data_5FDG # _entry.id 5FDG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5FDG pdb_00005fdg 10.2210/pdb5fdg/pdb WWPDB D_1000216406 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5FDD unspecified PDB . 5FDE unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5FDG _pdbx_database_status.recvd_initial_deposition_date 2015-12-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fudo, S.' 1 'Yamamoto, N.' 2 'Nukaga, M.' 3 'Odagiri, T.' 4 'Tashiro, M.' 5 'Hoshino, T.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 55 _citation.language ? _citation.page_first 2646 _citation.page_last 2660 _citation.title 'Two Distinctive Binding Modes of Endonuclease Inhibitors to the N-Terminal Region of Influenza Virus Polymerase Acidic Subunit' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.5b01087 _citation.pdbx_database_id_PubMed 27088785 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fudo, S.' 1 ? primary 'Yamamoto, N.' 2 ? primary 'Nukaga, M.' 3 ? primary 'Odagiri, T.' 4 ? primary 'Tashiro, M.' 5 ? primary 'Hoshino, T.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5FDG _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.438 _cell.length_a_esd ? _cell.length_b 66.438 _cell.length_b_esd ? _cell.length_c 126.977 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FDG _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein' 22300.494 1 ? ? 'endonuclease, residues 1-50, 73-196' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 4 non-polymer syn '(2Z)-4-[1-benzyl-4-(4-chlorobenzyl)piperidin-4-yl]-2-hydroxy-4-oxobut-2-enoic acid' 413.894 1 ? ? ? ? 5 water nat water 18.015 99 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHRFEIIEGRDRTMAWTVVNSIC NTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL FTIRQEMASRGLWDSFRQSERGAAELALVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHRFEIIEGRDRTMAWTVVNSIC NTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL FTIRQEMASRGLWDSFRQSERGAAELALVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ASP n 1 9 PHE n 1 10 VAL n 1 11 ARG n 1 12 GLN n 1 13 CYS n 1 14 PHE n 1 15 ASN n 1 16 PRO n 1 17 MET n 1 18 ILE n 1 19 VAL n 1 20 GLU n 1 21 LEU n 1 22 ALA n 1 23 GLU n 1 24 LYS n 1 25 THR n 1 26 MET n 1 27 LYS n 1 28 GLU n 1 29 TYR n 1 30 GLY n 1 31 GLU n 1 32 ASP n 1 33 LEU n 1 34 LYS n 1 35 ILE n 1 36 GLU n 1 37 THR n 1 38 ASN n 1 39 LYS n 1 40 PHE n 1 41 ALA n 1 42 ALA n 1 43 ILE n 1 44 CYS n 1 45 THR n 1 46 HIS n 1 47 LEU n 1 48 GLU n 1 49 VAL n 1 50 CYS n 1 51 PHE n 1 52 MET n 1 53 TYR n 1 54 SER n 1 55 ASP n 1 56 ALA n 1 57 SER n 1 58 LYS n 1 59 HIS n 1 60 ARG n 1 61 PHE n 1 62 GLU n 1 63 ILE n 1 64 ILE n 1 65 GLU n 1 66 GLY n 1 67 ARG n 1 68 ASP n 1 69 ARG n 1 70 THR n 1 71 MET n 1 72 ALA n 1 73 TRP n 1 74 THR n 1 75 VAL n 1 76 VAL n 1 77 ASN n 1 78 SER n 1 79 ILE n 1 80 CYS n 1 81 ASN n 1 82 THR n 1 83 THR n 1 84 GLY n 1 85 ALA n 1 86 GLU n 1 87 LYS n 1 88 PRO n 1 89 LYS n 1 90 PHE n 1 91 LEU n 1 92 PRO n 1 93 ASP n 1 94 LEU n 1 95 TYR n 1 96 ASP n 1 97 TYR n 1 98 LYS n 1 99 GLU n 1 100 ASN n 1 101 ARG n 1 102 PHE n 1 103 ILE n 1 104 GLU n 1 105 ILE n 1 106 GLY n 1 107 VAL n 1 108 THR n 1 109 ARG n 1 110 ARG n 1 111 GLU n 1 112 VAL n 1 113 HIS n 1 114 ILE n 1 115 TYR n 1 116 TYR n 1 117 LEU n 1 118 GLU n 1 119 LYS n 1 120 ALA n 1 121 ASN n 1 122 LYS n 1 123 ILE n 1 124 LYS n 1 125 SER n 1 126 GLU n 1 127 LYS n 1 128 THR n 1 129 HIS n 1 130 ILE n 1 131 HIS n 1 132 ILE n 1 133 PHE n 1 134 SER n 1 135 PHE n 1 136 THR n 1 137 GLY n 1 138 GLU n 1 139 GLU n 1 140 MET n 1 141 ALA n 1 142 THR n 1 143 LYS n 1 144 ALA n 1 145 ASP n 1 146 TYR n 1 147 THR n 1 148 LEU n 1 149 ASP n 1 150 GLU n 1 151 GLU n 1 152 SER n 1 153 ARG n 1 154 ALA n 1 155 ARG n 1 156 ILE n 1 157 LYS n 1 158 THR n 1 159 ARG n 1 160 LEU n 1 161 PHE n 1 162 THR n 1 163 ILE n 1 164 ARG n 1 165 GLN n 1 166 GLU n 1 167 MET n 1 168 ALA n 1 169 SER n 1 170 ARG n 1 171 GLY n 1 172 LEU n 1 173 TRP n 1 174 ASP n 1 175 SER n 1 176 PHE n 1 177 ARG n 1 178 GLN n 1 179 SER n 1 180 GLU n 1 181 ARG n 1 182 GLY n 1 183 ALA n 1 184 ALA n 1 185 GLU n 1 186 LEU n 1 187 ALA n 1 188 LEU n 1 189 VAL n 1 190 PRO n 1 191 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 57 ? ? PA ? 'A/Puerto Rico/8/1934 H1N1' ? ? ? ? 'Influenza A virus' 211044 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3) pLysS' ? ? ? ? ? ? ? plasmid ? ? ? 'pET50b(+)' ? ? 1 2 sample 'Biological sequence' 58 191 ? ? PA ? 'A/Puerto Rico/8/1934 H1N1' ? ? ? ? 'Influenza A virus' 211044 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'Rosetta (DE3) pLysS' ? ? ? ? ? ? ? plasmid ? ? ? 'pET50b(+)' ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PA_I34A1 P03433 ? 1 MEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSD 1 2 UNP PA_I34A1 P03433 ? 1 ;KHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERG ; 73 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5FDG A 6 ? 55 ? P03433 1 ? 50 ? 6 55 2 2 5FDG A 58 ? 182 ? P03433 73 ? 197 ? 58 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FDG GLY A 1 ? UNP P03433 ? ? 'expression tag' 1 1 1 5FDG PRO A 2 ? UNP P03433 ? ? 'expression tag' 2 2 1 5FDG LEU A 3 ? UNP P03433 ? ? 'expression tag' 3 3 1 5FDG GLY A 4 ? UNP P03433 ? ? 'expression tag' 4 4 1 5FDG SER A 5 ? UNP P03433 ? ? 'expression tag' 5 5 1 5FDG ALA A 56 ? UNP P03433 ? ? linker 56 6 1 5FDG SER A 57 ? UNP P03433 ? ? linker 57 7 2 5FDG ALA A 183 ? UNP P03433 ? ? 