data_5FEE # _entry.id 5FEE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5FEE WWPDB D_1000216446 # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Wild-type version of EGFR kinase domain complexed with the same inhibitor.' _pdbx_database_related.db_id 5FED _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5FEE _pdbx_database_status.recvd_initial_deposition_date 2015-12-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'DiDonato, M.' 1 'Spraggon, G.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 59 _citation.language ? _citation.page_first 6671 _citation.page_last 6689 _citation.title ;Discovery of (R,E)-N-(7-Chloro-1-(1-[4-(dimethylamino)but-2-enoyl]azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (EGF816), a Novel, Potent, and WT Sparing Covalent Inhibitor of Oncogenic (L858R, ex19del) and Resistant (T790M) EGFR Mutants for the Treatment of EGFR Mutant Non-Small-Cell Lung Cancers. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.5b01985 _citation.pdbx_database_id_PubMed 27433829 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lelais, G.' 1 primary 'Epple, R.' 2 primary 'Marsilje, T.H.' 3 primary 'Long, Y.O.' 4 primary 'McNeill, M.' 5 primary 'Chen, B.' 6 primary 'Lu, W.' 7 primary 'Anumolu, J.' 8 primary 'Badiger, S.' 9 primary 'Bursulaya, B.' 10 primary 'DiDonato, M.' 11 primary 'Fong, R.' 12 primary 'Juarez, J.' 13 primary 'Li, J.' 14 primary 'Manuia, M.' 15 primary 'Mason, D.E.' 16 primary 'Gordon, P.' 17 primary 'Groessl, T.' 18 primary 'Johnson, K.' 19 primary 'Jia, Y.' 20 primary 'Kasibhatla, S.' 21 primary 'Li, C.' 22 primary 'Isbell, J.' 23 primary 'Spraggon, G.' 24 primary 'Bender, S.' 25 primary 'Michellys, P.Y.' 26 # _cell.entry_id 5FEE _cell.length_a 145.097 _cell.length_b 145.097 _cell.length_c 145.097 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FEE _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 37391.277 1 2.7.10.1 T790M ? 'Inhibitor is covalently linked to Cys797.' 2 non-polymer syn '~{N}-[7-methyl-1-[(3~{R})-1-propanoylazepan-3-yl]benzimidazol-2-yl]-3-(trifluoromethyl)benzamide' 472.503 1 ? ? ? ? 3 water nat water 18.015 11 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1,Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQQG ; _entity_poly.pdbx_seq_one_letter_code_can ;GGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 GLU n 1 4 ALA n 1 5 PRO n 1 6 ASN n 1 7 GLN n 1 8 ALA n 1 9 LEU n 1 10 LEU n 1 11 ARG n 1 12 ILE n 1 13 LEU n 1 14 LYS n 1 15 GLU n 1 16 THR n 1 17 GLU n 1 18 PHE n 1 19 LYS n 1 20 LYS n 1 21 ILE n 1 22 LYS n 1 23 VAL n 1 24 LEU n 1 25 GLY n 1 26 SER n 1 27 GLY n 1 28 ALA n 1 29 PHE n 1 30 GLY n 1 31 THR n 1 32 VAL n 1 33 TYR n 1 34 LYS n 1 35 GLY n 1 36 LEU n 1 37 TRP n 1 38 ILE n 1 39 PRO n 1 40 GLU n 1 41 GLY n 1 42 GLU n 1 43 LYS n 1 44 VAL n 1 45 LYS n 1 46 ILE n 1 47 PRO n 1 48 VAL n 1 49 ALA n 1 50 ILE n 1 51 LYS n 1 52 GLU n 1 53 LEU n 1 54 ARG n 1 55 GLU n 1 56 ALA n 1 57 THR n 1 58 SER n 1 59 PRO n 1 60 LYS n 1 61 ALA n 1 62 ASN n 1 63 LYS n 1 64 GLU n 1 65 ILE n 1 66 LEU n 1 67 ASP n 1 68 GLU n 1 69 ALA n 1 70 TYR n 1 71 VAL n 1 72 MET n 1 73 ALA n 1 74 SER n 1 75 VAL n 1 76 ASP n 1 77 ASN n 1 78 PRO n 1 79 HIS n 1 80 VAL n 1 81 CYS n 1 82 ARG n 1 83 LEU n 1 84 LEU n 1 85 GLY n 1 86 ILE n 1 87 CYS n 1 88 LEU n 1 89 THR n 1 90 SER n 1 91 THR n 1 92 VAL n 1 93 GLN n 1 94 LEU n 1 95 ILE n 1 96 MET n 1 97 GLN n 1 98 LEU n 1 99 MET n 1 100 PRO n 1 101 PHE n 1 102 GLY n 1 103 CYS n 1 104 LEU n 1 105 LEU n 1 106 ASP n 1 107 TYR n 1 108 VAL n 1 109 ARG n 1 110 GLU n 1 111 HIS n 1 112 LYS n 1 113 ASP n 1 114 ASN n 1 115 ILE n 1 116 GLY n 1 117 SER n 1 118 GLN n 1 119 TYR n 1 120 LEU n 