data_5FDD # _entry.id 5FDD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5FDD WWPDB D_1000216404 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB ;4ZHZ contains the same protein and ligand. The difference is the pH under which crystals were soaked with the ligand solution. 4ZHZ was pH 5.8 while this entry was pH 7.0. ; 4ZHZ unspecified PDB . 5FDE unspecified PDB . 5FDG unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5FDD _pdbx_database_status.recvd_initial_deposition_date 2015-12-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fudo, S.' 1 'Yamamoto, N.' 2 'Nukaga, M.' 3 'Odagiri, T.' 4 'Tashiro, M.' 5 'Hoshino, T.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 55 _citation.language ? _citation.page_first 2646 _citation.page_last 2660 _citation.title 'Two Distinctive Binding Modes of Endonuclease Inhibitors to the N-Terminal Region of Influenza Virus Polymerase Acidic Subunit' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.5b01087 _citation.pdbx_database_id_PubMed 27088785 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fudo, S.' 1 ? primary 'Yamamoto, N.' 2 ? primary 'Nukaga, M.' 3 ? primary 'Odagiri, T.' 4 ? primary 'Tashiro, M.' 5 ? primary 'Hoshino, T.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5FDD _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.397 _cell.length_a_esd ? _cell.length_b 66.397 _cell.length_b_esd ? _cell.length_c 127.392 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FDD _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein,Polymerase acidic protein' 22300.494 1 ? ? 'endonuclease, residues 1-50, 73-196' ? 2 non-polymer syn '5-(2-chlorobenzyl)-2-hydroxy-3-nitrobenzaldehyde' 291.687 1 ? ? ? ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 water nat water 18.015 23 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHRFEIIEGRDRTMAWTVVNSIC NTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL FTIRQEMASRGLWDSFRQSERGAAELALVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHRFEIIEGRDRTMAWTVVNSIC NTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL FTIRQEMASRGLWDSFRQSERGAAELALVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ASP n 1 9 PHE n 1 10 VAL n 1 11 ARG n 1 12 GLN n 1 13 CYS n 1 14 PHE n 1 15 ASN n 1 16 PRO n 1 17 MET n 1 18 ILE n 1 19 VAL n 1 20 GLU n 1 21 LEU n 1 22 ALA n 1 23 GLU n 1 24 LYS n 1 25 THR n 1 26 MET n 1 27 LYS n 1 28 GLU n 1 29 TYR n 1 30 GLY n 1 31 GLU n 1 32 ASP n 1 33 LEU n 1 34 LYS n 1 35 ILE n 1 36 GLU n 1 37 THR n 1 38 ASN n 1 39 LYS n 1 40 PHE n 1 41 ALA n 1 42 ALA n 1 43 ILE n 1 44 CYS n 1 45 THR n 1 46 HIS n 1 47 LEU n 1 48 GLU n 1 49 VAL n 1 50 CYS n 1 51 PHE n 1 52 MET n 1 53 TYR n 1 54 SER n 1 55 ASP n 1 56 ALA n 1 57 SER n 1 58 LYS n 1 59 HIS n 1 60 ARG n 1 61 PHE n 1 62 GLU n 1 63 ILE n 1 64 ILE n 1 65 GLU n 1 66 GLY n 1 67 ARG n 1 68 ASP n 1 69 ARG n 1 70 THR n 1 71 MET n 1 72 ALA n 1 73 TRP n 1 74 THR n 1 75 VAL n 1 76 VAL n 1 77 ASN n 1 78 SER n 1 79 ILE n 1 80 CYS n 1 81 ASN n 1 82 THR n 1 83 THR n 1 84 GLY n 1 85 ALA n 1 86 GLU n 1 87 LYS n 1 88 PRO n 1 89 LYS n 1 90 PHE n 1 91 LEU n 1 92 PRO n 1 93 ASP n 1 94 LEU n 1 95 TYR n 1 96 ASP n 1 97 TYR n 1 98 LYS n 1 99 GLU n 1 100 ASN n 1 101 ARG n 1 102 PHE n 1 103 ILE n 1 104 GLU n 1 105 ILE n 1 106 GLY n 1 107 VAL n 1 108 THR n 1 109 ARG n 1 110 ARG n 1 111 GLU n 1 112 VAL n 1 113 HIS n 1 114 ILE n 1 115 TYR n 1 116 TYR n 1 117 LEU n 1 118 GLU n 1 119 LYS n 1 120 ALA n 1 121 ASN n 1 122 LYS n 1 123 ILE n 1 124 LYS n 1 125 SER n 1 126 GLU n 1 