'expression tag' 183 8 2 5FDG ALA A 184 ? UNP P03433 ? ? 'expression tag' 184 9 2 5FDG GLU A 185 ? UNP P03433 ? ? 'expression tag' 185 10 2 5FDG LEU A 186 ? UNP P03433 ? ? 'expression tag' 186 11 2 5FDG ALA A 187 ? UNP P03433 ? ? 'expression tag' 187 12 2 5FDG LEU A 188 ? UNP P03433 ? ? 'expression tag' 188 13 2 5FDG VAL A 189 ? UNP P03433 ? ? 'expression tag' 189 14 2 5FDG PRO A 190 ? UNP P03433 ? ? 'expression tag' 190 15 2 5FDG ARG A 191 ? UNP P03433 ? ? 'expression tag' 191 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0N8 non-polymer . '(2Z)-4-[1-benzyl-4-(4-chlorobenzyl)piperidin-4-yl]-2-hydroxy-4-oxobut-2-enoic acid' ? 'C23 H24 Cl N O4' 413.894 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5FDG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.85 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100mM MES, 1.1M ammonium sulfate, 0.1M potassium chloride and 9% trehalose' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-06-27 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Numerical link type Si(111) double crystal monochromator, liquid nitrogen cooled' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-17A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-17A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate 37.420 _reflns.entry_id 5FDG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.100 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17513 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.200 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.000 _reflns.pdbx_Rmerge_I_obs 0.115 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 22.150 _reflns.pdbx_netI_over_sigmaI 9.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.008 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.120 _reflns.pdbx_Rpim_I_all 0.035 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 210260 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.100 2.140 ? ? ? ? ? 828 ? 98.700 ? ? ? ? 1.100 ? ? ? ? ? ? ? ? 11.300 ? 1.004 ? ? 1.152 0.339 0 1 1 0.804 ? 2.140 2.180 ? ? ? ? ? 847 ? 98.800 ? ? ? ? 0.902 ? ? ? ? ? ? ? ? 12.000 ? 1.014 ? ? 0.941 0.267 0 2 1 0.855 ? 2.180 2.220 ? ? ? ? ? 853 ? 98.800 ? ? ? ? 0.715 ? ? ? ? ? ? ? ? 11.800 ? 1.013 ? ? 0.747 0.214 0 3 1 0.886 ? 2.220 2.260 ? ? ? ? ? 857 ? 99.000 ? ? ? ? 0.637 ? ? ? ? ? ? ? ? 12.400 ? 1.013 ? ? 0.665 0.186 0 4 1 0.925 ? 2.260 2.310 ? ? ? ? ? 862 ? 99.000 ? ? ? ? 0.632 ? ? ? ? ? ? ? ? 13.000 ? 1.012 ? ? 0.657 0.179 0 5 1 0.949 ? 2.310 2.370 ? ? ? ? ? 849 ? 98.800 ? ? ? ? 0.577 ? ? ? ? ? ? ? ? 13.000 ? 0.970 ? ? 0.600 0.164 0 6 1 0.955 ? 2.370 2.420 ? ? ? ? ? 844 ? 98.900 ? ? ? ? 0.488 ? ? ? ? ? ? ? ? 12.800 ? 1.021 ? ? 0.509 0.140 0 7 1 0.963 ? 2.420 2.490 ? ? ? ? ? 878 ? 99.300 ? ? ? ? 0.406 ? ? ? ? ? ? ? ? 12.600 ? 1.026 ? ? 0.423 0.118 0 8 1 0.970 ? 2.490 2.560 ? ? ? ? ? 847 ? 98.700 ? ? ? ? 0.342 ? ? ? ? ? ? ? ? 11.800 ? 0.996 ? ? 0.358 0.103 0 9 1 0.976 ? 2.560 2.650 ? ? ? ? ? 866 ? 99.300 ? ? ? ? 0.300 ? ? ? ? ? ? ? ? 12.500 ? 1.033 ? ? 0.313 0.088 0 10 1 0.978 ? 2.650 2.740 ? ? ? ? ? 853 ? 99.200 ? ? ? ? 0.276 ? ? ? ? ? ? ? ? 12.000 ? 1.032 ? ? 0.288 0.082 0 11 1 0.979 ? 2.740 2.850 ? ? ? ? ? 875 ? 99.300 ? ? ? ? 0.219 ? ? ? ? ? ? ? ? 12.800 ? 0.986 ? ? 0.228 0.063 0 12 1 0.986 ? 2.850 2.980 ? ? ? ? ? 868 ? 98.500 ? ? ? ? 0.179 ? ? ? ? ? ? ? ? 12.800 ? 0.995 ? ? 0.187 0.052 0 13 1 0.990 ? 2.980 3.140 ? ? ? ? ? 876 ? 99.300 ? ? ? ? 0.144 ? ? ? ? ? ? ? ? 12.400 ? 1.002 ? ? 0.151 0.042 0 14 1 0.993 ? 3.140 3.330 ? ? ? ? ? 877 ? 99.500 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 11.600 ? 0.989 ? ? 0.123 0.036 0 15 1 0.995 ? 3.330 3.590 ? ? ? ? ? 885 ? 99.700 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 11.600 ? 1.024 ? ? 0.097 0.029 0 16 1 0.997 ? 3.590 3.950 ? ? ? ? ? 906 ? 99.500 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 11.800 ? 1.001 ? ? 0.080 0.024 0 17 1 0.998 ? 3.950 4.520 ? ? ? ? ? 900 ? 99.600 ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 11.400 ? 1.018 ? ? 0.067 0.020 0 18 1 0.998 ? 4.520 5.700 ? ? ? ? ? 925 ? 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 10.600 ? 1.014 ? ? 0.061 0.018 0 19 1 0.998 ? 5.700 50.000 ? ? ? ? ? 1017 ? 99.500 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 10.400 ? 1.004 ? ? 0.061 0.018 0 20 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 96.520 _refine.B_iso_mean 37.3500 _refine.B_iso_min 15.440 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5FDG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.100 _refine.ls_d_res_low 37.7640 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17465 _refine.ls_number_reflns_R_free 913 _refine.ls_number_reflns_R_work 16552 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.2400 _refine.ls_percent_reflns_R_free 5.2300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1918 _refine.ls_R_factor_R_free 0.2280 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1898 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ZQQ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.2000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8298 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.100 _refine_hist.d_res_low 37.7640 _refine_hist.pdbx_number_atoms_ligand 36 _refine_hist.number_atoms_solvent 99 _refine_hist.number_atoms_total 1628 _refine_hist.pdbx_number_residues_total 181 _refine_hist.pdbx_B_iso_mean_ligand 48.36 _refine_hist.pdbx_B_iso_mean_solvent 42.82 _refine_hist.pdbx_number_atoms_protein 1493 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1558 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.710 ? 