1 121 LEU n 1 122 ASN n 1 123 TRP n 1 124 CYS n 1 125 VAL n 1 126 GLN n 1 127 ILE n 1 128 ALA n 1 129 LYS n 1 130 GLY n 1 131 MET n 1 132 ASN n 1 133 TYR n 1 134 LEU n 1 135 GLU n 1 136 ASP n 1 137 ARG n 1 138 ARG n 1 139 LEU n 1 140 VAL n 1 141 HIS n 1 142 ARG n 1 143 ASP n 1 144 LEU n 1 145 ALA n 1 146 ALA n 1 147 ARG n 1 148 ASN n 1 149 VAL n 1 150 LEU n 1 151 VAL n 1 152 LYS n 1 153 THR n 1 154 PRO n 1 155 GLN n 1 156 HIS n 1 157 VAL n 1 158 LYS n 1 159 ILE n 1 160 THR n 1 161 ASP n 1 162 PHE n 1 163 GLY n 1 164 LEU n 1 165 ALA n 1 166 LYS n 1 167 LEU n 1 168 LEU n 1 169 GLY n 1 170 ALA n 1 171 GLU n 1 172 GLU n 1 173 LYS n 1 174 GLU n 1 175 TYR n 1 176 HIS n 1 177 ALA n 1 178 GLU n 1 179 GLY n 1 180 GLY n 1 181 LYS n 1 182 VAL n 1 183 PRO n 1 184 ILE n 1 185 LYS n 1 186 TRP n 1 187 MET n 1 188 ALA n 1 189 LEU n 1 190 GLU n 1 191 SER n 1 192 ILE n 1 193 LEU n 1 194 HIS n 1 195 ARG n 1 196 ILE n 1 197 TYR n 1 198 THR n 1 199 HIS n 1 200 GLN n 1 201 SER n 1 202 ASP n 1 203 VAL n 1 204 TRP n 1 205 SER n 1 206 TYR n 1 207 GLY n 1 208 VAL n 1 209 THR n 1 210 VAL n 1 211 TRP n 1 212 GLU n 1 213 LEU n 1 214 MET n 1 215 THR n 1 216 PHE n 1 217 GLY n 1 218 SER n 1 219 LYS n 1 220 PRO n 1 221 TYR n 1 222 ASP n 1 223 GLY n 1 224 ILE n 1 225 PRO n 1 226 ALA n 1 227 SER n 1 228 GLU n 1 229 ILE n 1 230 SER n 1 231 SER n 1 232 ILE n 1 233 LEU n 1 234 GLU n 1 235 LYS n 1 236 GLY n 1 237 GLU n 1 238 ARG n 1 239 LEU n 1 240 PRO n 1 241 GLN n 1 242 PRO n 1 243 PRO n 1 244 ILE n 1 245 CYS n 1 246 THR n 1 247 ILE n 1 248 ASP n 1 249 VAL n 1 250 TYR n 1 251 MET n 1 252 ILE n 1 253 MET n 1 254 VAL n 1 255 LYS n 1 256 CYS n 1 257 TRP n 1 258 MET n 1 259 ILE n 1 260 ASP n 1 261 ALA n 1 262 ASP n 1 263 SER n 1 264 ARG n 1 265 PRO n 1 266 LYS n 1 267 PHE n 1 268 ARG n 1 269 GLU n 1 270 LEU n 1 271 ILE n 1 272 ILE n 1 273 GLU n 1 274 PHE n 1 275 SER n 1 276 LYS n 1 277 MET n 1 278 ALA n 1 279 ARG n 1 280 ASP n 1 281 PRO n 1 282 GLN n 1 283 ARG n 1 284 TYR n 1 285 LEU n 1 286 VAL n 1 287 ILE n 1 288 GLN n 1 289 GLY n 1 290 ASP n 1 291 GLU n 1 292 ARG n 1 293 MET n 1 294 HIS n 1 295 LEU n 1 296 PRO n 1 297 SER n 1 298 PRO n 1 299 THR n 1 300 ASP n 1 301 SER n 1 302 ASN n 1 303 PHE n 1 304 TYR n 1 305 ARG n 1 306 ALA n 1 307 LEU n 1 308 MET n 1 309 ASP n 1 310 GLU n 1 311 GLU n 1 312 ASP n 1 313 MET n 1 314 ASP n 1 315 ASP n 1 316 VAL n 1 317 VAL n 1 318 ASP n 1 319 ALA n 1 320 ASP n 1 321 GLU n 1 322 TYR n 1 323 LEU n 1 324 ILE n 1 325 PRO n 1 326 GLN n 1 327 GLN n 1 328 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 328 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Sf9 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pFastBacHTc _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE YLIPQQG ; _struct_ref.pdbx_align_begin 696 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5FEE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 328 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 696 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 696 _struct_ref_seq.pdbx_auth_seq_align_end 1022 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FEE GLY A 1 ? UNP P00533 ? ? 'expression tag' 695 1 1 5FEE MET A 96 ? UNP P00533 THR 790 'engineered mutation' 790 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 5X4 non-polymer . '~{N}-[7-methyl-1-[(3~{R})-1-propanoylazepan-3-yl]benzimidazol-2-yl]-3-(trifluoromethyl)benzamide' ? 'C25 H27 F3 N4 O2' 472.503 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5FEE _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.41 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64 _exptl_crystal.description 'Hexagonal crystals in 1-2 weeks.' