data_5FDE # _entry.id 5FDE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5FDE WWPDB D_1000216405 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2016-02-17 _pdbx_database_PDB_obs_spr.pdb_id 5I13 _pdbx_database_PDB_obs_spr.replace_pdb_id 5FDE _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB ;4ZI0 contains the same protein and ligand. The difference is the pH under which crystals were soaked with the ligand solution. 4ZI0 was pH 5.8 while this entry was pH 7.0. ; 4ZI0 unspecified PDB . 5FDD unspecified PDB . 5FDG unspecified # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5FDE _pdbx_database_status.recvd_initial_deposition_date 2015-12-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fudo, S.' 1 'Yamamoto, N.' 2 'Nukaga, M.' 3 'Odagiri, T.' 4 'Tashiro, M.' 5 'Hoshino, T.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Two distinctive binding modes of endonuclease inhibitors to the N-terminal region of influenza virus polymerase acidic subunit' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Fudo, S.' 1 primary 'Yamamoto, N.' 2 primary 'Nukaga, M.' 3 primary 'Odagiri, T.' 4 primary 'Tashiro, M.' 5 primary 'Hoshino, T.' 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5FDE _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.580 _cell.length_a_esd ? _cell.length_b 66.580 _cell.length_b_esd ? _cell.length_c 128.314 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FDE _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein,Polymerase acidic protein' 22300.494 1 ? ? 'endonuclease, residues 1-50, 73-196' ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 non-polymer syn '4-{(E)-[2-(4-chlorophenyl)hydrazinylidene]methyl}benzene-1,2,3-triol' 278.691 2 ? ? ? ? 5 water nat water 18.015 30 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHRFEIIEGRDRTMAWTVVNSIC NTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL FTIRQEMASRGLWDSFRQSERGAAELALVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHRFEIIEGRDRTMAWTVVNSIC NTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL FTIRQEMASRGLWDSFRQSERGAAELALVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ASP n 1 9 PHE n 1 10 VAL n 1 11 ARG n 1 12 GLN n 1 13 CYS n 1 14 PHE n 1 15 ASN n 1 16 PRO n 1 17 MET n 1 18 ILE n 1 19 VAL n 1 20 GLU n 1 21 LEU n 1 22 ALA n 1 23 GLU n 1 24 LYS n 1 25 THR n 1 26 MET n 1 27 LYS n 1 28 GLU n 1 29 TYR n 1 30 GLY n 1 31 GLU n 1 32 ASP n 1 33 LEU n 1 34 LYS n 1 35 ILE n 1 36 GLU n 1 37 THR n 1 38 ASN n 1 39 LYS n 1 40 PHE n 1 41 ALA n 1 42 ALA n 1 43 ILE n 1 44 CYS n 1 45 THR n 1 46 HIS n 1 47 LEU n 1 48 GLU n 1 49 VAL n 1 50 CYS n 1 51 PHE n 1 52 MET n 1 53 TYR n 1 54 SER n 1 55 ASP n 1 56 ALA n 1 57 SER n 1 58 LYS n 1 59 HIS n 1 60 ARG n 1 61 PHE n 1 62 GLU n 1 63 ILE n 1 64 ILE n 1 65 GLU n 1 66 GLY n 1 67 ARG n 1 68 ASP n 1 69 ARG n 1 70 THR n 1 71 MET n 1 72 ALA n 1 73 TRP n 1 74 THR n 1 75 VAL n 1 76 VAL n 1 77 ASN n 1 78 SER n 1 79 ILE n 1 80 CYS n 1 81 ASN n 1 82 THR n 1 83 THR n 1 84 GLY n 1 85 ALA n 1 86 GLU n 1 87 LYS n 1 88 PRO n 1 89 LYS n 1 90 PHE n 1 91 LEU n 1 92 PRO n 1 93 ASP n 1 94 LEU n 1 95 TYR n 1 96 ASP n 1 97 TYR n 1 98 LYS n 1 99 GLU n 1 100 ASN n 1 101 ARG n 1 102 PHE n 1 103 ILE n 1 104 GLU n 1 105 ILE n 1 106 GLY n 1 107 VAL n 1 108 THR n 1 109 ARG n 1 110 ARG n 1 111 GLU n 1 112 VAL n 1 113 HIS n 1 114 ILE n 1 115 TYR n 1 116 TYR n 1 117 LEU n 1 118 GLU n 1 119 LYS n 1 120 ALA n 1 121 ASN n 1 122 LYS n 1 123 ILE n 1 124 LYS n 1 125 SER n 1 126 GLU n 1 127 LYS n 1 128 THR n 1 129 HIS n 1 130 ILE n 1 131 HIS n 1 132 ILE n 1 133 PHE n 1 134 SER n 1 135 PHE n 1 136 THR n 1 137 GLY n 1 138 GLU n 1 139 GLU n 1 140 MET n 1 141 ALA n 1 142 THR n 1 143 LYS n 