2093 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.083 ? 219 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 265 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.351 ? 595 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1000 2.1971 2412 . 118 2294 99.0000 . . . 0.3219 . 0.2276 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.1971 2.3348 2431 . 146 2285 99.0000 . . . 0.2214 . 0.2070 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.3348 2.5150 2457 . 123 2334 99.0000 . . . 0.2755 . 0.2053 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.5150 2.7680 2474 . 127 2347 99.0000 . . . 0.2943 . 0.1954 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.7680 3.1684 2480 . 134 2346 99.0000 . . . 0.2233 . 0.1937 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.1684 3.9911 2533 . 116 2417 100.0000 . . . 0.2096 . 0.1770 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.9911 37.7704 2678 . 149 2529 99.0000 . . . 0.2077 . 0.1849 . . . . . . 7 . . . # _struct.entry_id 5FDG _struct.title 'Endonuclease inhibitor 3 bound to influenza strain H1N1 polymerase acidic subunit N-terminal region at pH 7.0' _struct.pdbx_model_details 'RNA binding protein' _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5FDG _struct_keywords.text 'Hydrolase-Hydrolase Inhibitor complex' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? PHE A 14 ? SER A 5 PHE A 14 1 ? 10 HELX_P HELX_P2 AA2 ASN A 15 ? TYR A 29 ? ASN A 15 TYR A 29 1 ? 15 HELX_P HELX_P3 AA3 GLU A 36 ? ALA A 56 ? GLU A 36 ALA A 56 1 ? 21 HELX_P HELX_P4 AA4 ASP A 68 ? GLY A 84 ? ASP A 68 GLY A 84 1 ? 17 HELX_P HELX_P5 AA5 GLU A 111 ? LYS A 124 ? GLU A 111 LYS A 124 1 ? 14 HELX_P HELX_P6 AA6 LYS A 143 ? ASP A 145 ? LYS A 143 ASP A 145 5 ? 3 HELX_P HELX_P7 AA7 ASP A 149 ? ARG A 170 ? ASP A 149 ARG A 170 1 ? 22 HELX_P HELX_P8 AA8 LEU A 172 ? SER A 179 ? LEU A 172 SER A 179 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 46 NE2 ? ? ? 1_555 C MN . MN ? ? A HIS 46 A MN 202 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc2 metalc ? ? A GLU 65 OE2 ? ? ? 1_555 D MN . MN ? ? A GLU 65 A MN 203 1_555 ? ? ? ? ? ? ? 2.018 ? ? metalc3 metalc ? ? A ASP 93 OD2 ? ? ? 1_555 C MN . MN ? ? A ASP 93 A MN 202 1_555 ? ? ? ? ? ? ? 2.148 ? ? metalc4 metalc ? ? A ASP 93 OD1 ? ? ? 1_555 D MN . MN ? ? A ASP 93 A MN 203 1_555 ? ? ? ? ? ? ? 2.152 ? ? metalc5 metalc ? ? A GLU 104 OE2 ? ? ? 1_555 C MN . MN ? ? A GLU 104 A MN 202 1_555 ? ? ? ? ? ? ? 2.041 ? ? metalc6 metalc ? ? A ILE 105 O ? ? ? 1_555 C MN . MN ? ? A ILE 105 A MN 202 1_555 ? ? ? ? ? ? ? 2.185 ? ? metalc7 metalc ? ? C MN . MN ? ? ? 1_555 E 0N8 . O28 ? ? A MN 202 A 0N8 204 1_555 ? ? ? ? ? ? ? 2.440 ? ? metalc8 metalc ? ? C MN . MN ? ? ? 1_555 E 0N8 . O25 ? ? A MN 202 A 0N8 204 1_555 ? ? ? ? ? ? ? 2.227 ? ? metalc9 metalc ? ? D MN . MN ? ? ? 1_555 E 0N8 . O27 ? ? A MN 203 A 0N8 204 1_555 ? ? ? ? ? ? ? 2.248 ? ? metalc10 metalc ? ? D MN . MN ? ? ? 1_555 E 0N8 . O28 ? ? A MN 203 A 0N8 204 1_555 ? ? ? ? ? ? ? 2.133 ? ? metalc11 metalc ? ? D MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 203 A HOH 331 1_555 ? ? ? ? ? ? ? 2.271 ? ? metalc12 metalc ? ? D MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 203 A HOH 346 1_555 ? ? ? ? ? ? ? 1.902 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 61 ? ILE A 63 ? PHE A 61 ILE A 63 AA1 2 LEU A 94 ? ASP A 96 ? LEU A 94 ASP A 96 AA1 3 ARG A 101 ? THR A 108 ? ARG A 101 THR A 108 AA1 4 HIS A 129 ? SER A 134 ? HIS A 129 SER A 134 AA1 5 GLU A 139 ? ALA A 141 ? GLU A 139 ALA A 141 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 62 ? N GLU A 62 O TYR A 95 ? O TYR A 95 AA1 2 3 N ASP A 96 ? N ASP A 96 O ARG A 101 ? O ARG A 101 AA1 3 4 N GLU A 104 ? N GLU A 104 O HIS A 131 ? O HIS A 131 AA1 4 5 N ILE A 132 ? N ILE A 132 O MET A 140 ? O MET A 140 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 201 ? 4 'binding site for residue SO4 A 201' AC2 Software A MN 202 ? 5 'binding site for residue MN A 202' AC3 Software A MN 203 ? 5 'binding site for residue MN A 203' AC4 Software A 0N8 204 ? 13 'binding site for residue 0N8 A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 164 ? ARG A 164 . ? 1_555 ? 2 AC1 4 TRP A 173 ? TRP A 173 . ? 1_555 ? 3 AC1 4 ARG A 177 ? ARG A 177 . ? 1_555 ? 4 AC1 4 HOH F . ? HOH A 357 . ? 1_555 ? 5 AC2 5 HIS A 46 ? HIS A 46 . ? 1_555 ? 6 AC2 5 ASP A 93 ? ASP A 93 . ? 1_555 ? 7 AC2 5 GLU A 104 ? GLU A 104 . ? 1_555 ? 8 AC2 5 ILE A 105 ? ILE A 105 . ? 1_555 ? 9 AC2 5 0N8 E . ? 0N8 A 204 . ? 1_555 ? 10 AC3 5 GLU A 65 ? GLU A 65 . ? 1_555 ? 11 AC3 5 ASP A 93 ? ASP A 93 . ? 1_555 ? 12 AC3 5 0N8 E . ? 0N8 A 204 . ? 1_555 ? 13 AC3 5 HOH F . ? HOH A 331 . ? 1_555 ? 14 AC3 5 HOH F . ? HOH A 346 . ? 1_555 ? 15 AC4 13 TYR A 29 ? TYR A 29 . ? 1_555 ? 16 AC4 13 HIS A 46 ? HIS A 46 . ? 1_555 ? 17 AC4 13 GLU A 65 ? GLU A 65 . ? 1_555 ? 18 AC4 13 LEU A 91 ? LEU A 91 . ? 1_555 ? 19 AC4 13 ASP A 93 ? ASP A 93 . ? 1_555 ? 20 AC4 13 GLU A 104 ? GLU A 104 . ? 1_555 ? 21 AC4 13 ILE A 105 ? ILE A 105 . ? 1_555 ? 22 AC4 13 LYS A 119 ? LYS A 119 . ? 1_555 ? 23 AC4 13 MN C . ? MN A 202 . ? 1_555 ? 24 AC4 13 MN D . ? MN A 203 . ? 1_555 ? 25 AC4 13 HOH F . ? HOH A 308 . ? 