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.2M potassium sodium tartrate, 0.1M HEPES pH 7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-05-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Single crystal, cylindrically bent, Si(220)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97648 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97648 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.3 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 76 _reflns.entry_id 5FEE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 80 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14118 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.1 _reflns.pdbx_Rmerge_I_obs 0.077 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.8 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.19 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.787 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5FEE _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 14113 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 59.236 _refine.ls_d_res_high 2.700 _refine.ls_percent_reflns_obs 99.92 _refine.ls_R_factor_obs 0.1923 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1881 _refine.ls_R_factor_R_free 0.2293 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.97 _refine.ls_number_reflns_R_free 1407 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 2JIT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.39 _refine.pdbx_overall_phase_error 25.67 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2308 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 2353 _refine_hist.d_res_high 2.700 _refine_hist.d_res_low 59.236 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.015 ? ? 2393 'X-RAY DIFFRACTION' ? f_angle_d 1.443 ? ? 3238 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 18.820 ? ? 1451 'X-RAY DIFFRACTION' ? f_chiral_restr 0.072 ? ? 361 'X-RAY DIFFRACTION' ? f_plane_restr 0.008 ? ? 401 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.7000 2.7965 1265 0.2745 100.00 0.3555 . . 137 . . 'X-RAY DIFFRACTION' . 2.7965 2.9084 1243 0.2279 100.00 0.3461 . . 130 . . 'X-RAY DIFFRACTION' . 2.9084 3.0408 1250 0.2267 100.00 0.2859 . . 152 . . 'X-RAY DIFFRACTION' . 3.0408 3.2011 1262 0.2380 100.00 0.3006 . . 128 . . 'X-RAY DIFFRACTION' . 3.2011 3.4016 1270 0.2289 100.00 0.2882 . . 138 . . 'X-RAY DIFFRACTION' . 3.4016 3.6643 1260 0.1988 100.00 0.2554 . . 151 . . 'X-RAY DIFFRACTION' . 3.6643 4.0329 1279 0.1676 100.00 0.1974 . . 127 . . 'X-RAY DIFFRACTION' . 4.0329 4.6163 1265 0.1479 100.00 0.1893 . . 147 . . 'X-RAY DIFFRACTION' . 4.6163 5.8153 1276 0.1672 100.00 0.1977 . . 154 . . 'X-RAY DIFFRACTION' . 5.8153 59.2498 1336 0.1912 100.00 0.2148 . . 143 . . # _struct.entry_id 5FEE _struct.title 'EGFR kinase domain T790M mutant in complex with a covalent aminobenzimidazole inhibitor.' _struct.pdbx_descriptor 'Epidermal growth factor receptor (E.C.2.7.10.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5FEE _struct_keywords.text 'Kinase, Inhibitor, Covalently bound, T790M, TRANSFERASE-TRANSFERASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 14 ? THR A 16 ? LYS A 708 THR A 710 5 ? 3 HELX_P HELX_P2 AA2 PRO A 59 ? SER A 74 ? PRO A 753 SER A 768 1 ? 16 HELX_P HELX_P3 AA3 CYS A 103 ? LYS A 112 ? CYS A 797 LYS A 806 1 ? 10 HELX_P HELX_P4 AA4 ASP A 113 ? ILE A 115 ? ASP A 807 ILE A 809 5 ? 3 HELX_P HELX_P5 AA5 GLY A 116 ? ARG A 137 ? GLY A 810 ARG A 831 1 ? 22 HELX_P HELX_P6 AA6 ALA A 145 ? ARG A 147 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P7 AA7 ALA A 188 ? ARG A 195 ? ALA A 882 ARG A 889 1 ? 