1 144 ALA n 1 145 ASP n 1 146 TYR n 1 147 THR n 1 148 LEU n 1 149 ASP n 1 150 GLU n 1 151 GLU n 1 152 SER n 1 153 ARG n 1 154 ALA n 1 155 ARG n 1 156 ILE n 1 157 LYS n 1 158 THR n 1 159 ARG n 1 160 LEU n 1 161 PHE n 1 162 THR n 1 163 ILE n 1 164 ARG n 1 165 GLN n 1 166 GLU n 1 167 MET n 1 168 ALA n 1 169 SER n 1 170 ARG n 1 171 GLY n 1 172 LEU n 1 173 TRP n 1 174 ASP n 1 175 SER n 1 176 PHE n 1 177 ARG n 1 178 GLN n 1 179 SER n 1 180 GLU n 1 181 ARG n 1 182 GLY n 1 183 ALA n 1 184 ALA n 1 185 GLU n 1 186 LEU n 1 187 ALA n 1 188 LEU n 1 189 VAL n 1 190 PRO n 1 191 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 57 ? ? PA ? 'A/Puerto Rico/8/1934 H1N1' ? ? ? ? 'Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)' 211044 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3) pLysS' ? ? ? ? ? ? ? plasmid ? ? ? 'pET50b(+)' ? ? 1 2 sample 'Biological sequence' 58 191 ? ? PA ? 'A/Puerto Rico/8/1934 H1N1' ? ? ? ? 'Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)' 211044 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3) pLysS' ? ? ? ? ? ? ? plasmid ? ? ? 'pET50b(+)' ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PA_I34A1 P03433 ? 1 MEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSD 1 2 UNP PA_I34A1 P03433 ? 1 ;KHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERG ; 73 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5FDE A 6 ? 55 ? P03433 1 ? 50 ? 1 50 2 2 5FDE A 58 ? 182 ? P03433 73 ? 197 ? 73 197 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FDE GLY A 1 ? UNP P03433 ? ? 'expression tag' -4 1 1 5FDE PRO A 2 ? UNP P03433 ? ? 'expression tag' -3 2 1 5FDE LEU A 3 ? UNP P03433 ? ? 'expression tag' -2 3 1 5FDE GLY A 4 ? UNP P03433 ? ? 'expression tag' -1 4 1 5FDE SER A 5 ? UNP P03433 ? ? 'expression tag' 0 5 1 5FDE ALA A 56 ? UNP P03433 ? ? linker 51 6 1 5FDE SER A 57 ? UNP P03433 ? ? linker 52 7 2 5FDE ALA A 183 ? UNP P03433 ? ? 'expression tag' 198 8 2 5FDE ALA A 184 ? UNP P03433 ? ? 'expression tag' 199 9 2 5FDE GLU A 185 ? UNP P03433 ? ? 'expression tag' 200 10 2 5FDE LEU A 186 ? UNP P03433 ? ? 'expression tag' 201 11 2 5FDE ALA A 187 ? UNP P03433 ? ? 'expression tag' 202 12 2 5FDE LEU A 188 ? UNP P03433 ? ? 'expression tag' 203 13 2 5FDE VAL A 189 ? UNP P03433 ? ? 'expression tag' 204 14 2 5FDE PRO A 190 ? UNP P03433 ? ? 'expression tag' 205 15 2 5FDE ARG A 191 ? UNP P03433 ? ? 'expression tag' 206 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4P9 non-polymer . '4-{(E)-[2-(4-chlorophenyl)hydrazinylidene]methyl}benzene-1,2,3-triol' ? 'C13 H11 Cl N2 O3' 278.691 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5FDE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.19 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.42 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Crystals were grown with the reservoir containing 100 mM MES, 1.1 M ammonium sulfate, 0.1 M potassium chloride and 9 % trehalose at pH 5.8. Crystal was then soaked with the ligand solution at pH 7.0. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-12-05 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Numerical link type Si(111) double crystal monochromator, liquid nitrogen cooled' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9800 1.0 2 1.000 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-17A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-17A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5FDE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.150 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16066 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.000 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 25.351 _reflns.pdbx_netI_over_sigmaI 12.