOH A . E 3 HOH 175 475 103 HOH HOH A . E 3 HOH 176 476 160 HOH HOH A . E 3 HOH 177 477 183 HOH HOH A . E 3 HOH 178 478 146 HOH HOH A . E 3 HOH 179 479 133 HOH HOH A . E 3 HOH 180 480 147 HOH HOH A . E 3 HOH 181 481 55 HOH HOH A . E 3 HOH 182 482 181 HOH HOH A . E 3 HOH 183 483 95 HOH HOH A . E 3 HOH 184 484 158 HOH HOH A . E 3 HOH 185 485 159 HOH HOH A . E 3 HOH 186 486 155 HOH HOH A . E 3 HOH 187 487 168 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 119 ? CG ? A GLU 122 CG 2 1 Y 1 A GLU 119 ? CD ? A GLU 122 CD 3 1 Y 1 A GLU 119 ? OE1 ? A GLU 122 OE1 4 1 Y 1 A GLU 119 ? OE2 ? A GLU 122 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10_2155: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? BUCCANEER ? ? ? . 7 # _cell.entry_id 5FDA _cell.length_a 60.265 _cell.length_b 79.201 _cell.length_c 64.321 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FDA _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5FDA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.12 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.11 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 297 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M Sodium Acetate, 3.0 M Sodium chloride ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2010-12-09 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111) double crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97912 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97912 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 12.970 _reflns.entry_id 5FDA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.549 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22728 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.300 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 42.923 _reflns.pdbx_netI_over_sigmaI 16.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.957 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.050 _reflns.pdbx_Rpim_I_all 0.018 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 166938 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.550 1.580 ? ? ? ? ? 1085 ? 98.000 ? ? ? ? 0.688 ? ? ? ? ? ? ? ? 3.900 ? 0.873 ? ? 0.796 0.391 0 1 1 0.733 ? 1.580 1.610 ? ? ? ? ? 1140 ? 99.700 ? ? ? ? 0.609 ? ? ? ? ? ? ? ? 4.700 ? 0.912 ? ? 0.687 0.313 0 2 1 0.816 ? 1.610 1.640 ? ? ? ? ? 1089 ? 100.000 ? ? ? ? 0.594 ? ? ? ? ? ? ? ? 5.800 ? 0.916 ? ? 0.653 0.268 0 3 1 0.864 ? 1.640 1.670 ? ? ? ? ? 1143 ? 100.000 ? ? ? ? 0.499 ? ? ? ? ? ? ? ? 6.700 ? 0.940 ? ? 0.541 0.207 0 4 1 0.912 ? 1.670 1.710 ? ? ? ? ? 1104 ? 100.000 ? ? ? ? 0.444 ? ? ? ? ? ? ? ? 7.500 ? 0.941 ? ? 0.477 0.172 0 5 1 0.941 ? 1.710 1.750 ? ? ? ? ? 1124 ? 100.000 ? ? ? ? 0.359 ? ? ? ? ? ? ? ? 7.900 ? 0.939 ? ? 0.384 0.136 0 6 1 0.969 ? 1.750 1.790 ? ? ? ? ? 1134 ? 100.000 ? ? ? ? 0.289 ? ? ? ? ? ? ? ? 7.900 ? 0.968 ? ? 0.309 0.109 0 7 1 0.973 ? 1.790 1.840 ? ? ? ? ? 1137 ? 100.000 ? ? ? ? 0.205 ? ? ? ? ? ? ? ? 7.900 ? 0.974 ? ? 0.219 0.077 0 8 1 0.981 ? 1.840 1.890 ? ? ? ? ? 1130 ? 100.000 ? ? ? ? 0.157 ? ? ? ? ? ? ? ? 7.900 ? 0.974 ? ? 0.168 0.059 0 9 1 0.988 ? 1.890 1.950 ? ? ? ? ? 1108 ? 100.000 ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 7.900 ? 0.903 ? ? 0.120 0.042 0 10 1 0.992 ? 1.950 2.020 ? ? ? ? ? 1125 ? 100.000 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 7.900 ? 0.903 ? ? 0.094 0.033 0 11 1 0.994 ? 2.020 2.100 ? ? ? ? ? 1134 ? 100.000 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 7.900 ? 0.843 ? ? 0.074 0.026 0 12 1 0.996 ? 2.100 2.200 ? ? ? ? ? 1150 ? 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 8.000 ? 0.893 ? ? 0.063 0.022 0 13 1 0.996 ? 2.200 2.320 ? ? ? ? ? 1134 ? 100.000 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? 7.900 ? 0.827 ? ? 