8 HELX_P HELX_P8 AA8 THR A 198 ? THR A 215 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P9 AA9 PRO A 225 ? LYS A 235 ? PRO A 919 LYS A 929 1 ? 11 HELX_P HELX_P10 AB1 THR A 246 ? CYS A 256 ? THR A 940 CYS A 950 1 ? 11 HELX_P HELX_P11 AB2 ASP A 260 ? ARG A 264 ? ASP A 954 ARG A 958 5 ? 5 HELX_P HELX_P12 AB3 LYS A 266 ? ARG A 279 ? LYS A 960 ARG A 973 1 ? 14 HELX_P HELX_P13 AB4 ASP A 280 ? TYR A 284 ? ASP A 974 TYR A 978 5 ? 5 HELX_P HELX_P14 AB5 ASP A 318 ? TYR A 322 ? ASP A 1012 TYR A 1016 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 103 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id 5X4 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C32 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 797 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 5X4 _struct_conn.ptnr2_auth_seq_id 1101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.835 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 18 ? GLY A 25 ? PHE A 712 GLY A 719 AA1 2 VAL A 32 ? TRP A 37 ? VAL A 726 TRP A 731 AA1 3 ILE A 46 ? LYS A 51 ? ILE A 740 LYS A 745 AA1 4 GLN A 93 ? GLN A 97 ? GLN A 787 GLN A 791 AA1 5 LEU A 83 ? CYS A 87 ? LEU A 777 CYS A 781 AA2 1 LEU A 139 ? VAL A 140 ? LEU A 833 VAL A 834 AA2 2 LYS A 166 ? LEU A 167 ? LYS A 860 LEU A 861 AA3 1 VAL A 149 ? THR A 153 ? VAL A 843 THR A 847 AA3 2 HIS A 156 ? ILE A 159 ? HIS A 850 ILE A 853 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 24 ? N LEU A 718 O VAL A 32 ? O VAL A 726 AA1 2 3 N TRP A 37 ? N TRP A 731 O ILE A 46 ? O ILE A 740 AA1 3 4 N ALA A 49 ? N ALA A 743 O MET A 96 ? O MET A 790 AA1 4 5 O ILE A 95 ? O ILE A 789 N GLY A 85 ? N GLY A 779 AA2 1 2 N VAL A 140 ? N VAL A 834 O LYS A 166 ? O LYS A 860 AA3 1 2 N LEU A 150 ? N LEU A 844 O LYS A 158 ? O LYS A 852 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 5X4 _struct_site.pdbx_auth_seq_id 1101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'binding site for residue 5X4 A 1101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 VAL A 32 ? VAL A 726 . ? 1_555 ? 2 AC1 11 ALA A 49 ? ALA A 743 . ? 1_555 ? 3 AC1 11 LYS A 51 ? LYS A 745 . ? 1_555 ? 4 AC1 11 CYS A 81 ? CYS A 775 . ? 1_555 ? 5 AC1 11 MET A 96 ? MET A 790 . ? 1_555 ? 6 AC1 11 GLN A 97 ? GLN A 791 . ? 1_555 ? 7 AC1 11 MET A 99 ? MET A 793 . ? 1_555 ? 8 AC1 11 PRO A 100 ? PRO A 794 . ? 1_555 ? 9 AC1 11 CYS A 103 ? CYS A 797 . ? 1_555 ? 10 AC1 11 ASP A 106 ? ASP A 800 . ? 1_555 ? 11 AC1 11 THR A 160 ? THR A 854 . ? 1_555 ? # _atom_sites.entry_id 5FEE _atom_sites.fract_transf_matrix[1][1] 0.006892 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006892 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006892 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 695 ? ? ? A . n A 1 2 GLY 2 696 ? ? ? A . n A 1 3 GLU 3 697 697 GLU GLU A . n A 1 4 ALA 4 698 698 ALA ALA A . n A 1 5 PRO 5 699 699 PRO PRO A . n A 1 6 ASN 6 700 700 ASN ASN A . n A 1 7 GLN 7 701 701 GLN GLN A . n A 1 8 ALA 8 702 702 ALA ALA A . n A 1 9 LEU 9 703 703 LEU LEU A . n A 1 10 LEU 10 704 704 LEU LEU A . n A 1 11 ARG 11 705 705 ARG ARG A . n A 1 12 ILE 12 706 706 ILE ILE A . n A 1 13 LEU 13 707 707 LEU LEU A . n A 1 14 LYS 14 708 708 LYS LYS A . n A 1 15 GLU 15 709 709 GLU GLU A . n A 1 16 THR 16 710 710 THR THR A . n A 1 17 GLU 17 711 711 GLU GLU A . n A 1 18 PHE 18 712 712 PHE PHE A . n A 1 19 LYS 19 713 713 LYS LYS A . n A 1 20 LYS 20 714 714 LYS LYS A . n A 1 21 ILE 21 715 715 ILE ILE A . n A 1 22 LYS 22 716 716 LYS LYS A . n A 1 23 VAL 23 717 717 VAL VAL A . n A 1 24 LEU 24 718 718 LEU LEU A . n A 1 25 GLY 25 719 719 GLY GLY A . n A 1 26 SER 26 720 720 SER SER A . n A 1 27 GLY 27 721 ? ? ? A . n A 1 28 ALA 28 722 ? ? ? A . n A 1 29 PHE 29 723 ? ? ? A . n A 1 30 GLY 30 724 ? ? ? A . n A 