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.004 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.078 _reflns.pdbx_Rpim_I_all 0.026 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 145354 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.150 2.190 ? ? ? ? ? 787 ? 99.400 ? ? ? ? 1.034 ? ? ? ? ? ? ? ? 9.000 ? 1.020 ? ? 1.097 0.361 0 1 1 0.719 ? 2.190 2.230 ? ? ? ? ? 789 ? 99.400 ? ? ? ? 0.818 ? ? ? ? ? ? ? ? 8.400 ? 1.025 ? ? 0.872 0.295 0 2 1 0.784 ? 2.230 2.270 ? ? ? ? ? 779 ? 99.500 ? ? ? ? 0.677 ? ? ? ? ? ? ? ? 9.000 ? 1.009 ? ? 0.718 0.234 0 3 1 0.824 ? 2.270 2.320 ? ? ? ? ? 798 ? 99.400 ? ? ? ? 0.677 ? ? ? ? ? ? ? ? 8.800 ? 0.996 ? ? 0.720 0.238 0 4 1 0.839 ? 2.320 2.370 ? ? ? ? ? 817 ? 99.300 ? ? ? ? 0.586 ? ? ? ? ? ? ? ? 8.900 ? 1.014 ? ? 0.623 0.205 0 5 1 0.891 ? 2.370 2.420 ? ? ? ? ? 771 ? 98.700 ? ? ? ? 0.476 ? ? ? ? ? ? ? ? 9.500 ? 1.021 ? ? 0.503 0.161 0 6 1 0.927 ? 2.420 2.480 ? ? ? ? ? 808 ? 99.400 ? ? ? ? 0.407 ? ? ? ? ? ? ? ? 9.400 ? 1.017 ? ? 0.431 0.139 0 7 1 0.946 ? 2.480 2.550 ? ? ? ? ? 790 ? 99.000 ? ? ? ? 0.307 ? ? ? ? ? ? ? ? 9.400 ? 0.998 ? ? 0.325 0.105 0 8 1 0.961 ? 2.550 2.620 ? ? ? ? ? 790 ? 98.500 ? ? ? ? 0.249 ? ? ? ? ? ? ? ? 9.100 ? 1.008 ? ? 0.264 0.086 0 9 1 0.975 ? 2.620 2.710 ? ? ? ? ? 790 ? 98.600 ? ? ? ? 0.210 ? ? ? ? ? ? ? ? 8.700 ? 1.008 ? ? 0.224 0.075 0 10 1 0.978 ? 2.710 2.810 ? ? ? ? ? 801 ? 98.300 ? ? ? ? 0.177 ? ? ? ? ? ? ? ? 9.300 ? 1.001 ? ? 0.187 0.060 0 11 1 0.986 ? 2.810 2.920 ? ? ? ? ? 793 ? 98.100 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? 9.000 ? 0.998 ? ? 0.144 0.047 0 12 1 0.988 ? 2.920 3.050 ? ? ? ? ? 807 ? 98.400 ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 9.500 ? 1.027 ? ? 0.117 0.037 0 13 1 0.993 ? 3.050 3.210 ? ? ? ? ? 798 ? 97.800 ? ? ? ? 0.096 ? ? ? ? ? ? ? ? 9.500 ? 0.994 ? ? 0.101 0.032 0 14 1 0.995 ? 3.210 3.410 ? ? ? ? ? 794 ? 97.700 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? 9.300 ? 0.972 ? ? 0.077 0.025 0 15 1 0.997 ? 3.410 3.680 ? ? ? ? ? 804 ? 96.600 ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 9.200 ? 0.976 ? ? 0.068 0.022 0 16 1 0.998 ? 3.680 4.050 ? ? ? ? ? 815 ? 97.300 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 9.000 ? 1.010 ? ? 0.058 0.019 0 17 1 0.997 ? 4.050 4.630 ? ? ? ? ? 815 ? 96.700 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 9.200 ? 1.000 ? ? 0.051 0.016 0 18 1 0.998 ? 4.630 5.830 ? ? ? ? ? 826 ? 95.200 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 8.600 ? 1.005 ? ? 0.049 0.016 0 19 1 0.997 ? 5.830 50.000 ? ? ? ? ? 894 ? 94.100 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 8.300 ? 0.985 ? ? 0.041 0.014 0 20 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 116.990 _refine.B_iso_mean 48.3600 _refine.B_iso_min 24.430 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5FDE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1510 _refine.ls_d_res_low 37.9560 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16050 _refine.ls_number_reflns_R_free 813 _refine.ls_number_reflns_R_work 15237 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.2300 _refine.ls_percent_reflns_R_free 5.0700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2062 _refine.ls_R_factor_R_free 0.2273 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2051 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ZQQ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.6400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8361 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1510 _refine_hist.d_res_low 37.9560 _refine_hist.pdbx_number_atoms_ligand 45 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 1568 _refine_hist.pdbx_number_residues_total 181 _refine_hist.pdbx_B_iso_mean_ligand 72.93 _refine_hist.pdbx_B_iso_mean_solvent 43.94 _refine_hist.pdbx_number_atoms_protein 1493 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1567 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.076 ? 