127 LYS n 1 128 THR n 1 129 HIS n 1 130 ILE n 1 131 HIS n 1 132 ILE n 1 133 PHE n 1 134 SER n 1 135 PHE n 1 136 THR n 1 137 GLY n 1 138 GLU n 1 139 GLU n 1 140 MET n 1 141 ALA n 1 142 THR n 1 143 LYS n 1 144 ALA n 1 145 ASP n 1 146 TYR n 1 147 THR n 1 148 LEU n 1 149 ASP n 1 150 GLU n 1 151 GLU n 1 152 SER n 1 153 ARG n 1 154 ALA n 1 155 ARG n 1 156 ILE n 1 157 LYS n 1 158 THR n 1 159 ARG n 1 160 LEU n 1 161 PHE n 1 162 THR n 1 163 ILE n 1 164 ARG n 1 165 GLN n 1 166 GLU n 1 167 MET n 1 168 ALA n 1 169 SER n 1 170 ARG n 1 171 GLY n 1 172 LEU n 1 173 TRP n 1 174 ASP n 1 175 SER n 1 176 PHE n 1 177 ARG n 1 178 GLN n 1 179 SER n 1 180 GLU n 1 181 ARG n 1 182 GLY n 1 183 ALA n 1 184 ALA n 1 185 GLU n 1 186 LEU n 1 187 ALA n 1 188 LEU n 1 189 VAL n 1 190 PRO n 1 191 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 57 ? ? PA ? 'A/Puerto Rico/8/1934 H1N1' ? ? ? ? 'Influenza A virus' 211044 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3) pLysS' ? ? ? ? ? ? ? plasmid ? ? ? 'pET50b(+)' ? ? 1 2 sample 'Biological sequence' 58 191 ? ? PA ? 'A/Puerto Rico/8/1934 H1N1' ? ? ? ? 'Influenza A virus' 211044 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3) pLysS' ? ? ? ? ? ? ? plasmid ? ? ? 'pET50b(+)' ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PA_I34A1 P03433 ? 1 MEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSD 1 2 UNP PA_I34A1 P03433 ? 1 ;KHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERG ; 73 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5FDD A 6 ? 55 ? P03433 1 ? 50 ? 6 55 2 2 5FDD A 58 ? 182 ? P03433 73 ? 197 ? 58 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FDD GLY A 1 ? UNP P03433 ? ? 'expression tag' 1 1 1 5FDD PRO A 2 ? UNP P03433 ? ? 'expression tag' 2 2 1 5FDD LEU A 3 ? UNP P03433 ? ? 'expression tag' 3 3 1 5FDD GLY A 4 ? UNP P03433 ? ? 'expression tag' 4 4 1 5FDD SER A 5 ? UNP P03433 ? ? 'expression tag' 5 5 1 5FDD ALA A 56 ? UNP P03433 ? ? linker 56 6 1 5FDD SER A 57 ? UNP P03433 ? ? linker 57 7 2 5FDD ALA A 183 ? UNP P03433 ? ? 'expression tag' 183 8 2 5FDD ALA A 184 ? UNP P03433 ? ? 'expression tag' 184 9 2 5FDD GLU A 185 ? UNP P03433 ? ? 'expression tag' 185 10 2 5FDD LEU A 186 ? UNP P03433 ? ? 'expression tag' 186 11 2 5FDD ALA A 187 ? UNP P03433 ? ? 'expression tag' 187 12 2 5FDD LEU A 188 ? UNP P03433 ? ? 'expression tag' 188 13 2 5FDD VAL A 189 ? UNP P03433 ? ? 'expression tag' 189 14 2 5FDD PRO A 190 ? UNP P03433 ? ? 'expression tag' 190 15 2 5FDD ARG A 191 ? UNP P03433 ? ? 'expression tag' 191 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4P8 non-polymer . '5-(2-chlorobenzyl)-2-hydroxy-3-nitrobenzaldehyde' ? 'C14 H10 Cl N O4' 291.687 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5FDD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Crystals were grown with the reservoir containing 100 mM MES, 1.1 M ammonium sulfate, 0.1 M potassium chloride and 9 % trehalose at pH 5.8. Crystal was then soaked with the ligand solution at pH 7.0. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-12-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Numerical link type Si(111) double crystal monochromator, liquid nitrogen cooled' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9800 1.0 2 1.000 1.0 3 0.98 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-17A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-17A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5FDD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.500 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10401 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.300 _reflns.pdbx_Rmerge_I_obs 0.152 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 18.628 _reflns.pdbx_netI_over_sigmaI 9.