1 31 THR 31 725 725 THR THR A . n A 1 32 VAL 32 726 726 VAL VAL A . n A 1 33 TYR 33 727 727 TYR TYR A . n A 1 34 LYS 34 728 728 LYS LYS A . n A 1 35 GLY 35 729 729 GLY GLY A . n A 1 36 LEU 36 730 730 LEU LEU A . n A 1 37 TRP 37 731 731 TRP TRP A . n A 1 38 ILE 38 732 732 ILE ILE A . n A 1 39 PRO 39 733 733 PRO PRO A . n A 1 40 GLU 40 734 734 GLU GLU A . n A 1 41 GLY 41 735 735 GLY GLY A . n A 1 42 GLU 42 736 736 GLU GLU A . n A 1 43 LYS 43 737 737 LYS LYS A . n A 1 44 VAL 44 738 738 VAL VAL A . n A 1 45 LYS 45 739 739 LYS LYS A . n A 1 46 ILE 46 740 740 ILE ILE A . n A 1 47 PRO 47 741 741 PRO PRO A . n A 1 48 VAL 48 742 742 VAL VAL A . n A 1 49 ALA 49 743 743 ALA ALA A . n A 1 50 ILE 50 744 744 ILE ILE A . n A 1 51 LYS 51 745 745 LYS LYS A . n A 1 52 GLU 52 746 746 GLU GLU A . n A 1 53 LEU 53 747 ? ? ? A . n A 1 54 ARG 54 748 ? ? ? A . n A 1 55 GLU 55 749 ? ? ? A . n A 1 56 ALA 56 750 ? ? ? A . n A 1 57 THR 57 751 ? ? ? A . n A 1 58 SER 58 752 752 SER SER A . n A 1 59 PRO 59 753 753 PRO PRO A . n A 1 60 LYS 60 754 754 LYS LYS A . n A 1 61 ALA 61 755 755 ALA ALA A . n A 1 62 ASN 62 756 756 ASN ASN A . n A 1 63 LYS 63 757 757 LYS LYS A . n A 1 64 GLU 64 758 758 GLU GLU A . n A 1 65 ILE 65 759 759 ILE ILE A . n A 1 66 LEU 66 760 760 LEU LEU A . n A 1 67 ASP 67 761 761 ASP ASP A . n A 1 68 GLU 68 762 762 GLU GLU A . n A 1 69 ALA 69 763 763 ALA ALA A . n A 1 70 TYR 70 764 764 TYR TYR A . n A 1 71 VAL 71 765 765 VAL VAL A . n A 1 72 MET 72 766 766 MET MET A . n A 1 73 ALA 73 767 767 ALA ALA A . n A 1 74 SER 74 768 768 SER SER A . n A 1 75 VAL 75 769 769 VAL VAL A . n A 1 76 ASP 76 770 770 ASP ASP A . n A 1 77 ASN 77 771 771 ASN ASN A . n A 1 78 PRO 78 772 772 PRO PRO A . n A 1 79 HIS 79 773 773 HIS HIS A . n A 1 80 VAL 80 774 774 VAL VAL A . n A 1 81 CYS 81 775 775 CYS CYS A . n A 1 82 ARG 82 776 776 ARG ARG A . n A 1 83 LEU 83 777 777 LEU LEU A . n A 1 84 LEU 84 778 778 LEU LEU A . n A 1 85 GLY 85 779 779 GLY GLY A . n A 1 86 ILE 86 780 780 ILE ILE A . n A 1 87 CYS 87 781 781 CYS CYS A . n A 1 88 LEU 88 782 782 LEU LEU A . n A 1 89 THR 89 783 783 THR THR A . n A 1 90 SER 90 784 784 SER SER A . n A 1 91 THR 91 785 785 THR THR A . n A 1 92 VAL 92 786 786 VAL VAL A . n A 1 93 GLN 93 787 787 GLN GLN A . n A 1 94 LEU 94 788 788 LEU LEU A . n A 1 95 ILE 95 789 789 ILE ILE A . n A 1 96 MET 96 790 790 MET MET A . n A 1 97 GLN 97 791 791 GLN GLN A . n A 1 98 LEU 98 792 792 LEU LEU A . n A 1 99 MET 99 793 793 MET MET A . n A 1 100 PRO 100 794 794 PRO PRO A . n A 1 101 PHE 101 795 795 PHE PHE A . n A 1 102 GLY 102 796 796 GLY GLY A . n A 1 103 CYS 103 797 797 CYS CYS A . n A 1 104 LEU 104 798 798 LEU LEU A . n A 1 105 LEU 105 799 799 LEU LEU A . n A 1 106 ASP 106 800 800 ASP ASP A . n A 1 107 TYR 107 801 801 TYR TYR A . n A 1 108 VAL 108 802 802 VAL VAL A . n A 1 109 ARG 109 803 803 ARG ARG A . n A 1 110 GLU 110 804 804 GLU GLU A . n A 1 111 HIS 111 805 805 HIS HIS A . n A 1 112 LYS 112 806 806 LYS LYS A . n A 1 113 ASP 113 807 807 ASP ASP A . n A 1 114 ASN 114 808 808 ASN ASN A . n A 1 115 ILE 115 809 809 ILE ILE A . n A 1 116 GLY 116 810 810 GLY GLY A . n A 1 117 SER 117 811 811 SER SER A . n A 1 118 GLN 118 812 812 GLN GLN A . n A 1 119 TYR 119 813 813 TYR TYR A . n A 1 120 LEU 120 814 814 LEU LEU A . n A 1 121 LEU 121 815 815 LEU LEU A . n A 1 122 ASN 122 816 816 ASN ASN A . n A 1 123 TRP 123 817 817 TRP TRP A . n A 1 124 CYS 124 818 818 CYS CYS A . n A 1 125 VAL 125 819 819 VAL VAL A . n A 1 126 GLN 126 820 820 GLN GLN A . n A 1 127 ILE 127 821 821 ILE ILE A . n A 1 128 ALA 128 822 822 ALA ALA A . n A 1 129 LYS 129 823 823 LYS LYS A . n A 1 130 GLY 130 824 824 GLY GLY A . n A 1 131 MET 131 825 825 