2104 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.064 ? 218 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 268 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.219 ? 589 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1514 2.2862 2631 . 138 2493 99.0000 . . . 0.2595 . 0.2585 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.2862 2.4627 2640 . 139 2501 99.0000 . . . 0.3151 . 0.2483 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.4627 2.7105 2641 . 118 2523 99.0000 . . . 0.3033 . 0.2347 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.7105 3.1025 2661 . 151 2510 98.0000 . . . 0.2734 . 0.2313 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.1025 3.9082 2688 . 135 2553 97.0000 . . . 0.2150 . 0.2012 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.9082 37.9621 2789 . 132 2657 96.0000 . . . 0.1885 . 0.1816 . . . . . . 6 . . . # _struct.entry_id 5FDE _struct.title 'Endonuclease inhibitor 2 bound to influenza strain H1N1 polymerase acidic subunit N-terminal region at pH 7.0' _struct.pdbx_descriptor 'Polymerase acidic protein' _struct.pdbx_model_details 'RNA binding protein' _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5FDE _struct_keywords.text 'Hydrolase-Hydrolase Inhibitor complex' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? PHE A 14 ? SER A 0 PHE A 9 1 ? 10 HELX_P HELX_P2 AA2 ASN A 15 ? TYR A 29 ? ASN A 10 TYR A 24 1 ? 15 HELX_P HELX_P3 AA3 GLU A 36 ? ALA A 56 ? GLU A 31 ALA A 51 1 ? 21 HELX_P HELX_P4 AA4 ASP A 68 ? GLY A 84 ? ASP A 83 GLY A 99 1 ? 17 HELX_P HELX_P5 AA5 GLU A 111 ? LYS A 124 ? GLU A 126 LYS A 139 1 ? 14 HELX_P HELX_P6 AA6 LYS A 143 ? ASP A 145 ? LYS A 158 ASP A 160 5 ? 3 HELX_P HELX_P7 AA7 ASP A 149 ? ARG A 170 ? ASP A 164 ARG A 185 1 ? 22 HELX_P HELX_P8 AA8 LEU A 172 ? SER A 179 ? LEU A 187 SER A 194 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 46 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 41 A MN 301 1_555 ? ? ? ? ? ? ? 2.259 ? metalc2 metalc ? ? A GLU 65 OE1 ? ? ? 1_555 C MN . MN ? ? A GLU 80 A MN 302 1_555 ? ? ? ? ? ? ? 1.940 ? metalc3 metalc ? ? A ASP 93 OD1 ? ? ? 1_555 C MN . MN ? ? A ASP 108 A MN 302 1_555 ? ? ? ? ? ? ? 2.063 ? metalc4 metalc ? ? A ASP 93 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 108 A MN 301 1_555 ? ? ? ? ? ? ? 2.089 ? metalc5 metalc ? ? A GLU 104 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 119 A MN 301 1_555 ? ? ? ? ? ? ? 1.982 ? metalc6 metalc ? ? A ILE 105 O ? ? ? 1_555 B MN . MN ? ? A ILE 120 A MN 301 1_555 ? ? ? ? ? ? ? 2.121 ? metalc7 metalc ? ? B MN . MN ? ? ? 1_555 F 4P9 . OAG ? ? A MN 301 A 4P9 305 1_555 ? ? ? ? ? ? ? 2.110 ? metalc8 metalc ? ? B MN . MN ? ? ? 1_555 F 4P9 . OAH ? ? A MN 301 A 4P9 305 1_555 ? ? ? ? ? ? ? 1.999 ? metalc9 metalc ? ? C MN . MN ? ? ? 1_555 G HOH . O ? ? A MN 302 A HOH 409 1_555 ? ? ? ? ? ? ? 1.997 ? metalc10 metalc ? ? C MN . MN ? ? ? 1_555 G HOH . O ? ? A MN 302 A HOH 410 1_555 ? ? ? ? ? ? ? 2.007 ? metalc11 metalc ? ? C MN . MN ? ? ? 1_555 F 4P9 . OAH ? ? A MN 302 A 4P9 305 1_555 ? ? ? ? ? ? ? 2.119 ? metalc12 metalc ? ? C MN . MN ? ? ? 1_555 F 4P9 . OAI ? ? A MN 302 A 4P9 305 1_555 ? ? ? ? ? ? ? 