1_555 ? 26 AC4 13 HOH F . ? HOH A 345 . ? 1_555 ? 27 AC4 13 HOH F . ? HOH A 346 . ? 1_555 ? # _atom_sites.entry_id 5FDG _atom_sites.fract_transf_matrix[1][1] 0.015052 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015052 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007875 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 MET 167 167 167 MET MET A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 TRP 173 173 173 TRP TRP A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 GLY 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 ALA 184 184 ? ? ? A . n A 1 185 GLU 185 185 ? ? ? A . n A 1 186 LEU 186 186 ? ? ? A . n A 1 187 ALA 187 187 ? ? ? A . n A 1 188 LEU 188 188 ? ? ? A . n A 1 189 VAL 189 189 ? ? ? A . n A 1 190 PRO 190 190 ? ? ? A . n A 1 191 ARG 191 191 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 1 SO4 SO4 A . C 3 MN 1 202 1 MN MN A . D 3 MN 1 203 2 MN MN A . E 4 0N8 1 204 1 0N8 DRG A . F 5 HOH 1 301 46 HOH HOH A . F 5 HOH 2 302 95 HOH HOH A . F 5 HOH 3 303 39 HOH HOH A . F 5 HOH 4 304 45 HOH HOH A . F 5 HOH 5 305 21 HOH HOH A . F 5 HOH 6 306 82 HOH HOH A . F 5 HOH 7 307 41 HOH HOH A . F 5 HOH 8 308 59 HOH HOH A . F 5 HOH 9 309 61 HOH HOH A . F 5 HOH 10 310 24 HOH HOH A . F 5 HOH 11 311 25 HOH HOH A . F 5 HOH 12 312 2 HOH HOH A . F 5 HOH 13 313 7 HOH HOH A . F 5 HOH 14 314 37 HOH HOH A . F 5 HOH 15 315 30 HOH HOH A . F 5 HOH 16 316 40 HOH HOH A . F 5 HOH 17 317 9 HOH HOH A . F 5 HOH 18 318 64 HOH HOH A . F 5 HOH 19 319 38 HOH HOH A . F 5 HOH 20 320 49 HOH HOH A . F 5 HOH 21 321 15 HOH HOH A . F 5 HOH 22 322 70 HOH HOH A . F 5 HOH 23 323 18 HOH HOH A . F 5 HOH 24 324 77 HOH HOH A . F 5 HOH 25 325 75 HOH HOH A . F 5 HOH 26 326 20 HOH HOH A . F 5 HOH 27 327 1 HOH HOH A . F 5 HOH 28 328 51 HOH HOH A . F 5 HOH 29 329 29 HOH HOH A . F 5 HOH 30 330 23 HOH HOH A . F 5 HOH 31 331 42 HOH HOH A . F 5 HOH 32 332 44 HOH HOH A . F 5 HOH 33 333 73 HOH HOH A . F 5 HOH 34 334 35 HOH HOH A . F 5 HOH 35 335 19 HOH HOH A . F 5 HOH 36 336 8 HOH HOH A . F 5 HOH 37 337 66 HOH HOH A . F 5 HOH 38 338 78 HOH HOH A . F 5 HOH 39 339 36 HOH HOH A . F 5 HOH 40 340 14 HOH HOH A . F 5 HOH 41 341 10 HOH HOH A . F 5 HOH 42 342 6 HOH HOH A . F 5 HOH 43 343 22 HOH HOH A . F 5 HOH 44 344 16 HOH HOH A . F 5 HOH 45 345 13 HOH HOH A . F 5 HOH 46 346 99 HOH HOH A . F 5 HOH 47 347 43 HOH HOH A . F 5 HOH 48 348 76 HOH HOH A . F 5 HOH 49 349 52 HOH HOH A . F 5 HOH 50 350 11 HOH HOH A . F 5 HOH 51 351 96 HOH HOH A . F 5 HOH 52 352 83 HOH HOH A . F 5 HOH 53 353 17 HOH HOH A . F 5 HOH 54 354 32 HOH HOH A . F 5 HOH 55 355 12 HOH HOH A . F 5 HOH 56 356 47 HOH HOH A . F 5 HOH 57 357 65 HOH HOH A . F 5 HOH 58 358 26 HOH HOH A . F 5 HOH 59 359 4 HOH HOH A . F 5 HOH 60 360 34 HOH HOH A . F 5 HOH 61 361 55 HOH HOH A . F 5 HOH 62 362 5 HOH HOH A . F 5 HOH 63 363 84 HOH HOH A . F 5 HOH 64 364 71 HOH HOH A . F 5 HOH 65 365 28 HOH HOH A . F 5 HOH 66 366 27 HOH HOH A . F 5 HOH 67 367 79 HOH HOH A . F 5 HOH 68 368 62 HOH HOH A . F 5 HOH 69 369 3 HOH HOH A . F 5 HOH 70 370 89 HOH HOH A . F 5 HOH 71 371 90 HOH HOH A . F 5 HOH 72 372 69 HOH HOH A . F 5 HOH 73 373 72 HOH HOH A . F 5 HOH 74 374 81 HOH HOH A . F 5 HOH 75 375 97 HOH HOH A . F 5 HOH 76 376 87 HOH HOH A . F 5 HOH 77 377 93 HOH HOH A . F 5 HOH 78 378 50 HOH HOH A . F 5 HOH 79 379 58 HOH HOH A . F 5 HOH 80 380 80 HOH HOH A . F 5 HOH 81 381 91 HOH HOH A . F 5 HOH 82 382 74 HOH HOH A . F 5 HOH 83 383 48 HOH HOH A . F 5 HOH 84 384 54 HOH HOH A . F 5 HOH 85 385 88 HOH HOH A . F 5 HOH 86 386 33 HOH HOH A . F 5 HOH 87 387 60 HOH HOH A . F 5 HOH 88 388 68 HOH HOH A . F 5 HOH 89 389 67 HOH HOH A . F 5 HOH 90 390 85 HOH HOH A . F 5 HOH 91 391 31 HOH HOH A . F 5 HOH 92 392 98 HOH HOH A . F 5 HOH 93 393 86 HOH HOH A . F 5 HOH 94 394 94 HOH HOH A . F 5 HOH 95 395 92 HOH HOH A . F 5 HOH 96 396 57 HOH HOH A . F 5 HOH 97 397 53 HOH HOH A . F 5 HOH 98 398 56 HOH HOH A . F 5 HOH 99 399 63 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 190 ? 1 MORE -13 ? 1 'SSA (A^2)' 9630 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 102.7 ? 2 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 169.7 ? 3 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 83.5 ? 4 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? A ILE 105 ? A ILE 105 ? 1_555 84.7 ? 5 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? A ILE 105 ? A ILE 105 ? 1_555 91.7 ? 6 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? A ILE 105 ? A ILE 105 ? 1_555 87.1 ? 7 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O28 ? E 0N8 . ? A 0N8 204 ? 1_555 88.5 ? 8 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O28 ? E 0N8 . ? A 0N8 204 ? 1_555 104.0 ? 9 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O28 ? E 0N8 . ? A 0N8 204 ? 1_555 97.9 ? 10 O ? A ILE 105 ? A ILE 105 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O28 ? E 0N8 . ? A 0N8 204 ? 1_555 164.0 ? 11 NE2 ? A HIS 46 ? A HIS 46 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O25 ? E 0N8 . ? A 0N8 204 ? 1_555 80.4 ? 12 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O25 ? E 0N8 . ? A 0N8 204 ? 1_555 176.8 ? 13 OE2 ? A GLU 104 ? A GLU 104 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O25 ? E 0N8 . ? A 0N8 204 ? 1_555 93.5 ? 14 O ? A ILE 105 ? A ILE 105 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O25 ? E 0N8 . ? A 0N8 204 ? 1_555 89.6 ? 