MET MET A . n A 1 132 ASN 132 826 826 ASN ASN A . n A 1 133 TYR 133 827 827 TYR TYR A . n A 1 134 LEU 134 828 828 LEU LEU A . n A 1 135 GLU 135 829 829 GLU GLU A . n A 1 136 ASP 136 830 830 ASP ASP A . n A 1 137 ARG 137 831 831 ARG ARG A . n A 1 138 ARG 138 832 832 ARG ARG A . n A 1 139 LEU 139 833 833 LEU LEU A . n A 1 140 VAL 140 834 834 VAL VAL A . n A 1 141 HIS 141 835 835 HIS HIS A . n A 1 142 ARG 142 836 836 ARG ARG A . n A 1 143 ASP 143 837 837 ASP ASP A . n A 1 144 LEU 144 838 838 LEU LEU A . n A 1 145 ALA 145 839 839 ALA ALA A . n A 1 146 ALA 146 840 840 ALA ALA A . n A 1 147 ARG 147 841 841 ARG ARG A . n A 1 148 ASN 148 842 842 ASN ASN A . n A 1 149 VAL 149 843 843 VAL VAL A . n A 1 150 LEU 150 844 844 LEU LEU A . n A 1 151 VAL 151 845 845 VAL VAL A . n A 1 152 LYS 152 846 846 LYS LYS A . n A 1 153 THR 153 847 847 THR THR A . n A 1 154 PRO 154 848 848 PRO PRO A . n A 1 155 GLN 155 849 849 GLN GLN A . n A 1 156 HIS 156 850 850 HIS HIS A . n A 1 157 VAL 157 851 851 VAL VAL A . n A 1 158 LYS 158 852 852 LYS LYS A . n A 1 159 ILE 159 853 853 ILE ILE A . n A 1 160 THR 160 854 854 THR THR A . n A 1 161 ASP 161 855 855 ASP ASP A . n A 1 162 PHE 162 856 856 PHE PHE A . n A 1 163 GLY 163 857 857 GLY GLY A . n A 1 164 LEU 164 858 858 LEU LEU A . n A 1 165 ALA 165 859 859 ALA ALA A . n A 1 166 LYS 166 860 860 LYS LYS A . n A 1 167 LEU 167 861 861 LEU LEU A . n A 1 168 LEU 168 862 862 LEU LEU A . n A 1 169 GLY 169 863 ? ? ? A . n A 1 170 ALA 170 864 ? ? ? A . n A 1 171 GLU 171 865 ? ? ? A . n A 1 172 GLU 172 866 ? ? ? A . n A 1 173 LYS 173 867 ? ? ? A . n A 1 174 GLU 174 868 868 GLU GLU A . n A 1 175 TYR 175 869 869 TYR TYR A . n A 1 176 HIS 176 870 870 HIS HIS A . n A 1 177 ALA 177 871 871 ALA ALA A . n A 1 178 GLU 178 872 872 GLU GLU A . n A 1 179 GLY 179 873 873 GLY GLY A . n A 1 180 GLY 180 874 874 GLY GLY A . n A 1 181 LYS 181 875 875 LYS LYS A . n A 1 182 VAL 182 876 876 VAL VAL A . n A 1 183 PRO 183 877 877 PRO PRO A . n A 1 184 ILE 184 878 878 ILE ILE A . n A 1 185 LYS 185 879 879 LYS LYS A . n A 1 186 TRP 186 880 880 TRP TRP A . n A 1 187 MET 187 881 881 MET MET A . n A 1 188 ALA 188 882 882 ALA ALA A . n A 1 189 LEU 189 883 883 LEU LEU A . n A 1 190 GLU 190 884 884 GLU GLU A . n A 1 191 SER 191 885 885 SER SER A . n A 1 192 ILE 192 886 886 ILE ILE A . n A 1 193 LEU 193 887 887 LEU LEU A . n A 1 194 HIS 194 888 888 HIS HIS A . n A 1 195 ARG 195 889 889 ARG ARG A . n A 1 196 ILE 196 890 890 ILE ILE A . n A 1 197 TYR 197 891 891 TYR TYR A . n A 1 198 THR 198 892 892 THR THR A . n A 1 199 HIS 199 893 893 HIS HIS A . n A 1 200 GLN 200 894 894 GLN GLN A . n A 1 201 SER 201 895 895 SER SER A . n A 1 202 ASP 202 896 896 ASP ASP A . n A 1 203 VAL 203 897 897 VAL VAL A . n A 1 204 TRP 204 898 898 TRP TRP A . n A 1 205 SER 205 899 899 SER SER A . n A 1 206 TYR 206 900 900 TYR TYR A . n A 1 207 GLY 207 901 901 GLY GLY A . n A 1 208 VAL 208 902 902 VAL VAL A . n A 1 209 THR 209 903 903 THR THR A . n A 1 210 VAL 210 904 904 VAL VAL A . n A 1 211 TRP 211 905 905 TRP TRP A . n A 1 212 GLU 212 906 906 GLU GLU A . n A 1 213 LEU 213 907 907 LEU LEU A . n A 1 214 MET 214 908 908 MET MET A . n A 1 215 THR 215 909 909 THR THR A . n A 1 216 PHE 216 910 910 PHE PHE A . n A 1 217 GLY 217 911 911 GLY GLY A . n A 1 218 SER 218 912 912 SER SER A . n A 1 219 LYS 219 913 913 LYS LYS A . n A 1 220 PRO 220 914 914 PRO PRO A . n A 1 221 TYR 221 915 915 TYR TYR A . n A 1 222 ASP 222 916 916 ASP ASP A . n A 1 223 GLY 223 917 917 GLY GLY A . n A 1 224 ILE 224 918 918 ILE ILE A . n A 1 225 PRO 225 919 919 PRO PRO A . n A 1 226 ALA 226 920 920 ALA ALA A . n A 1 227 SER 227 921 921 SER SER A . n A 1 228 GLU 228 922 