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.020 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.160 _reflns.pdbx_Rpim_I_all 0.047 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 117975 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.500 2.540 ? ? ? ? ? 504 ? 100.000 ? ? ? ? 1.195 ? ? ? ? ? ? ? ? 8.800 ? 0.996 ? ? 1.270 0.422 0 1 1 0.807 ? 2.540 2.590 ? ? ? ? ? 495 ? 99.800 ? ? ? ? 1.055 ? ? ? ? ? ? ? ? 9.800 ? 1.010 ? ? 1.113 0.350 0 2 1 0.896 ? 2.590 2.640 ? ? ? ? ? 514 ? 100.000 ? ? ? ? 1.051 ? ? ? ? ? ? ? ? 10.400 ? 0.981 ? ? 1.105 0.337 0 3 1 0.895 ? 2.640 2.690 ? ? ? ? ? 495 ? 100.000 ? ? ? ? 1.008 ? ? ? ? ? ? ? ? 10.900 ? 1.024 ? ? 1.058 0.316 0 4 1 0.880 ? 2.690 2.750 ? ? ? ? ? 518 ? 100.000 ? ? ? ? 0.858 ? ? ? ? ? ? ? ? 12.200 ? 1.032 ? ? 0.895 0.252 0 5 1 0.937 ? 2.750 2.820 ? ? ? ? ? 497 ? 100.000 ? ? ? ? 0.769 ? ? ? ? ? ? ? ? 12.000 ? 1.042 ? ? 0.803 0.229 0 6 1 0.931 ? 2.820 2.890 ? ? ? ? ? 515 ? 100.000 ? ? ? ? 0.655 ? ? ? ? ? ? ? ? 12.600 ? 1.044 ? ? 0.683 0.189 0 7 1 0.967 ? 2.890 2.960 ? ? ? ? ? 501 ? 100.000 ? ? ? ? 0.485 ? ? ? ? ? ? ? ? 12.900 ? 1.032 ? ? 0.505 0.138 0 8 1 0.978 ? 2.960 3.050 ? ? ? ? ? 506 ? 100.000 ? ? ? ? 0.388 ? ? ? ? ? ? ? ? 12.800 ? 1.031 ? ? 0.404 0.111 0 9 1 0.977 ? 3.050 3.150 ? ? ? ? ? 522 ? 100.000 ? ? ? ? 0.350 ? ? ? ? ? ? ? ? 12.400 ? 1.043 ? ? 0.365 0.102 0 10 1 0.979 ? 3.150 3.260 ? ? ? ? ? 509 ? 100.000 ? ? ? ? 0.278 ? ? ? ? ? ? ? ? 11.800 ? 1.014 ? ? 0.291 0.084 0 11 1 0.981 ? 3.260 3.390 ? ? ? ? ? 509 ? 100.000 ? ? ? ? 0.209 ? ? ? ? ? ? ? ? 12.100 ? 1.035 ? ? 0.218 0.062 0 12 1 0.989 ? 3.390 3.550 ? ? ? ? ? 521 ? 100.000 ? ? ? ? 0.171 ? ? ? ? ? ? ? ? 11.600 ? 1.044 ? ? 0.179 0.053 0 13 1 0.990 ? 3.550 3.730 ? ? ? ? ? 512 ? 99.800 ? ? ? ? 0.140 ? ? ? ? ? ? ? ? 12.200 ? 1.028 ? ? 0.147 0.042 0 14 1 0.995 ? 3.730 3.970 ? ? ? ? ? 521 ? 100.000 ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 11.700 ? 1.045 ? ? 0.117 0.035 0 15 1 0.994 ? 3.970 4.270 ? ? ? ? ? 529 ? 99.800 ? ? ? ? 0.089 ? ? ? ? ? ? ? ? 10.800 ? 0.975 ? ? 0.094 0.029 0 16 1 0.997 ? 4.270 4.700 ? ? ? ? ? 533 ? 100.000 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 10.800 ? 0.997 ? ? 0.087 0.027 0 17 1 0.995 ? 4.700 5.380 ? ? ? ? ? 536 ? 100.000 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 11.300 ? 0.995 ? ? 0.083 0.024 0 18 1 0.997 ? 5.380 6.780 ? ? ? ? ? 555 ? 99.800 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 10.700 ? 0.992 ? ? 0.091 0.028 0 19 1 0.995 ? 6.780 50.000 ? ? ? ? ? 609 ? 99.200 ? ? ? ? 0.089 ? ? ? ? ? ? ? ? 9.300 ? 1.022 ? ? 0.094 0.030 0 20 1 0.995 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 132.140 _refine.B_iso_mean 59.3400 _refine.B_iso_min 26.350 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5FDD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5060 _refine.ls_d_res_low 37.7930 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10350 _refine.ls_number_reflns_R_free 550 _refine.ls_number_reflns_R_work 9800 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8900 _refine.ls_percent_reflns_R_free 5.3100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2024 _refine.ls_R_factor_R_free 0.2318 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2007 