0.048 0.017 0 14 1 0.997 ? 2.320 2.460 ? ? ? ? ? 1131 ? 100.000 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 8.000 ? 0.776 ? ? 0.042 0.015 0 15 1 0.997 ? 2.460 2.650 ? ? ? ? ? 1142 ? 100.000 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 7.900 ? 0.828 ? ? 0.039 0.014 0 16 1 0.998 ? 2.650 2.920 ? ? ? ? ? 1156 ? 100.000 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 7.900 ? 0.984 ? ? 0.037 0.013 0 17 1 0.998 ? 2.920 3.340 ? ? ? ? ? 1150 ? 99.900 ? ? ? ? 0.037 ? ? ? ? ? ? ? ? 7.900 ? 1.431 ? ? 0.040 0.014 0 18 1 0.998 ? 3.340 4.210 ? ? ? ? ? 1176 ? 100.000 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? 7.700 ? 1.186 ? ? 0.032 0.011 0 19 1 0.998 ? 4.210 50.000 ? ? ? ? ? 1236 ? 99.700 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 7.300 ? 1.046 ? ? 0.030 0.011 0 20 1 0.997 ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5FDA _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 22259 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 47.960 _refine.ls_d_res_high 1.549 _refine.ls_percent_reflns_obs 97.81 _refine.ls_R_factor_obs 0.1587 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1568 _refine.ls_R_factor_R_free 0.1942 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.00 _refine.ls_number_reflns_R_free 1113 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 3Q1H _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.16 _refine.pdbx_overall_phase_error 20.24 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1272 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 187 _refine_hist.number_atoms_total 1462 _refine_hist.d_res_high 1.549 _refine_hist.d_res_low 47.960 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.009 ? ? 1365 'X-RAY DIFFRACTION' ? f_angle_d 0.973 ? ? 1861 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 18.538 ? ? 816 'X-RAY DIFFRACTION' ? f_chiral_restr 0.063 ? ? 197 'X-RAY DIFFRACTION' ? f_plane_restr 0.006 ? ? 249 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 1.5486 1.6191 2187 0.1955 83.00 0.2753 . . 120 . . . . 'X-RAY DIFFRACTION' . 1.6191 1.7045 2669 0.1630 100.00 0.2385 . . 125 . . . . 'X-RAY DIFFRACTION' . 1.7045 1.8113 2662 0.1466 100.00 0.2102 . . 142 . . . . 'X-RAY DIFFRACTION' . 1.8113 1.9511 2693 0.1390 100.00 0.1859 . . 137 . . . . 'X-RAY DIFFRACTION' . 1.9511 2.1475 2694 0.1335 100.00 0.1614 . . 142 . . . . 'X-RAY DIFFRACTION' . 2.1475 2.4582 2682 0.1434 100.00 0.1985 . . 152 . . . . 'X-RAY DIFFRACTION' . 2.4582 3.0970 2712 0.1676 100.00 0.2103 . . 162 . . . . 'X-RAY DIFFRACTION' . 3.0970 47.9826 2847 0.1657 100.00 0.1760 . . 133 . . . . # _struct.entry_id 5FDA _struct.title 'The high resolution structure of apo form dihydrofolate reductase from Yersinia pestis at 1.55 A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5FDA _struct_keywords.text ;Structural Genomics, Center For Structural Genomics Of Infectious Diseases, CSGID, Dihydrofolate Reductase, Yersinia pestis, OXIDOREDUCTASE ; _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0B6NYF5_YERPE _struct_ref.pdbx_db_accession A0A0B6NYF5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLNIVISSQPGTDERVTWAASIE EALAFAGNAEEVMVMGGGRVYKQFLDRANRMYLTHIDAEVGGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5FDA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 163 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0B6NYF5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 160 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 160 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FDA SER A 1 ? UNP A0A0B6NYF5 ? ? 'expression tag' -2 1 1 5FDA ASN A 2 ? UNP A0A0B6NYF5 ? ? 'expression tag' -1 2 1 5FDA ALA A 3 ? UNP A0A0B6NYF5 ? ? 'expression tag' 0 3 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 560 ? 