922 GLU GLU A . n A 1 229 ILE 229 923 923 ILE ILE A . n A 1 230 SER 230 924 924 SER SER A . n A 1 231 SER 231 925 925 SER SER A . n A 1 232 ILE 232 926 926 ILE ILE A . n A 1 233 LEU 233 927 927 LEU LEU A . n A 1 234 GLU 234 928 928 GLU GLU A . n A 1 235 LYS 235 929 929 LYS LYS A . n A 1 236 GLY 236 930 930 GLY GLY A . n A 1 237 GLU 237 931 931 GLU GLU A . n A 1 238 ARG 238 932 932 ARG ARG A . n A 1 239 LEU 239 933 933 LEU LEU A . n A 1 240 PRO 240 934 934 PRO PRO A . n A 1 241 GLN 241 935 935 GLN GLN A . n A 1 242 PRO 242 936 936 PRO PRO A . n A 1 243 PRO 243 937 937 PRO PRO A . n A 1 244 ILE 244 938 938 ILE ILE A . n A 1 245 CYS 245 939 939 CYS CYS A . n A 1 246 THR 246 940 940 THR THR A . n A 1 247 ILE 247 941 941 ILE ILE A . n A 1 248 ASP 248 942 942 ASP ASP A . n A 1 249 VAL 249 943 943 VAL VAL A . n A 1 250 TYR 250 944 944 TYR TYR A . n A 1 251 MET 251 945 945 MET MET A . n A 1 252 ILE 252 946 946 ILE ILE A . n A 1 253 MET 253 947 947 MET MET A . n A 1 254 VAL 254 948 948 VAL VAL A . n A 1 255 LYS 255 949 949 LYS LYS A . n A 1 256 CYS 256 950 950 CYS CYS A . n A 1 257 TRP 257 951 951 TRP TRP A . n A 1 258 MET 258 952 952 MET MET A . n A 1 259 ILE 259 953 953 ILE ILE A . n A 1 260 ASP 260 954 954 ASP ASP A . n A 1 261 ALA 261 955 955 ALA ALA A . n A 1 262 ASP 262 956 956 ASP ASP A . n A 1 263 SER 263 957 957 SER SER A . n A 1 264 ARG 264 958 958 ARG ARG A . n A 1 265 PRO 265 959 959 PRO PRO A . n A 1 266 LYS 266 960 960 LYS LYS A . n A 1 267 PHE 267 961 961 PHE PHE A . n A 1 268 ARG 268 962 962 ARG ARG A . n A 1 269 GLU 269 963 963 GLU GLU A . n A 1 270 LEU 270 964 964 LEU LEU A . n A 1 271 ILE 271 965 965 ILE ILE A . n A 1 272 ILE 272 966 966 ILE ILE A . n A 1 273 GLU 273 967 967 GLU GLU A . n A 1 274 PHE 274 968 968 PHE PHE A . n A 1 275 SER 275 969 969 SER SER A . n A 1 276 LYS 276 970 970 LYS LYS A . n A 1 277 MET 277 971 971 MET MET A . n A 1 278 ALA 278 972 972 ALA ALA A . n A 1 279 ARG 279 973 973 ARG ARG A . n A 1 280 ASP 280 974 974 ASP ASP A . n A 1 281 PRO 281 975 975 PRO PRO A . n A 1 282 GLN 282 976 976 GLN GLN A . n A 1 283 ARG 283 977 977 ARG ARG A . n A 1 284 TYR 284 978 978 TYR TYR A . n A 1 285 LEU 285 979 979 LEU LEU A . n A 1 286 VAL 286 980 980 VAL VAL A . n A 1 287 ILE 287 981 981 ILE ILE A . n A 1 288 GLN 288 982 982 GLN GLN A . n A 1 289 GLY 289 983 983 GLY GLY A . n A 1 290 ASP 290 984 984 ASP ASP A . n A 1 291 GLU 291 985 985 GLU GLU A . n A 1 292 ARG 292 986 ? ? ? A . n A 1 293 MET 293 987 ? ? ? A . n A 1 294 HIS 294 988 ? ? ? A . n A 1 295 LEU 295 989 ? ? ? A . n A 1 296 PRO 296 990 ? ? ? A . n A 1 297 SER 297 991 ? ? ? A . n A 1 298 PRO 298 992 ? ? ? A . n A 1 299 THR 299 993 ? ? ? A . n A 1 300 ASP 300 994 ? ? ? A . n A 1 301 SER 301 995 ? ? ? A . n A 1 302 ASN 302 996 ? ? ? A . n A 1 303 PHE 303 997 ? ? ? A . n A 1 304 TYR 304 998 ? ? ? A . n A 1 305 ARG 305 999 ? ? ? A . n A 1 306 ALA 306 1000 ? ? ? A . n A 1 307 LEU 307 1001 ? ? ? A . n A 1 308 MET 308 1002 ? ? ? A . n A 1 309 ASP 309 1003 ? ? ? A . n A 1 310 GLU 310 1004 ? ? ? A . n A 1 311 GLU 311 1005 ? ? ? A . n A 1 312 ASP 312 1006 ? ? ? A . n A 1 313 MET 313 1007 1007 MET MET A . n A 1 314 ASP 314 1008 1008 ASP ASP A . n A 1 315 ASP 315 1009 1009 ASP ASP A . n A 1 316 VAL 316 1010 1010 VAL VAL A . n A 1 317 VAL 317 1011 1011 VAL VAL A . n A 1 318 ASP 318 1012 1012 ASP ASP A . n A 1 319 ALA 319 1013 1013 ALA ALA A . n A 1 320 ASP 320 1014 1014 ASP ASP A . n A 1 321 GLU 321 1015 1015 GLU GLU A . n A 1 322 TYR 322 1016 1016 TYR TYR A . n A 1 323 LEU 323 1017 1017 LEU LEU A . n A 1 324 ILE 324 1018 1018 ILE ILE A . n A 1 325 PRO 325 1019 ? ? ? A . n A 1 326 GLN 326 1020 ? ? ? A . n A 1 327 GLN 327 