15 O28 ? E 0N8 . ? A 0N8 204 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O25 ? E 0N8 . ? A 0N8 204 ? 1_555 75.0 ? 16 OE2 ? A GLU 65 ? A GLU 65 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 86.0 ? 17 OE2 ? A GLU 65 ? A GLU 65 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O27 ? E 0N8 . ? A 0N8 204 ? 1_555 101.5 ? 18 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O27 ? E 0N8 . ? A 0N8 204 ? 1_555 169.0 ? 19 OE2 ? A GLU 65 ? A GLU 65 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O28 ? E 0N8 . ? A 0N8 204 ? 1_555 95.2 ? 20 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O28 ? E 0N8 . ? A 0N8 204 ? 1_555 95.7 ? 21 O27 ? E 0N8 . ? A 0N8 204 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O28 ? E 0N8 . ? A 0N8 204 ? 1_555 75.8 ? 22 OE2 ? A GLU 65 ? A GLU 65 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? F HOH . ? A HOH 331 ? 1_555 88.9 ? 23 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? F HOH . ? A HOH 331 ? 1_555 93.5 ? 24 O27 ? E 0N8 . ? A 0N8 204 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? F HOH . ? A HOH 331 ? 1_555 94.6 ? 25 O28 ? E 0N8 . ? A 0N8 204 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? F HOH . ? A HOH 331 ? 1_555 170.2 ? 26 OE2 ? A GLU 65 ? A GLU 65 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? F HOH . ? A HOH 346 ? 1_555 172.3 ? 27 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? F HOH . ? A HOH 346 ? 1_555 87.7 ? 28 O27 ? E 0N8 . ? A 0N8 204 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? F HOH . ? A HOH 346 ? 1_555 85.4 ? 29 O28 ? E 0N8 . ? A 0N8 204 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? F HOH . ? A HOH 346 ? 1_555 89.8 ? 30 O ? F HOH . ? A HOH 331 ? 1_555 MN ? D MN . ? A MN 203 ? 1_555 O ? F HOH . ? A HOH 346 ? 1_555 87.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-30 2 'Structure model' 1 1 2016-05-25 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' diffrn_source 3 3 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' diffrn_radiation_wavelength 8 4 'Structure model' pdbx_initial_refinement_model 9 4 'Structure model' pdbx_struct_conn_angle 10 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 20 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 22 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' # _pdbx_phasing_MR.entry_id 5FDG _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body 0.424 _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 'phenix.refine: 1.8.1_116' 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 6 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 164 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SO4 _pdbx_validate_close_contact.auth_seq_id_2 201 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 59 ? ? 76.29 -6.09 2 1 THR A 147 ? ? 66.48 -57.79 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 399 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.25 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 182 ? A GLY 182 2 1 Y 1 A ALA 183 ? A ALA 183 3 1 Y 1 A ALA 184 ? A ALA 184 4 1 Y 1 A GLU 185 ? A GLU 185 5 1 Y 1 A LEU 186 ? A LEU 186 6 1 Y 1 A ALA 187 ? A ALA 187 7 1 Y 1 A LEU 188 ? A LEU 188 8 1 Y 1 A VAL 189 ? A VAL 189 9 1 Y 1 A PRO 190 ? A PRO 190 10 1 Y 1 A ARG 191 ? A ARG 191 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 0N8 CL2 CL N N 1 0N8 C19 C Y N 2 0N8 C18 C Y N 3 0N8 C17 C Y N 4 0N8 C20 C Y N 5 0N8 C21 C Y N 6 0N8 C16 C Y N 7 0N8 C15 C N N 8 0N8 C11 C N N 9 0N8 C10 C N N 10 0N8 C9 C N N 11 0N8 C14 C N N 12 0N8 O27 O N N 13 0N8 C22 C N N 14 0N8 C23 C N N 15 0N8 O28 O N N 16 0N8 C24 C N N 17 0N8 O26 O N N 18 0N8 O25 O N N 19 0N8 C12 C N N 20 0N8 C13 C N N 21 0N8 N8 N N N 22 0N8 C7 C N N 23 0N8 C2 C Y N 24 0N8 C3 C Y N 25 0N8 C4 C Y N 26 0N8 C5 C Y N 27 0N8 C6 C Y N 28 0N8 C1 C Y N 29 0N8 H1 H N N 30 0N8 H2 H N N 31 0N8 H3 H N N 32 0N8 H4 H N N 33 0N8 H5 H N N 34 0N8 H6 H N N 35 0N8 H7 H N N 36 0N8 H8 H N N 37 0N8 H9 H N N 38 0N8 H10 H N N 39 0N8 H11 H N N 40 0N8 H14 H N N 41 0N8 H15 H N N 42 0N8 H16 H N N 43 0N8 H17 H N N 44 0N8 H18 H N N 45 0N8 H19 H N N 46 0N8 H21 H N N 47 0N8 H22 H N N 48 0N8 H23 H N N 49 0N8 H24 H N N 50 0N8 H25 H N N 51 0N8 H26 H N N 52 0N8 H27 H N N 53 ALA N N N N 54 ALA CA C N S 55 ALA C C N N 56 ALA O O N N 57 ALA CB C N N 58 ALA OXT O N N 59 ALA H H N N 60 ALA H2 H N N 61 ALA HA H N N 62 ALA HB1 H N N 63 ALA HB2 H N N 64 ALA HB3 H N N 65 ALA HXT H N N 66 ARG N N N N 67 ARG CA C N S 68 ARG C C N N 69 ARG O O N N 70 ARG CB C N N 71 ARG CG C N N 72 ARG CD C N N 73 ARG NE N N N 74 ARG CZ C N N 75 ARG NH1 N N N 76 ARG NH2 N N N 77 ARG OXT O N N 78 ARG H H N N 79 ARG H2 H N N 80 ARG HA H N N 81 ARG HB2 H N N 82 ARG HB3 H N N 83 ARG HG2 H N N 84 ARG HG3 H N N 85 ARG HD2 H N N 86 ARG HD3 H N N 87 ARG HE H N N 88 ARG HH11 H N N 89 ARG HH12 H N N 90 ARG HH21 H N N 91 ARG HH22 H N N 92 ARG HXT H N N 93 ASN N N N N 94 ASN CA C N S 95 ASN C C N N 96 ASN O O N N 97 ASN CB C N N 98 ASN CG C N N 99 ASN OD1 O N N 100 ASN ND2 N N N 101 ASN OXT O N N 102 ASN H H N N 103 ASN H2 H N N 104 ASN HA H N N 105 ASN HB2 H N N 106 ASN HB3 H N N 107 ASN HD21 H N N 108 ASN HD22 H N N 109 ASN HXT H N N 110 ASP N N N N 111 ASP CA C N S 112 ASP C C N N 113 ASP O O N N 114 ASP CB C N N 115 ASP CG C N N 116 ASP OD1 O N N 117 ASP OD2 O N N 118 ASP OXT O N N 119 ASP H H N N 120 ASP H2 H N N 121 ASP HA H N N 122 ASP HB2 H N N 123 ASP HB3 H N N 124 ASP HD2 