2.196 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 61 ? ILE A 63 ? PHE A 76 ILE A 78 AA1 2 LEU A 94 ? ASP A 96 ? LEU A 109 ASP A 111 AA1 3 ARG A 101 ? THR A 108 ? ARG A 116 THR A 123 AA1 4 HIS A 129 ? SER A 134 ? HIS A 144 SER A 149 AA1 5 GLU A 139 ? ALA A 141 ? GLU A 154 ALA A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 62 ? N GLU A 77 O TYR A 95 ? O TYR A 110 AA1 2 3 N ASP A 96 ? N ASP A 111 O ARG A 101 ? O ARG A 116 AA1 3 4 N GLU A 104 ? N GLU A 119 O HIS A 129 ? O HIS A 144 AA1 4 5 N ILE A 132 ? N ILE A 147 O MET A 140 ? O MET A 155 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 301 ? 5 'binding site for residue MN A 301' AC2 Software A MN 302 ? 5 'binding site for residue MN A 302' AC3 Software A SO4 303 ? 4 'binding site for residue SO4 A 303' AC4 Software A 4P9 304 ? 8 'binding site for residue 4P9 A 304' AC5 Software A 4P9 305 ? 10 'binding site for residue 4P9 A 305' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 46 ? HIS A 41 . ? 1_555 ? 2 AC1 5 ASP A 93 ? ASP A 108 . ? 1_555 ? 3 AC1 5 GLU A 104 ? GLU A 119 . ? 1_555 ? 4 AC1 5 ILE A 105 ? ILE A 120 . ? 1_555 ? 5 AC1 5 4P9 F . ? 4P9 A 305 . ? 1_555 ? 6 AC2 5 GLU A 65 ? GLU A 80 . ? 1_555 ? 7 AC2 5 ASP A 93 ? ASP A 108 . ? 1_555 ? 8 AC2 5 4P9 F . ? 4P9 A 305 . ? 1_555 ? 9 AC2 5 HOH G . ? HOH A 409 . ? 1_555 ? 10 AC2 5 HOH G . ? HOH A 410 . ? 1_555 ? 11 AC3 4 ARG A 109 ? ARG A 124 . ? 1_555 ? 12 AC3 4 ARG A 164 ? ARG A 179 . ? 1_555 ? 13 AC3 4 TRP A 173 ? TRP A 188 . ? 1_555 ? 14 AC3 4 ARG A 177 ? ARG A 192 . ? 1_555 ? 15 AC4 8 GLU A 36 ? GLU A 31 . ? 1_555 ? 16 AC4 8 LYS A 39 ? LYS A 34 . ? 1_555 ? 17 AC4 8 ALA A 42 ? ALA A 37 . ? 1_555 ? 18 AC4 8 ARG A 109 ? ARG A 124 . ? 1_555 ? 19 AC4 8 PHE A 135 ? PHE A 150 . ? 1_555 ? 20 AC4 8 PHE A 176 ? PHE A 191 . ? 1_555 ? 21 AC4 8 SER A 179 ? SER A 194 . ? 1_555 ? 22 AC4 8 GLU A 180 ? GLU A 195 . ? 1_555 ? 23 AC5 10 TYR A 29 ? TYR A 24 . ? 1_555 ? 24 AC5 10 HIS A 46 ? HIS A 41 . ? 1_555 ? 25 AC5 10 GLU A 65 ? GLU A 80 . ? 1_555 ? 26 AC5 10 ASP A 93 ? ASP A 108 . ? 1_555 ? 27 AC5 10 GLU A 104 ? GLU A 119 . ? 1_555 ? 28 AC5 10 ILE A 105 ? ILE A 120 . ? 1_555 ? 29 AC5 10 LYS A 119 ? LYS A 134 . ? 1_555 ? 30 AC5 10 MN B . ? MN A 301 . ? 1_555 ? 31 AC5 10 MN C . ? MN A 302 . ? 1_555 ? 32 AC5 10 HOH G . ? HOH A 410 . ? 1_555 ? # _atom_sites.entry_id 5FDE _atom_sites.fract_transf_matrix[1][1] 0.015020 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015020 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007793 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 -4 GLY GLY A . n A 1 2 PRO 2 -3 -3 PRO PRO A . n A 1 3 LEU 3 -2 -2 LEU LEU A . n A 1 4 GLY 4 -1 -1 GLY GLY A . n A 1 5 SER 5 0 0 SER SER A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 GLU 7 2 2 GLU GLU A . n A 1 8 ASP 8 3 3 ASP ASP A . n A 1 9 PHE 9 4 4 PHE PHE A . n A 1 10 VAL 10 5 5 VAL VAL A . n A 1 11 ARG 11 6 6 ARG ARG A . n A 1 12 GLN 12 7 7 GLN GLN A . n A 1 13 CYS 13 8 8 CYS CYS A . n A 1 14 PHE 14 9 9 PHE PHE A . n A 1 15 ASN 15 10 10 ASN ASN A . n A 1 16 PRO 16 11 11 PRO PRO A . n A 1 17 MET 17 12 12 MET MET A . n A 1 18 ILE 18 13 13 ILE ILE A . n A 1 19 VAL 19 14 14 VAL VAL A . n A 1 20 GLU 20 15 15 GLU GLU A . n A 1 21 LEU 21 16 16 LEU LEU A . n A 1 22 ALA 22 17 17 ALA ALA A . n A 1 23 GLU 23 18 18 GLU GLU A . n A 1 24 LYS 24 19 19 LYS LYS A . n A 1 25 THR 25 20 20 THR THR A . n A 1 26 MET 26 21 21 MET MET A . n A 1 27 LYS 27 22 22 LYS LYS A . n A 1 28 GLU 28 23 23 GLU GLU A . n A 1 29 TYR 29 24 24 TYR TYR A . n A 1 30 GLY 30 25 25 GLY GLY A . n A 1 31 GLU 31 26 26 GLU GLU A . n A 1 32 ASP 32 27 27 ASP ASP A . n A 1 33 LEU 33 28 28 LEU LEU A . n A 1 34 LYS 34 29 29 LYS LYS A . n A 1 35 ILE 35 30 30 ILE ILE A . n A 1 36 GLU 36 31 31 GLU GLU A . n A 1 37 THR 37 32 32 THR THR A . n A 1 38 ASN 38 33 33 ASN ASN A . n A 1 39 LYS 39 34 34 LYS LYS A . n A 1 40 PHE 40 35 35 PHE PHE A . n A 1 41 ALA 41 36 36 ALA ALA A . n A 1 42 ALA 42 37 37 ALA ALA A . n A 1 43 ILE 43 38 38 ILE ILE A . n A 1 44 CYS 44 39 39 CYS CYS A . n A 1 45 THR 45 40 40 THR THR A . n A 1 46 HIS 46 41 41 HIS HIS A . n A 1 47 LEU 47 42 42 LEU LEU A . n A 1 48 GLU 48 43 43 GLU GLU A . n A 1 49 VAL 49 44 44 VAL VAL A . n A 1 50 CYS 50 45 45 CYS CYS A . n A 1 51 PHE 51 46 46 PHE PHE A . n A 1 52 MET 52 47 47 MET MET A . n A 1 53 TYR 53 48 48 TYR TYR A . n A 1 54 SER 54 49 49 SER SER A . n A 1 55 ASP 55 50 50 ASP ASP A . n A 1 56 ALA 56 51 51 ALA ALA A . n A 1 57 SER 57 52 52 SER SER A . n A 1 58 LYS 58 73 73 LYS LYS A . n A 1 59 HIS 59 74 74 HIS HIS A . n A 1 60 ARG 60 75 75 ARG ARG A . n A 1 61 PHE 61 76 76 PHE PHE A . n A 1 62 GLU 62 77 77 GLU GLU A . n A 1 63 ILE 63 78 78 ILE ILE A . n A 1 64 ILE 64 79 79 ILE ILE A . n A 1 65 GLU 65 80 80 GLU GLU A . n A 1 66 GLY 66 81 81 GLY GLY A . n A 1 67 ARG 67 82 82 ARG ARG A . n A 1 68 ASP 68 83 83 ASP ASP A . n A 1 69 ARG 69 84 84 ARG ARG A . n A 1 70 THR 70 85 85 THR THR A . n A 1 71 MET 71 86 86 MET MET A . n A 1 72 ALA 72 87 87 ALA ALA A . n A 1 73 TRP 73 88 88 TRP TRP A . n A 1 74 THR 74 89 89 THR THR A . n A 1 75 VAL 75 90 90 VAL VAL A . n A 1 76 VAL 76 91 91 VAL VAL A . n A 1 77 ASN 77 92 92 ASN ASN A . n A 1 78 SER 78 93 93 SER SER A . n A 1 79 ILE 79 94 94 ILE ILE A . n A 1 80 CYS 80 95 95 CYS CYS A . n A 1 81 ASN 81 96 96 ASN ASN A . n A 1 82 THR 82 97 97 THR THR A . n A 1 83 THR 83 98 98 THR THR A . n A 1 84 GLY 84 99 99 GLY GLY A . n A 1 85 ALA 85 100 100 ALA ALA A . n A 1 86 GLU 86 101 101 GLU GLU A . n A 1 87 LYS 87 102 102 LYS LYS A . n A 1 88 PRO 88 103 103 PRO PRO A . n A 1 89 LYS 89 104 104 LYS LYS A . n A 1 90 PHE 90 105 105 PHE PHE A . n A 1 91 LEU 91 106 106 LEU LEU A . n A 1 92 PRO 92 107 107 PRO PRO A . n A 1 93 ASP 93 108 108 ASP ASP A . n A 1 94 LEU 94 109 109 LEU LEU A . n A 1 95 TYR 95 110 110 TYR TYR A . n A 1 96 ASP 96 111 111 ASP ASP A . n A 1 97 TYR 97 112 112 TYR TYR A . n A 1 98 LYS 98 113 113 LYS LYS A . n A 1 99 GLU 99 114 114 GLU GLU A . n A 1 100 ASN 100 115 115 ASN ASN A . n A 1 101 ARG 101 116 116 ARG ARG A . n A 1 102 PHE 102 117 117 PHE PHE A . n A 1 103 ILE 103 118 118 ILE ILE A . n A 1 104 GLU 104 119 119 GLU GLU A . n A 1 105 ILE 105 120 120 ILE ILE A . n A 1 106 GLY 106 121 121 GLY GLY A . n A 1 107 VAL 107 122 122 VAL VAL A . n A 1 108 THR 108 123 123 THR THR A . n A 1 109 ARG 109 124 124 ARG ARG A . n A 1 110 ARG 110 125 125 ARG ARG A . n A 1 111 GLU 111 126 126 GLU GLU A . n A 1 112 VAL 112 127 127 VAL VAL A . n A 1 113 HIS 113 128 128 HIS HIS A . n A 1 114 ILE 114 129 129 ILE ILE A . n A 1 115 TYR 115 130 130 TYR TYR A . n A 1 116 TYR 116 131 131 TYR TYR A . n A 1 117 LEU 117 132 132 LEU LEU A . n A 1 118 GLU 118 133 133 GLU GLU A . n A 1 119 LYS 119 134 134 LYS LYS A . n A 1 120 ALA 120 135 135 ALA ALA A . n A 1 121 ASN 121 136 136 ASN ASN A . n A 1 122 LYS 122 137 137 LYS LYS A . n A 1 123 ILE 123 138 138 ILE ILE A . n A 1 124 LYS 124 139 139 LYS LYS A . n A 1 125 SER 125 140 140 SER SER A . n A 1 126 GLU 126 141 141 GLU GLU A . n A 1 127 LYS 127 142 142 LYS LYS A . n A 1 128 THR 128 143 143 THR THR A . n A 1 129 HIS 129 144 144 HIS HIS A . n A 1 130 ILE 130 145 145 ILE ILE A . n A 1 131 HIS 131 146 146 HIS HIS A . n A 1 132 ILE 132 147 147 ILE ILE A . n A 1 133 PHE 133 148 148 PHE PHE A . n A 1 134 SER 134 149 149 SER SER A . n A 1 135 PHE 135 150 150 PHE PHE A . n A 1 136 THR 136 151 151 THR THR A . n A 1 137 GLY 137 152 152 GLY GLY A . n A 1 138 GLU 138 153 153 GLU GLU A . n A 1 139 GLU 139 154 154 GLU GLU A . n A 1 140 MET 140 155 155 MET MET A . n A 1 141 ALA 141 156 156 ALA ALA A . n A 1 142 THR 142 157 157 THR THR A . n A 1 143 LYS 143 158 158 LYS LYS A . n A 1 144 ALA 144 159 159 