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ZQQ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.7500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8073 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.5060 _refine_hist.d_res_low 37.7930 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1542 _refine_hist.pdbx_number_residues_total 181 _refine_hist.pdbx_B_iso_mean_ligand 96.54 _refine_hist.pdbx_B_iso_mean_solvent 54.75 _refine_hist.pdbx_number_atoms_protein 1493 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 1548 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.794 ? 2079 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.059 ? 218 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 265 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.054 ? 585 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5058 2.7579 2522 . 140 2382 100.0000 . . . 0.3190 . 0.2459 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.7579 3.1569 2533 . 129 2404 100.0000 . . . 0.3217 . 0.2361 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.1569 3.9766 2564 . 129 2435 100.0000 . . . 0.2332 . 0.1939 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.9766 37.7970 2731 . 152 2579 100.0000 . . . 0.1933 . 0.1858 . . . . . . 4 . . . # _struct.entry_id 5FDD _struct.title 'Endonuclease inhibitor 1 bound to influenza strain H1N1 polymerase acidic subunit N-terminal region at pH 7.0' _struct.pdbx_descriptor 'Polymerase acidic protein' _struct.pdbx_model_details 'RNA binding protein' _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5FDD _struct_keywords.text 'Hydrolase/Inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? PHE A 14 ? SER A 5 PHE A 14 1 ? 10 HELX_P HELX_P2 AA2 ASN A 15 ? TYR A 29 ? ASN A 15 TYR A 29 1 ? 15 HELX_P HELX_P3 AA3 GLU A 36 ? ALA A 56 ? GLU A 36 ALA A 56 1 ? 21 HELX_P HELX_P4 AA4 ASP A 68 ? GLY A 84 ? ASP A 68 GLY A 84 1 ? 17 HELX_P HELX_P5 AA5 GLU A 111 ? LYS A 124 ? GLU A 111 LYS A 124 1 ? 14 HELX_P HELX_P6 AA6 LYS A 143 ? ASP A 145 ? LYS A 143 ASP A 145 5 ? 3 HELX_P HELX_P7 AA7 ASP A 149 ? ARG A 170 ? ASP A 149 ARG A 170 1 ? 22 HELX_P HELX_P8 AA8 LEU A 172 ? SER A 179 ? LEU A 172 SER A 179 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ASP _struct_conn.ptnr1_label_seq_id 93 _struct_conn.ptnr1_label_atom_id OD1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id MN _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id MN _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ASP _struct_conn.ptnr1_auth_seq_id 93 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id MN _struct_conn.ptnr2_auth_seq_id 202 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.487 _struct_conn.pdbx_value_order ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 61 ? ILE A 63 ? PHE A 61 ILE A 63 AA1 2 LEU A 94 ? ASP A 96 ? LEU A 94 ASP A 96 AA1 3 ARG A 101 ? THR A 108 ? ARG A 101 THR A 108 AA1 4 HIS A 129 ? SER A 134 ? HIS A 129 SER A 134 AA1 5 GLU A 139 ? ALA A 141 ? GLU A 139 ALA A 141 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 62 ? N GLU A 62 O TYR A 95 ? O TYR A 95 AA1 2 3 N LEU A 94 ? N LEU A 94 O ILE A 103 ? O ILE A 103 AA1 3 4 N PHE A 102 ? N PHE A 102 O HIS A 129 ? O HIS A 129 AA1 4 5 N ILE A 132 ? N ILE A 132 O MET A 140 ? O MET A 140 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 4P8 201 ? 8 'binding site for residue 4P8 A 201' AC2 Software A MN 202 ? 4 'binding site for residue MN A 202' AC3 Software A SO4 203 ? 3 'binding site for residue SO4 A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 TYR A 29 ? TYR A 29 . ? 