H N N 125 ASP HXT H N N 126 CYS N N N N 127 CYS CA C N R 128 CYS C C N N 129 CYS O O N N 130 CYS CB C N N 131 CYS SG S N N 132 CYS OXT O N N 133 CYS H H N N 134 CYS H2 H N N 135 CYS HA H N N 136 CYS HB2 H N N 137 CYS HB3 H N N 138 CYS HG H N N 139 CYS HXT H N N 140 GLN N N N N 141 GLN CA C N S 142 GLN C C N N 143 GLN O O N N 144 GLN CB C N N 145 GLN CG C N N 146 GLN CD C N N 147 GLN OE1 O N N 148 GLN NE2 N N N 149 GLN OXT O N N 150 GLN H H N N 151 GLN H2 H N N 152 GLN HA H N N 153 GLN HB2 H N N 154 GLN HB3 H N N 155 GLN HG2 H N N 156 GLN HG3 H N N 157 GLN HE21 H N N 158 GLN HE22 H N N 159 GLN HXT H N N 160 GLU N N N N 161 GLU CA C N S 162 GLU C C N N 163 GLU O O N N 164 GLU CB C N N 165 GLU CG C N N 166 GLU CD C N N 167 GLU OE1 O N N 168 GLU OE2 O N N 169 GLU OXT O N N 170 GLU H H N N 171 GLU H2 H N N 172 GLU HA H N N 173 GLU HB2 H N N 174 GLU HB3 H N N 175 GLU HG2 H N N 176 GLU HG3 H N N 177 GLU HE2 H N N 178 GLU HXT H N N 179 GLY N N N N 180 GLY CA C N N 181 GLY C C N N 182 GLY O O N N 183 GLY OXT O N N 184 GLY H H N N 185 GLY H2 H N N 186 GLY HA2 H N N 187 GLY HA3 H N N 188 GLY HXT H N N 189 HIS N N N N 190 HIS CA C N S 191 HIS C C N N 192 HIS O O N N 193 HIS CB C N N 194 HIS CG C Y N 195 HIS ND1 N Y N 196 HIS CD2 C Y N 197 HIS CE1 C Y N 198 HIS NE2 N Y N 199 HIS OXT O N N 200 HIS H H N N 201 HIS H2 H N N 202 HIS HA H N N 203 HIS HB2 H N N 204 HIS HB3 H N N 205 HIS HD1 H N N 206 HIS HD2 H N N 207 HIS HE1 H N N 208 HIS HE2 H N N 209 HIS HXT H N N 210 HOH O O N N 211 HOH H1 H N N 212 HOH H2 H N N 213 ILE N N N N 214 ILE CA C N S 215 ILE C C N N 216 ILE O O N N 217 ILE CB C N S 218 ILE CG1 C N N 219 ILE CG2 C N N 220 ILE CD1 C N N 221 ILE OXT O N N 222 ILE H H N N 223 ILE H2 H N N 224 ILE HA H N N 225 ILE HB H N N 226 ILE HG12 H N N 227 ILE HG13 H N N 228 ILE HG21 H N N 229 ILE HG22 H N N 230 ILE HG23 H N N 231 ILE HD11 H N N 232 ILE HD12 H N N 233 ILE HD13 H N N 234 ILE HXT H N N 235 LEU N N N N 236 LEU CA C N S 237 LEU C C N N 238 LEU O O N N 239 LEU CB C N N 240 LEU CG C N N 241 LEU CD1 C N N 242 LEU CD2 C N N 243 LEU OXT O N N 244 LEU H H N N 245 LEU H2 H N N 246 LEU HA H N N 247 LEU HB2 H N N 248 LEU HB3 H N N 249 LEU HG H N N 250 LEU HD11 H N N 251 LEU HD12 H N N 252 LEU HD13 H N N 253 LEU HD21 H N N 254 LEU HD22 H N N 255 LEU HD23 H N N 256 LEU HXT H N N 257 LYS N N N N 258 LYS CA C N S 259 LYS C C N N 260 LYS O O N N 261 LYS CB C N N 262 LYS CG C N N 263 LYS CD C N N 264 LYS CE C N N 265 LYS NZ N N N 266 LYS OXT O N N 267 LYS H H N N 268 LYS H2 H N N 269 LYS HA H N N 270 LYS HB2 H N N 271 LYS HB3 H N N 272 LYS HG2 H N N 273 LYS HG3 H N N 274 LYS HD2 H N N 275 LYS HD3 H N N 276 LYS HE2 H N N 277 LYS HE3 H N N 278 LYS HZ1 H N N 279 LYS HZ2 H N N 280 LYS HZ3 H N N 281 LYS HXT H N N 282 MET N N N N 283 MET CA C N S 284 MET C C N N 285 MET O O N N 286 MET CB C N N 287 MET CG C N N 288 MET SD S N N 289 MET CE C N N 290 MET OXT O N N 291 MET H H N N 292 MET H2 H N N 293 MET HA H N N 294 MET HB2 H N N 295 MET HB3 H N N 296 MET HG2 H N N 297 MET HG3 H N N 298 MET HE1 H N N 299 MET HE2 H N N 300 MET HE3 H N N 301 MET HXT H N N 302 MN MN MN N N 303 PHE N N N N 304 PHE CA C N S 305 PHE C C N N 306 PHE O O N N 307 PHE CB C N N 308 PHE CG C Y N 309 PHE CD1 C Y N 310 PHE CD2 C Y N 311 PHE CE1 C Y N 312 PHE CE2 C Y N 313 PHE CZ C Y N 314 PHE OXT O N N 315 PHE H H N N 316 PHE H2 H N N 317 PHE HA H N N 318 PHE HB2 H N N 319 PHE HB3 H N N 320 PHE HD1 H N N 321 PHE HD2 H N N 322 PHE HE1 H N N 323 PHE HE2 H N N 324 PHE HZ H N N 325 PHE HXT H N N 326 PRO N N N N 327 PRO CA C N S 328 PRO C C N N 329 PRO O O N N 330 PRO CB C N N 331 PRO CG C N N 332 PRO CD C N N 333 PRO OXT O N N 334 PRO H H N N 335 PRO HA H N N 336 PRO HB2 H N N 337 PRO HB3 H N N 338 PRO HG2 H N N 339 PRO HG3 H N N 340 PRO HD2 H N N 341 PRO HD3 H N N 342 PRO HXT H N N 343 SER N N N N 344 SER CA C N S 345 SER C C N N 346 SER O O N N 347 SER CB C N N 348 SER OG O N N 349 SER OXT O N N 350 SER H H N N 351 SER H2 H N N 352 SER HA H N N 353 SER HB2 H N N 354 SER HB3 H N N 355 SER HG H N N 356 SER HXT H N N 357 SO4 S S N N 358 SO4 O1 O N N 359 SO4 O2 O N N 360 SO4 O3 O N N 361 SO4 O4 O N N 362 THR N N N N 363 THR CA C N S 364 THR C C N N 365 THR O O N N 366 THR CB C N R 367 THR OG1 O N N 368 THR CG2 C N N 369 THR OXT O N N 370 THR H H N N 371 THR H2 H N N 372 THR HA H N N 373 THR HB H N N 374 THR HG1 H N N 375 THR HG21 H N N 376 THR HG22 H N N 377 THR HG23 H N N 378 THR HXT H N N 379 TRP N N N N 380 TRP CA C N S 381 TRP C C N N 382 TRP O O N N 383 TRP CB C N N 384 TRP CG C Y N 385 TRP CD1 C Y N 386 TRP CD2 C Y N 387 TRP NE1 N Y N 388 TRP CE2 C Y N 389 TRP CE3 C Y N 390 TRP CZ2 C Y N 391 TRP CZ3 C Y N 392 TRP CH2 C Y N 393 TRP OXT O N N 394 TRP H H N N 395 TRP H2 H N N 396 TRP HA H N N 397 TRP HB2 H N N 398 TRP HB3 H N N 399 TRP HD1 H N N 400 TRP HE1 H N N 401 TRP HE3 H N N 402 TRP HZ2 H N N 403 TRP HZ3 H N N 404 TRP HH2 H N N 405 TRP HXT H N N 406 TYR N N N N 407 TYR CA C N S 408 TYR C C N N 409 TYR O O N N 410 TYR CB C N N 411 TYR CG C Y N 412 TYR CD1 C Y N 413 TYR CD2 C Y N 414 TYR CE1 C Y N 415 TYR CE2 C Y N 416 TYR CZ C Y N 417 TYR OH O N N 418 TYR OXT O N N 419 TYR H H N N 420 TYR H2 H N N 421 TYR HA H N N 422 TYR HB2 H N N 423 TYR HB3 H N N 424 TYR HD1 H N N 425 TYR HD2 H N N 426 TYR HE1 H N N 427 TYR HE2 H N N 428 TYR HH H N N 429 TYR HXT H N N 430 VAL N N N N 431 VAL CA C N S 432 VAL C C N N 433 VAL