ALA ALA A . n A 1 145 ASP 145 160 160 ASP ASP A . n A 1 146 TYR 146 161 161 TYR TYR A . n A 1 147 THR 147 162 162 THR THR A . n A 1 148 LEU 148 163 163 LEU LEU A . n A 1 149 ASP 149 164 164 ASP ASP A . n A 1 150 GLU 150 165 165 GLU GLU A . n A 1 151 GLU 151 166 166 GLU GLU A . n A 1 152 SER 152 167 167 SER SER A . n A 1 153 ARG 153 168 168 ARG ARG A . n A 1 154 ALA 154 169 169 ALA ALA A . n A 1 155 ARG 155 170 170 ARG ARG A . n A 1 156 ILE 156 171 171 ILE ILE A . n A 1 157 LYS 157 172 172 LYS LYS A . n A 1 158 THR 158 173 173 THR THR A . n A 1 159 ARG 159 174 174 ARG ARG A . n A 1 160 LEU 160 175 175 LEU LEU A . n A 1 161 PHE 161 176 176 PHE PHE A . n A 1 162 THR 162 177 177 THR THR A . n A 1 163 ILE 163 178 178 ILE ILE A . n A 1 164 ARG 164 179 179 ARG ARG A . n A 1 165 GLN 165 180 180 GLN GLN A . n A 1 166 GLU 166 181 181 GLU GLU A . n A 1 167 MET 167 182 182 MET MET A . n A 1 168 ALA 168 183 183 ALA ALA A . n A 1 169 SER 169 184 184 SER SER A . n A 1 170 ARG 170 185 185 ARG ARG A . n A 1 171 GLY 171 186 186 GLY GLY A . n A 1 172 LEU 172 187 187 LEU LEU A . n A 1 173 TRP 173 188 188 TRP TRP A . n A 1 174 ASP 174 189 189 ASP ASP A . n A 1 175 SER 175 190 190 SER SER A . n A 1 176 PHE 176 191 191 PHE PHE A . n A 1 177 ARG 177 192 192 ARG ARG A . n A 1 178 GLN 178 193 193 GLN GLN A . n A 1 179 SER 179 194 194 SER SER A . n A 1 180 GLU 180 195 195 GLU GLU A . n A 1 181 ARG 181 196 196 ARG ARG A . n A 1 182 GLY 182 197 ? ? ? A . n A 1 183 ALA 183 198 ? ? ? A . n A 1 184 ALA 184 199 ? ? ? A . n A 1 185 GLU 185 200 ? ? ? A . n A 1 186 LEU 186 201 ? ? ? A . n A 1 187 ALA 187 202 ? ? ? A . n A 1 188 LEU 188 203 ? ? ? A . n A 1 189 VAL 189 204 ? ? ? A . n A 1 190 PRO 190 205 ? ? ? A . n A 1 191 ARG 191 206 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 301 301 MN MN A . C 2 MN 1 302 302 MN MN A . D 3 SO4 1 303 303 SO4 SO4 A . E 4 4P9 1 304 1 4P9 DRG A . F 4 4P9 1 305 2 4P9 DRG A . G 5 HOH 1 401 22 HOH HOH A . G 5 HOH 2 402 25 HOH HOH A . G 5 HOH 3 403 19 HOH HOH A . G 5 HOH 4 404 12 HOH HOH A . G 5 HOH 5 405 3 HOH HOH A . G 5 HOH 6 406 15 HOH HOH A . G 5 HOH 7 407 27 HOH HOH A . G 5 HOH 8 408 26 HOH HOH A . G 5 HOH 9 409 23 HOH HOH A . G 5 HOH 10 410 28 HOH HOH A . G 5 HOH 11 411 9 HOH HOH A . G 5 HOH 12 412 20 HOH HOH A . G 5 HOH 13 413 4 HOH HOH A . G 5 HOH 14 414 30 HOH HOH A . G 5 HOH 15 415 8 HOH HOH A . G 5 HOH 16 416 13 HOH HOH A . G 5 HOH 17 417 16 HOH HOH A . G 5 HOH 18 418 18 HOH HOH A . G 5 HOH 19 419 7 HOH HOH A . G 5 HOH 20 420 6 HOH HOH A . G 5 HOH 21 421 5 HOH HOH A . G 5 HOH 22 422 2 HOH HOH A . G 5 HOH 23 423 14 HOH HOH A . G 5 HOH 24 424 29 HOH HOH A . G 5 HOH 25 425 24 HOH HOH A . G 5 HOH 26 426 1 HOH HOH A . G 5 HOH 27 427 21 HOH HOH A . G 5 HOH 28 428 17 HOH HOH A . G 5 HOH 29 429 10 HOH HOH A . G 5 HOH 30 430 11 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 190 ? 1 MORE -15 ? 1 'SSA (A^2)' 10080 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 46 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OD2 ? A ASP 93 ? A ASP 108 ? 1_555 101.0 ? 2 NE2 ? A HIS 46 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE2 ? A GLU 104 ? A GLU 119 ? 1_555 173.6 ? 3 OD2 ? A ASP 93 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE2 ? A GLU 104 ? A GLU 119 ? 1_555 81.7 ? 4 NE2 ? A HIS 46 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 105 ? A ILE 120 ? 1_555 84.1 ? 5 OD2 ? A ASP 93 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 105 ? A ILE 120 ? 1_555 95.9 ? 6 OE2 ? A GLU 104 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 105 ? A ILE 120 ? 1_555 89.9 ? 7 NE2 ? A HIS 46 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OAG ? F 4P9 . ? A 4P9 305 ? 1_555 76.9 ? 