1 MORE -26 ? 1 'SSA (A^2)' 8900 ? 2 'ABSA (A^2)' 2460 ? 2 MORE -32 ? 2 'SSA (A^2)' 15970 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E 2 1,2 A,B,C,D,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 32.1605000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 29 ? ASP A 31 ? PRO A 26 ASP A 28 5 ? 3 HELX_P HELX_P2 AA2 LEU A 32 ? LEU A 40 ? LEU A 29 LEU A 37 1 ? 9 HELX_P HELX_P3 AA3 ARG A 48 ? GLY A 55 ? ARG A 45 GLY A 52 1 ? 8 HELX_P HELX_P4 AA4 SER A 81 ? ALA A 89 ? SER A 78 ALA A 86 1 ? 9 HELX_P HELX_P5 AA5 GLY A 100 ? LEU A 108 ? GLY A 97 LEU A 105 1 ? 9 HELX_P HELX_P6 AA6 GLU A 133 ? ASP A 135 ? GLU A 130 ASP A 132 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 3 C ? ? ? 1_555 A MSE 4 N ? ? A ALA 0 A MSE 1 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A MSE 4 C ? ? ? 1_555 A ILE 5 N ? ? A MSE 1 A ILE 2 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale3 covale both ? A GLY 19 C ? ? ? 1_555 A MSE 20 N ? ? A GLY 16 A MSE 17 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? A MSE 20 C ? ? ? 1_555 A GLU 21 N ? ? A MSE 17 A GLU 18 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale5 covale both ? A ALA 23 C ? ? ? 1_555 A MSE 24 N ? ? A ALA 20 A MSE 21 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale6 covale both ? A MSE 24 C ? ? ? 1_555 A PRO 25 N ? ? A MSE 21 A PRO 22 1_555 ? ? ? ? ? ? ? 1.364 ? ? covale7 covale both ? A ILE 45 C ? ? ? 1_555 A MSE 46 N ? ? A ILE 42 A MSE 43 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale8 covale both ? A MSE 46 C ? ? ? 1_555 A GLY 47 N ? ? A MSE 43 A GLY 44 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale9 covale both ? A VAL 95 C A ? ? 1_555 A MSE 96 N A ? A VAL 92 A MSE 93 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale10 covale both ? A VAL 95 C B ? ? 1_555 A MSE 96 N B ? A VAL 92 A MSE 93 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale11 covale both ? A MSE 96 C A ? ? 1_555 A VAL 97 N ? ? A MSE 93 A VAL 94 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale12 covale both ? A MSE 96 C B ? ? 1_555 A VAL 97 N ? ? A MSE 93 A VAL 94 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale13 covale both ? A VAL 97 C ? ? ? 1_555 A MSE 98 N B ? A VAL 94 A MSE 95 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale14 covale both ? A VAL 97 C ? ? ? 1_555 A MSE 98 N A ? A VAL 94 A MSE 95 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale15 covale both ? A MSE 98 C A ? ? 1_555 A GLY 99 N ? ? A MSE 95 A GLY 96 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale16 covale both ? A MSE 98 C B ? ? 1_555 A GLY 99 N ? ? A MSE 95 A GLY 96 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale17 covale both ? A ARG 113 C ? ? ? 1_555 A MSE 114 N ? ? A ARG 110 A MSE 111 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale18 covale both ? A MSE 114 C ? ? ? 1_555 A TYR 115 N ? ? A MSE 111 A TYR 112 1_555 ? ? ? ? ? ? ? 1.343 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 4 ? . . . . MSE A 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 20 ? . . . . MSE A 17 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 24 ? . . . . MSE A 21 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 46 ? . . . . MSE A 43 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 96 A . . . . MSE A 93 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE A 96 B . . . . MSE A 93 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 7 MSE A 98 A . . . . MSE A 95 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 8 MSE A 98 B . . . . MSE A 95 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 9 MSE A 114 ? . . . . MSE A 111 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 16 ? VAL A 17 ? ARG A 13 VAL A 14 AA1 2 ILE A 5 ? ALA A 13 ? ILE A 2 ALA A 10 AA1 3 GLU A 94 ? VAL A 97 ? GLU A 91 VAL A 94 AA1 4 VAL A 44 ? GLY A 47 ? VAL A 41 GLY A 44 AA1 5 ASN A 63 ? ILE A 66 ? ASN A 60 ILE A 63 AA1 6 THR A 77 ? ALA A 79 ? THR A 74 ALA A 76 AA2 1 ARG A 16 ? VAL A 17 ? ARG A 13 VAL A 14 AA2 2 ILE A 5 ? ALA A 13 ? ILE A 2 ALA A 10 AA2 3 ARG A 113 ? ILE A 119 ? ARG A 110 ILE A 116 AA2 4 TYR A 155 ? ARG A 162 ? TYR A 152 ARG A 159 AA2 5 TRP A 137 ? HIS A 145 ? TRP A 134 HIS A 142 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 16 ? O ARG A 13 N ALA A 13 ? N ALA A 10 AA1 2 3 N SER A 7 ? N SER A 4 O VAL A 97 ? O VAL A 94 AA1 3 4 O MSE A 96 ? O MSE A 93 N ILE A 45 ? N ILE A 42 AA1 4 5 N VAL A 44 ? N VAL A 41 O ILE A 64 ? O ILE A 61 AA1 5 6 N ASN A 63 ? N ASN A 60 O THR A 77 ? O THR A 74 AA2 1 2 O ARG A 16 ? O ARG A 13 N ALA A 13 ? N ALA A 10 AA2 2 3 N LEU A 8 ? N LEU A 5 O TYR A 115 ? O TYR A 112 AA2 3 4 N HIS A 118 ? N HIS A 115 O CYS A 156 ? O CYS A 153 AA2 4 5 O GLU A 161 ? O GLU A 158 N GLU A 138 ? N GLU A 135 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 201 ? 4 'binding site for residue CL A 201' AC2 Software A CL 202 ? 6 'binding site for residue CL A 202' AC3 Software A CL 203 ? 2 'binding site for residue CL A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASN A 38 ? ASN A 35 . ? 3_555 ? 2 AC1 4 ASN A 38 ? ASN A 35 . ? 1_555 ? 3 AC1 4 LYS A 42 ? LYS A 39 . ? 3_555 ? 4 AC1 4 LYS A 42 ? LYS A 39 . ? 1_555 ? 5 AC2 6 ASN A 41 ? ASN A 38 . ? 1_555 ? 6 AC2 6 ASN A 41 ? ASN A 38 . ? 3_555 ? 7 AC2 6 LYS A 42 ? LYS A 39 . ? 3_555 ? 8 AC2 6 LYS A 42 ? LYS A 39 . ? 1_555 ? 9 AC2 6 HOH E . ? HOH A 417 . ? 3_555 ? 10 AC2 6 HOH E . ? HOH A 417 . ? 1_555 ? 11 AC3 2 SER A 152 ? SER A 149 . ? 4_555 ? 12 AC3 2 SER A 152 ? SER A 149 . ? 1_555 ? # _pdbx_entry_details.entry_id 5FDA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 12 ? ? O A HOH 301 ? ? 2.01 2 1 NH1 A ARG 107 ? ? O A HOH 302 ? ? 2.05 3 1 O A HOH 330 ? ? O A HOH 387 ? ? 2.12 4 1 O A HOH 340 ? ? O A HOH 432 ? ? 2.14 5 1 NE2 A HIS 150 ? ? O A HOH 303 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 307 ? ? 1_555 O A HOH 407 ? ? 3_455 2.06 2 1 O A HOH 391 ? ? 1_555 O A HOH 391 ? ? 4_556 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 11 ? ? 56.79 -121.01 2 1 ASP A 145 ? ? -160.29 -164.43 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Center for Structural Genomics of Infectious Diseases' _pdbx_SG_project.initial_of_center CSGID # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 4 A MSE 1 ? MET 'modified residue' 2 A MSE 20 A MSE 17 ? MET 'modified residue' 3 A MSE 24 A MSE 21 ? MET 'modified residue' 4 A MSE 46 A MSE 43 ? MET 'modified residue' 5 A MSE 96 A MSE 93 ? MET 'modified residue' 6 A MSE 98 A MSE 95 ? MET 'modified residue' 7 A MSE 114 A MSE 111 ? MET 'modified residue' # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CL 201 ? B CL . 2 1 A CL 202 ? C CL . 3 1 A CL 203 ? D CL . 4 1 A HOH 304 ? E HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MSE N N N N 231 MSE CA C N S 232 MSE C C N N 233 MSE O O N N 234 MSE OXT O N N 235 MSE CB C N N 236 MSE CG C N N 237 MSE SE SE N N 238 MSE CE C N N 239 MSE H H N N 240 MSE H2 H N N 241 MSE HA H N N 242 MSE HXT H N N 243 MSE HB2 H N N 244 MSE HB3 H N N 245 MSE HG2 H N N 246 MSE HG3 H N N 247 MSE HE1 H N N 248 MSE HE2 H N N 249 MSE HE3 H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3Q1H _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5FDA _atom_sites.fract_transf_matrix[1][1] 0.016593 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012626 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015547 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S SE # loop_