O O N N 434 VAL CB C N N 435 VAL CG1 C N N 436 VAL CG2 C N N 437 VAL OXT O N N 438 VAL H H N N 439 VAL H2 H N N 440 VAL HA H N N 441 VAL HB H N N 442 VAL HG11 H N N 443 VAL HG12 H N N 444 VAL HG13 H N N 445 VAL HG21 H N N 446 VAL HG22 H N N 447 VAL HG23 H N N 448 VAL HXT H N N 449 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 0N8 C6 C1 doub Y N 1 0N8 C6 C5 sing Y N 2 0N8 C1 C2 sing Y N 3 0N8 O27 C14 doub N N 4 0N8 C12 C13 sing N N 5 0N8 C12 C11 sing N N 6 0N8 C5 C4 doub Y N 7 0N8 C13 N8 sing N N 8 0N8 C2 C7 sing N N 9 0N8 C2 C3 doub Y N 10 0N8 O28 C23 sing N N 11 0N8 C7 N8 sing N N 12 0N8 C15 C11 sing N N 13 0N8 C15 C16 sing N N 14 0N8 C14 C11 sing N N 15 0N8 C14 C22 sing N N 16 0N8 C11 C10 sing N N 17 0N8 N8 C9 sing N N 18 0N8 C4 C3 sing Y N 19 0N8 C16 C21 doub Y N 20 0N8 C16 C17 sing Y N 21 0N8 C23 C22 doub N Z 22 0N8 C23 C24 sing N N 23 0N8 C21 C20 sing Y N 24 0N8 C17 C18 doub Y N 25 0N8 O25 C24 doub N N 26 0N8 C10 C9 sing N N 27 0N8 C24 O26 sing N N 28 0N8 C20 C19 doub Y N 29 0N8 C18 C19 sing Y N 30 0N8 C19 CL2 sing N N 31 0N8 C18 H1 sing N N 32 0N8 C17 H2 sing N N 33 0N8 C20 H3 sing N N 34 0N8 C21 H4 sing N N 35 0N8 C15 H5 sing N N 36 0N8 C15 H6 sing N N 37 0N8 C10 H7 sing N N 38 0N8 C10 H8 sing N N 39 0N8 C9 H9 sing N N 40 0N8 C9 H10 sing N N 41 0N8 C22 H11 sing N N 42 0N8 O28 H14 sing N N 43 0N8 O26 H15 sing N N 44 0N8 C12 H16 sing N N 45 0N8 C12 H17 sing N N 46 0N8 C13 H18 sing N N 47 0N8 C13 H19 sing N N 48 0N8 C7 H21 sing N N 49 0N8 C7 H22 sing N N 50 0N8 C3 H23 sing N N 51 0N8 C4 H24 sing N N 52 0N8 C5 H25 sing N N 53 0N8 C6 H26 sing N N 54 0N8 C1 H27 sing N N 55 ALA N CA sing N N 56 ALA N H sing N N 57 ALA N H2 sing N N 58 ALA CA C sing N N 59 ALA CA CB sing N N 60 ALA CA HA sing N N 61 ALA C O doub N N 62 ALA C OXT sing N N 63 ALA CB HB1 sing N N 64 ALA CB HB2 sing N N 65 ALA CB HB3 sing N N 66 ALA OXT HXT sing N N 67 ARG N CA sing N N 68 ARG N H sing N N 69 ARG N H2 sing N N 70 ARG CA C sing N N 71 ARG CA CB sing N N 72 ARG CA HA sing N N 73 ARG C O doub N N 74 ARG C OXT sing N N 75 ARG CB CG sing N N 76 ARG CB HB2 sing N N 77 ARG CB HB3 sing N N 78 ARG CG CD sing N N 79 ARG CG HG2 sing N N 80 ARG CG HG3 sing N N 81 ARG CD NE sing N N 82 ARG CD HD2 sing N N 83 ARG CD HD3 sing N N 84 ARG NE CZ sing N N 85 ARG NE HE sing N N 86 ARG CZ NH1 sing N N 87 ARG CZ NH2 doub N N 88 ARG NH1 HH11 sing N N 89 ARG NH1 HH12 sing N N 90 ARG NH2 HH21 sing N N 91 ARG NH2 HH22 sing N N 92 ARG OXT HXT sing N N 93 ASN N CA sing N N 94 ASN N H sing N N 95 ASN N H2 sing N N 96 ASN CA C sing N N 97 ASN CA CB sing N N 98 ASN CA HA sing N N 99 ASN C O doub N N 100 ASN C OXT sing N N 101 ASN CB CG sing N N 102 ASN CB HB2 sing N N 103 ASN CB HB3 sing N N 104 ASN CG OD1 doub N N 105 ASN CG ND2 sing N N 106 ASN ND2 HD21 sing N N 107 ASN ND2 HD22 sing N N 108 ASN OXT HXT sing N N 109 ASP N CA sing N N 110 ASP N H sing N N 111 ASP N H2 sing N N 112 ASP CA C sing N N 113 ASP CA CB sing N N 114 ASP CA HA sing N N 115 ASP C O doub N N 116 ASP C OXT sing N N 117 ASP CB CG sing N N 118 ASP CB HB2 sing N N 119 ASP CB HB3 sing N N 120 ASP CG OD1 doub N N 121 ASP CG OD2 sing N N 122 ASP OD2 HD2 sing N N 123 ASP OXT HXT sing N N 124 CYS N CA sing N N 125 CYS N H sing N N 126 CYS N H2 sing N N 127 CYS CA C sing N N 128 CYS CA CB sing N N 129 CYS CA HA sing N N 130 CYS C O doub N N 131 CYS C OXT sing N N 132 CYS CB SG sing N N 133 CYS CB HB2 sing N N 134 CYS CB HB3 sing N N 135 CYS SG HG sing N N 136 CYS OXT HXT sing N N 137 GLN N CA sing N N 138 GLN N H sing N N 139 GLN N H2 sing N N 140 GLN CA C sing N N 141 GLN CA CB sing N N 142 GLN CA HA sing N N 143 GLN C O doub N N 144 GLN C OXT sing N N 145 GLN CB CG sing N N 146 GLN CB HB2 sing N N 147 GLN CB HB3 sing N N 148 GLN CG CD sing N N 149 GLN CG HG2 sing N N 150 GLN CG HG3 sing N N 151 GLN CD OE1 doub N N 152 GLN CD NE2 sing N N 153 GLN NE2 HE21 sing N N 154 GLN NE2 HE22 sing N N 155 GLN OXT HXT sing N N 156 GLU N CA sing N N 157 GLU N H sing N N 158 GLU N H2 sing N N 159 GLU CA C sing N N 160 GLU CA CB sing N N 161 GLU CA HA sing N N 162 GLU C O doub N N 163 GLU C OXT sing N N 164 GLU CB CG sing N N 165 GLU CB HB2 sing N N 166 GLU CB HB3 sing N N 167 GLU CG CD sing N N 168 GLU CG HG2 sing N N 169 GLU CG HG3 sing N N 170 GLU CD OE1 doub N N 171 GLU CD OE2 sing N N 172 GLU OE2 HE2 sing N N 173 GLU OXT HXT sing N N 174 GLY N CA sing N N 175 GLY N H sing N N 176 GLY N H2 sing N N 177 GLY CA C sing N N 178 GLY CA HA2 sing N N 179 GLY CA HA3 sing N N 180 GLY C O doub N N 181 GLY C OXT sing N N 182 GLY OXT HXT sing N N 183 HIS N CA sing N N 184 HIS N H sing N N 185 HIS N H2 sing N N 186 HIS CA C sing N N 187 HIS CA CB sing N N 188 HIS CA HA sing N N 189 HIS C O doub N N 190 HIS C OXT sing N N 191 HIS CB CG sing N N 192 HIS CB HB2 sing N N 193 HIS CB HB3 sing N N 194 HIS CG ND1 sing Y N 195 HIS CG CD2 doub Y N 196 HIS ND1 CE1 doub Y N 197 HIS ND1 HD1 sing N N 198 HIS CD2 NE2 sing Y N 199 HIS CD2 HD2 sing N N 200 HIS CE1 NE2 sing Y N 201 HIS CE1 HE1 sing N N 202 HIS NE2 HE2 sing N N 203 HIS OXT HXT sing N N 204 HOH O H1 sing N N 205 HOH O H2 sing N N 206 ILE N CA sing N N 207 ILE N H sing N N 208 ILE N H2 sing N N 209 ILE CA C sing N N 210 ILE CA CB sing N N 211 ILE CA HA sing N N 212 ILE C O doub N N 213 ILE C OXT sing N N 214 ILE CB CG1 sing N N 215 ILE CB CG2 sing N N 216 ILE CB HB sing N N 217 ILE CG1 CD1 sing N N 218 ILE