8 OD2 ? A ASP 93 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OAG ? F 4P9 . ? A 4P9 305 ? 1_555 175.1 ? 9 OE2 ? A GLU 104 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OAG ? F 4P9 . ? A 4P9 305 ? 1_555 100.8 ? 10 O ? A ILE 105 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OAG ? F 4P9 . ? A 4P9 305 ? 1_555 88.4 ? 11 NE2 ? A HIS 46 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OAH ? F 4P9 . ? A 4P9 305 ? 1_555 86.6 ? 12 OD2 ? A ASP 93 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OAH ? F 4P9 . ? A 4P9 305 ? 1_555 94.3 ? 13 OE2 ? A GLU 104 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OAH ? F 4P9 . ? A 4P9 305 ? 1_555 99.0 ? 14 O ? A ILE 105 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OAH ? F 4P9 . ? A 4P9 305 ? 1_555 167.4 ? 15 OAG ? F 4P9 . ? A 4P9 305 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OAH ? F 4P9 . ? A 4P9 305 ? 1_555 81.1 ? 16 OE1 ? A GLU 65 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OD1 ? A ASP 93 ? A ASP 108 ? 1_555 86.6 ? 17 OE1 ? A GLU 65 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 409 ? 1_555 82.0 ? 18 OD1 ? A ASP 93 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 409 ? 1_555 95.3 ? 19 OE1 ? A GLU 65 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 410 ? 1_555 168.4 ? 20 OD1 ? A ASP 93 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 410 ? 1_555 88.2 ? 21 O ? G HOH . ? A HOH 409 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? G HOH . ? A HOH 410 ? 1_555 88.2 ? 22 OE1 ? A GLU 65 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OAH ? F 4P9 . ? A 4P9 305 ? 1_555 100.0 ? 23 OD1 ? A ASP 93 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OAH ? F 4P9 . ? A 4P9 305 ? 1_555 81.2 ? 24 O ? G HOH . ? A HOH 409 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OAH ? F 4P9 . ? A 4P9 305 ? 1_555 175.9 ? 25 O ? G HOH . ? A HOH 410 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OAH ? F 4P9 . ? A 4P9 305 ? 1_555 89.4 ? 26 OE1 ? A GLU 65 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OAI ? F 4P9 . ? A 4P9 305 ? 1_555 102.7 ? 27 OD1 ? A ASP 93 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OAI ? F 4P9 . ? A 4P9 305 ? 1_555 157.3 ? 28 O ? G HOH . ? A HOH 409 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OAI ? F 4P9 . ? A 4P9 305 ? 1_555 106.3 ? 29 O ? G HOH . ? A HOH 410 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OAI ? F 4P9 . ? A 4P9 305 ? 1_555 85.9 ? 30 OAH ? F 4P9 . ? A 4P9 305 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OAI ? F 4P9 . ? A 4P9 305 ? 1_555 76.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-30 2 'Structure model' 1 1 2016-02-17 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? 11.0.05 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 'phenix.refine: 1.8.1_1168' 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG1 A THR 151 ? ? OE1 A GLU 153 ? ? 1.90 2 1 OE2 A GLU 77 ? ? O A HOH 401 ? ? 2.10 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 52 ? ? -161.37 85.27 2 1 HIS A 74 ? ? 74.17 -0.36 3 1 LYS A 139 ? ? 72.06 -3.09 4 1 THR A 162 ? ? 65.25 -58.74 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 197 ? A GLY 182 2 1 Y 1 A ALA 198 ? A ALA 183 3 1 Y 1 A ALA 199 ? A ALA 184 4 1 Y 1 A GLU 200 ? A GLU 185 5 1 Y 1 A LEU 201 ? A LEU 186 6 1 Y 1 A ALA 202 ? A ALA 187 7 1 Y 1 A LEU 203 ? A LEU 188 8 1 Y 1 A VAL 204 ? A VAL 189 9 1 Y 1 A PRO 205 ? A PRO 190 10 1 Y 1 A ARG 206 ? A ARG 191 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 24590548 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 'SULFATE ION' SO4 4 '4-{(E)-[2-(4-chlorophenyl)hydrazinylidene]methyl}benzene-1,2,3-triol' 4P9 5 water HOH #