1021 ? ? ? A . n A 1 328 GLY 328 1022 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 5X4 1 1101 1 5X4 LI1 A . C 3 HOH 1 1201 10 HOH HOH A . C 3 HOH 2 1202 6 HOH HOH A . C 3 HOH 3 1203 1 HOH HOH A . C 3 HOH 4 1204 5 HOH HOH A . C 3 HOH 5 1205 7 HOH HOH A . C 3 HOH 6 1206 3 HOH HOH A . C 3 HOH 7 1207 4 HOH HOH A . C 3 HOH 8 1208 11 HOH HOH A . C 3 HOH 9 1209 8 HOH HOH A . C 3 HOH 10 1210 2 HOH HOH A . C 3 HOH 11 1211 9 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 14520 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-27 2 'Structure model' 1 1 2016-08-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -52.8056 8.0955 -31.0190 0.4693 0.5988 0.5252 -0.1413 -0.0278 0.0083 0.6476 0.4682 1.0763 0.6479 -0.7167 -0.6631 0.1014 0.0762 0.0407 0.0097 -0.0612 -0.1023 -0.2317 0.2944 0.0032 'X-RAY DIFFRACTION' 2 ? refined -58.1311 -6.8530 -25.3971 0.4376 0.4872 0.3254 -0.0368 0.0546 0.0513 0.9846 1.5577 0.7040 0.7161 0.0075 -0.7669 -0.0972 -0.0441 0.1177 -0.1272 -0.1308 -0.1660 0.0277 0.2242 -0.0031 'X-RAY DIFFRACTION' 3 ? refined -61.6506 -18.8384 -21.4722 0.4613 0.4199 0.4002 -0.0084 0.0970 0.0725 0.2450 2.4940 1.8533 0.9040 -0.7077 -1.2771 -0.1508 -0.1254 -0.1315 -0.2087 -0.1914 -0.3619 0.3934 0.2158 -0.4057 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 697 through 767 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 768 through 882 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 883 through 1018 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG1 A THR 783 ? ? O A THR 785 ? ? 1.84 2 1 NH1 A ARG 932 ? ? O A TRP 951 ? ? 1.93 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A LEU 861 ? ? CG A LEU 861 ? ? CD1 A LEU 861 ? ? 93.56 111.00 -17.44 1.70 N 2 1 CG1 A ILE 878 ? ? CB A ILE 878 ? ? CG2 A ILE 878 ? ? 97.80 111.40 -13.60 2.20 N 3 1 NE A ARG 932 ? ? CZ A ARG 932 ? ? NH1 A ARG 932 ? ? 112.52 120.30 -7.78 0.50 N 4 1 NE A ARG 932 ? ? CZ A ARG 932 ? ? NH2 A ARG 932 ? ? 125.54 120.30 5.24 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 836 ? ? 72.54 -3.53 2 1 ASP A 837 ? ? -140.02 39.22 3 1 PHE A 856 ? ? -115.76 70.34 4 1 GLU A 872 ? ? -109.64 -78.61 5 1 ILE A 878 ? ? 66.26 -53.45 6 1 ASP A 974 ? ? -150.61 72.56 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 695 ? A GLY 1 2 1 Y 1 A GLY 696 ? A GLY 2 3 1 Y 1 A GLY 721 ? A GLY 27 4 1 Y 1 A ALA 722 ? A ALA 28 5 1 Y 1 A PHE 723 ? A PHE 29 6 1 Y 1 A GLY 724 ? A GLY 30 7 1 Y 1 A LEU 747 ? A LEU 53 8 1 Y 1 A ARG 748 ? A ARG 54 9 1 Y 1 A GLU 749 ? A GLU 55 10 1 Y 1 A ALA 750 ? A ALA 56 11 1 Y 1 A THR 751 ? A THR 57 12 1 Y 1 A GLY 863 ? A GLY 169 13 1 Y 1 A ALA 864 ? A ALA 170 14 1 Y 1 A GLU 865 ? A GLU 171 15 1 Y 1 A GLU 866 ? A GLU 172 16 1 Y 1 A LYS 867 ? A LYS 173 17 1 Y 1 A ARG 986 ? A ARG 292 18 1 Y 1 A MET 987 ? A MET 293 19 1 Y 1 A HIS 988 ? A HIS 294 20 1 Y 1 A LEU 989 ? A LEU 295 21 1 Y 1 A PRO 990 ? A PRO 296 22 1 Y 1 A SER 991 ? A SER 297 23 1 Y 1 A PRO 992 ? A PRO 298 24 1 Y 1 A THR 993 ? A THR 299 25 1 Y 1 A ASP 994 ? A ASP 300 26 1 Y 1 A SER 995 ? A SER 301 27 1 Y 1 A ASN 996 ? A ASN 302 28 1 Y 1 A PHE 997 ? A PHE 303 29 1 Y 1 A TYR 998 ? A TYR 304 30 1 Y 1 A ARG 999 ? A ARG 305 31 1 Y 1 A ALA 1000 ? A ALA 306 32 1 Y 1 A LEU 1001 ? A LEU 307 33 1 Y 1 A MET 1002 ? A MET 308 34 1 Y 1 A ASP 1003 ? A ASP 309 35 1 Y 1 A GLU 1004 ? A GLU 310 36 1 Y 1 A GLU 1005 ? A GLU 311 37 1 Y 1 A ASP 1006 ? A ASP 312 38 1 Y 1 A PRO 1019 ? A PRO 325 39 1 Y 1 A GLN 1020 ? A GLN 326 40 1 Y 1 A GLN 1021 ? A GLN 327 41 1 Y 1 A GLY 1022 ? A GLY 328 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-[7-methyl-1-[(3~{R})-1-propanoylazepan-3-yl]benzimidazol-2-yl]-3-(trifluoromethyl)benzamide' 5X4 3 water HOH #