1_555 ? 2 AC1 8 HIS A 46 ? HIS A 46 . ? 1_555 ? 3 AC1 8 GLU A 65 ? GLU A 65 . ? 1_555 ? 4 AC1 8 GLU A 104 ? GLU A 104 . ? 1_555 ? 5 AC1 8 TYR A 115 ? TYR A 115 . ? 1_555 ? 6 AC1 8 LYS A 119 ? LYS A 119 . ? 1_555 ? 7 AC1 8 MN C . ? MN A 202 . ? 1_555 ? 8 AC1 8 HOH E . ? HOH A 301 . ? 1_555 ? 9 AC2 4 GLU A 65 ? GLU A 65 . ? 1_555 ? 10 AC2 4 LEU A 91 ? LEU A 91 . ? 1_555 ? 11 AC2 4 ASP A 93 ? ASP A 93 . ? 1_555 ? 12 AC2 4 4P8 B . ? 4P8 A 201 . ? 1_555 ? 13 AC3 3 ARG A 164 ? ARG A 164 . ? 1_555 ? 14 AC3 3 TRP A 173 ? TRP A 173 . ? 1_555 ? 15 AC3 3 ARG A 177 ? ARG A 177 . ? 1_555 ? # _atom_sites.entry_id 5FDD _atom_sites.fract_transf_matrix[1][1] 0.015061 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015061 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007850 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 MET 167 167 167 MET MET A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 TRP 173 173 173 TRP TRP A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 GLY 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 ALA 184 184 ? ? ? A . n A 1 185 GLU 185 185 ? ? ? A . n A 1 186 LEU 186 186 ? ? ? A . n A 1 187 ALA 187 187 ? ? ? A . n A 1 188 LEU 188 188 ? ? ? A . n A 1 189 VAL 189 189 ? ? ? A . n A 1 190 PRO 190 190 ? ? ? A . n A 1 191 ARG 191 191 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 4P8 1 201 1 4P8 DRG A . C 3 MN 1 202 1 MN MN A . D 4 SO4 1 203 1 SO4 SO4 A . E 5 HOH 1 301 17 HOH HOH A . E 5 HOH 2 302 22 HOH HOH A . E 5 HOH 3 303 11 HOH HOH A . E 5 HOH 4 304 3 HOH HOH A . E 5 HOH 5 305 2 HOH HOH A . E 5 HOH 6 306 12 HOH HOH A . E 5 HOH 7 307 15 HOH HOH A . E 5 HOH 8 308 20 HOH HOH A . E 5 HOH 9 309 5 HOH HOH A . E 5 HOH 10 310 16 HOH HOH A . E 5 HOH 11 311 10 HOH HOH A . E 5 HOH 12 312 4 HOH HOH A . E 5 HOH 13 313 6 HOH HOH A . E 5 HOH 14 314 1 HOH HOH A . E 5 HOH 15 315 23 HOH HOH A . E 5 HOH 16 316 13 HOH HOH A . E 5 HOH 17 317 7 HOH HOH A . E 5 HOH 18 318 18 HOH HOH A . E 5 HOH 19 319 8 HOH HOH A . E 5 HOH 20 320 9 HOH HOH A . E 5 HOH 21 321 14 HOH HOH A . E 5 HOH 22 322 19 HOH HOH A . E 5 HOH 23 323 21 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 180 ? 1 MORE -12 ? 1 'SSA (A^2)' 9750 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-30 2 'Structure model' 1 1 2016-05-25 3 'Structure model' 1 2 2020-02-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' diffrn_source 3 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_phasing_MR.entry_id 5FDD _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body 0.438 _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 'phenix.refine: 1.8.1_1168' 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OAS A 4P8 201 ? ? O A HOH 301 ? ? 1.95 2 1 OE2 A GLU 104 ? ? O A HOH 301 ? ? 2.04 3 1 NZ A LYS 122 ? ? O A HOH 302 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 57 ? ? -154.80 82.46 2 1 HIS A 59 ? ? 74.87 -0.35 3 1 LYS A 124 ? ? 57.36 5.01 4 1 THR A 147 ? ? 64.83 -58.44 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 182 ? A GLY 182 2 1 Y 1 A ALA 183 ? A ALA 183 3 1 Y 1 A ALA 184 ? A ALA 184 4 1 Y 1 A GLU 185 ? A GLU 185 5 1 Y 1 A LEU 186 ? A LEU 186 6 1 Y 1 A ALA 187 ? A ALA 187 7 1 Y 1 A LEU 188 ? A LEU 188 8 1 Y 1 A VAL 189 ? A VAL 189 9 1 Y 1 A PRO 190 ? A PRO 190 10 1 Y 1 A ARG 191 ? A ARG 191 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 24590548 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-(2-chlorobenzyl)-2-hydroxy-3-nitrobenzaldehyde' 4P8 3 'MANGANESE (II) ION' MN 4 'SULFATE ION' SO4 5 water HOH #