CG1 HG12 sing N N 219 ILE CG1 HG13 sing N N 220 ILE CG2 HG21 sing N N 221 ILE CG2 HG22 sing N N 222 ILE CG2 HG23 sing N N 223 ILE CD1 HD11 sing N N 224 ILE CD1 HD12 sing N N 225 ILE CD1 HD13 sing N N 226 ILE OXT HXT sing N N 227 LEU N CA sing N N 228 LEU N H sing N N 229 LEU N H2 sing N N 230 LEU CA C sing N N 231 LEU CA CB sing N N 232 LEU CA HA sing N N 233 LEU C O doub N N 234 LEU C OXT sing N N 235 LEU CB CG sing N N 236 LEU CB HB2 sing N N 237 LEU CB HB3 sing N N 238 LEU CG CD1 sing N N 239 LEU CG CD2 sing N N 240 LEU CG HG sing N N 241 LEU CD1 HD11 sing N N 242 LEU CD1 HD12 sing N N 243 LEU CD1 HD13 sing N N 244 LEU CD2 HD21 sing N N 245 LEU CD2 HD22 sing N N 246 LEU CD2 HD23 sing N N 247 LEU OXT HXT sing N N 248 LYS N CA sing N N 249 LYS N H sing N N 250 LYS N H2 sing N N 251 LYS CA C sing N N 252 LYS CA CB sing N N 253 LYS CA HA sing N N 254 LYS C O doub N N 255 LYS C OXT sing N N 256 LYS CB CG sing N N 257 LYS CB HB2 sing N N 258 LYS CB HB3 sing N N 259 LYS CG CD sing N N 260 LYS CG HG2 sing N N 261 LYS CG HG3 sing N N 262 LYS CD CE sing N N 263 LYS CD HD2 sing N N 264 LYS CD HD3 sing N N 265 LYS CE NZ sing N N 266 LYS CE HE2 sing N N 267 LYS CE HE3 sing N N 268 LYS NZ HZ1 sing N N 269 LYS NZ HZ2 sing N N 270 LYS NZ HZ3 sing N N 271 LYS OXT HXT sing N N 272 MET N CA sing N N 273 MET N H sing N N 274 MET N H2 sing N N 275 MET CA C sing N N 276 MET CA CB sing N N 277 MET CA HA sing N N 278 MET C O doub N N 279 MET C OXT sing N N 280 MET CB CG sing N N 281 MET CB HB2 sing N N 282 MET CB HB3 sing N N 283 MET CG SD sing N N 284 MET CG HG2 sing N N 285 MET CG HG3 sing N N 286 MET SD CE sing N N 287 MET CE HE1 sing N N 288 MET CE HE2 sing N N 289 MET CE HE3 sing N N 290 MET OXT HXT sing N N 291 PHE N CA sing N N 292 PHE N H sing N N 293 PHE N H2 sing N N 294 PHE CA C sing N N 295 PHE CA CB sing N N 296 PHE CA HA sing N N 297 PHE C O doub N N 298 PHE C OXT sing N N 299 PHE CB CG sing N N 300 PHE CB HB2 sing N N 301 PHE CB HB3 sing N N 302 PHE CG CD1 doub Y N 303 PHE CG CD2 sing Y N 304 PHE CD1 CE1 sing Y N 305 PHE CD1 HD1 sing N N 306 PHE CD2 CE2 doub Y N 307 PHE CD2 HD2 sing N N 308 PHE CE1 CZ doub Y N 309 PHE CE1 HE1 sing N N 310 PHE CE2 CZ sing Y N 311 PHE CE2 HE2 sing N N 312 PHE CZ HZ sing N N 313 PHE OXT HXT sing N N 314 PRO N CA sing N N 315 PRO N CD sing N N 316 PRO N H sing N N 317 PRO CA C sing N N 318 PRO CA CB sing N N 319 PRO CA HA sing N N 320 PRO C O doub N N 321 PRO C OXT sing N N 322 PRO CB CG sing N N 323 PRO CB HB2 sing N N 324 PRO CB HB3 sing N N 325 PRO CG CD sing N N 326 PRO CG HG2 sing N N 327 PRO CG HG3 sing N N 328 PRO CD HD2 sing N N 329 PRO CD HD3 sing N N 330 PRO OXT HXT sing N N 331 SER N CA sing N N 332 SER N H sing N N 333 SER N H2 sing N N 334 SER CA C sing N N 335 SER CA CB sing N N 336 SER CA HA sing N N 337 SER C O doub N N 338 SER C OXT sing N N 339 SER CB OG sing N N 340 SER CB HB2 sing N N 341 SER CB HB3 sing N N 342 SER OG HG sing N N 343 SER OXT HXT sing N N 344 SO4 S O1 doub N N 345 SO4 S O2 doub N N 346 SO4 S O3 sing N N 347 SO4 S O4 sing N N 348 THR N CA sing N N 349 THR N H sing N N 350 THR N H2 sing N N 351 THR CA C sing N N 352 THR CA CB sing N N 353 THR CA HA sing N N 354 THR C O doub N N 355 THR C OXT sing N N 356 THR CB OG1 sing N N 357 THR CB CG2 sing N N 358 THR CB HB sing N N 359 THR OG1 HG1 sing N N 360 THR CG2 HG21 sing N N 361 THR CG2 HG22 sing N N 362 THR CG2 HG23 sing N N 363 THR OXT HXT sing N N 364 TRP N CA sing N N 365 TRP N H sing N N 366 TRP N H2 sing N N 367 TRP CA C sing N N 368 TRP CA CB sing N N 369 TRP CA HA sing N N 370 TRP C O doub N N 371 TRP C OXT sing N N 372 TRP CB CG sing N N 373 TRP CB HB2 sing N N 374 TRP CB HB3 sing N N 375 TRP CG CD1 doub Y N 376 TRP CG CD2 sing Y N 377 TRP CD1 NE1 sing Y N 378 TRP CD1 HD1 sing N N 379 TRP CD2 CE2 doub Y N 380 TRP CD2 CE3 sing Y N 381 TRP NE1 CE2 sing Y N 382 TRP NE1 HE1 sing N N 383 TRP CE2 CZ2 sing Y N 384 TRP CE3 CZ3 doub Y N 385 TRP CE3 HE3 sing N N 386 TRP CZ2 CH2 doub Y N 387 TRP CZ2 HZ2 sing N N 388 TRP CZ3 CH2 sing Y N 389 TRP CZ3 HZ3 sing N N 390 TRP CH2 HH2 sing N N 391 TRP OXT HXT sing N N 392 TYR N CA sing N N 393 TYR N H sing N N 394 TYR N H2 sing N N 395 TYR CA C sing N N 396 TYR CA CB sing N N 397 TYR CA HA sing N N 398 TYR C O doub N N 399 TYR C OXT sing N N 400 TYR CB CG sing N N 401 TYR CB HB2 sing N N 402 TYR CB HB3 sing N N 403 TYR CG CD1 doub Y N 404 TYR CG CD2 sing Y N 405 TYR CD1 CE1 sing Y N 406 TYR CD1 HD1 sing N N 407 TYR CD2 CE2 doub Y N 408 TYR CD2 HD2 sing N N 409 TYR CE1 CZ doub Y N 410 TYR CE1 HE1 sing N N 411 TYR CE2 CZ sing Y N 412 TYR CE2 HE2 sing N N 413 TYR CZ OH sing N N 414 TYR OH HH sing N N 415 TYR OXT HXT sing N N 416 VAL N CA sing N N 417 VAL N H sing N N 418 VAL N H2 sing N N 419 VAL CA C sing N N 420 VAL CA CB sing N N 421 VAL CA HA sing N N 422 VAL C O doub N N 423 VAL C OXT sing N N 424 VAL CB CG1 sing N N 425 VAL CB CG2 sing N N 426 VAL CB HB sing N N 427 VAL CG1 HG11 sing N N 428 VAL CG1 HG12 sing N N 429 VAL CG1 HG13 sing N N 430 VAL CG2 HG21 sing N N 431 VAL CG2 HG22 sing N N 432 VAL CG2 HG23 sing N N 433 VAL OXT HXT sing N N 434 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'MANGANESE (II) ION' MN 4 '(2Z)-4-[1-benzyl-4-(4-chlorobenzyl)piperidin-4-yl]-2-hydroxy-4-oxobut-2-enoic acid' 0N8 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4ZQQ _pdbx_initial_refinement_model.details ? #