data_5FGM # _entry.id 5FGM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5FGM pdb_00005fgm 10.2210/pdb5fgm/pdb WWPDB D_1000216559 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-02 2 'Structure model' 1 1 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_modification_feature 6 2 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5FGM _pdbx_database_status.recvd_initial_deposition_date 2015-12-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Park, S.Y.' _audit_author.pdbx_ordinal 1 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 470 _citation.language ? _citation.page_first 257 _citation.page_last 262 _citation.title ;In Streptomyces coelicolor SigR, methionine at the -35 element interacting region 4 confers the -31'-adenine base selectivity ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2016.01.075 _citation.pdbx_database_id_PubMed 26775842 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, K.Y.' 1 ? primary 'Park, J.K.' 2 ? primary 'Park, S.Y.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ECF RNA polymerase sigma factor SigR' 7990.549 1 ? ? 'UNP residues 143-207' ? 2 water nat water 18.015 11 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ECF sigma factor SigR,Alternative RNA polymerase sigma factor SigR,RNA polymerase sigma-R factor,Sigma-R factor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSH(MSE)LPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADI(MSE)GTPIGTV(MSE)SRLHRGRRQLRG(MSE)L EDYAR ; _entity_poly.pdbx_seq_one_letter_code_can GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MSE n 1 5 LEU n 1 6 PRO n 1 7 ASP n 1 8 SER n 1 9 ASP n 1 10 VAL n 1 11 LYS n 1 12 GLN n 1 13 ALA n 1 14 LEU n 1 15 GLN n 1 16 ALA n 1 17 ILE n 1 18 PRO n 1 19 GLU n 1 20 GLU n 1 21 PHE n 1 22 ARG n 1 23 ILE n 1 24 ALA n 1 25 VAL n 1 26 TYR n 1 27 LEU n 1 28 ALA n 1 29 ASP n 1 30 VAL n 1 31 GLU n 1 32 GLY n 1 33 PHE n 1 34 ALA n 1 35 TYR n 1 36 LYS n 1 37 GLU n 1 38 ILE n 1 39 ALA n 1 40 ASP n 1 41 ILE n 1 42 MSE n 1 43 GLY n 1 44 THR n 1 45 PRO n 1 46 ILE n 1 47 GLY n 1 48 THR n 1 49 VAL n 1 50 MSE n 1 51 SER n 1 52 ARG n 1 53 LEU n 1 54 HIS n 1 55 ARG n 1 56 GLY n 1 57 ARG n 1 58 ARG n 1 59 GLN n 1 60 LEU n 1 61 ARG n 1 62 GLY n 1 63 MSE n 1 64 LEU n 1 65 GLU n 1 66 ASP n 1 67 TYR n 1 68 ALA n 1 69 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 69 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'sigR, SCO5216' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC BAA-471 / A3(2) / M145' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces coelicolor' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 100226 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 139 ? ? ? A . n A 1 2 SER 2 140 ? ? ? A . n A 1 3 HIS 3 141 ? ? ? A . n A 1 4 MSE 4 142 ? ? ? A . n A 1 5 LEU 5 143 143 LEU LEU A . n A 1 6 PRO 6 144 144 PRO PRO A . n A 1 7 ASP 7 145 145 ASP ASP A . n A 1 8 SER 8 146 146 SER SER A . n A 1 9 ASP 9 147 147 ASP ASP A . n A 1 10 VAL 10 148 148 VAL VAL A . n A 1 11 LYS 11 149 149 LYS LYS A . n A 1 12 GLN 12 150 150 GLN GLN A . n A 1 13 ALA 13 151 151 ALA ALA A . n A 1 14 LEU 14 152 152 LEU LEU A . n A 1 15 GLN 15 153 153 GLN GLN A . n A 1 16 ALA 16 154 154 ALA ALA A . n A 1 17 ILE 17 155 155 ILE ILE A . n A 1 18 PRO 18 156 156 PRO PRO A . n A 1 19 GLU 19 157 157 GLU GLU A . n A 1 20 GLU 20 158 158 GLU GLU A . n A 1 21 PHE 21 159 159 PHE PHE A . n A 1 22 ARG 22 160 160 ARG ARG A . n A 1 23 ILE 23 161 161 ILE ILE A . n A 1 24 ALA 24 162 162 ALA ALA A . n A 1 25 VAL 25 163 163 VAL VAL A . n A 1 26 TYR 26 164 164 TYR TYR A . n A 1 27 LEU 27 165 165 LEU LEU A . n A 1 28 ALA 28 166 166 ALA ALA A . n A 1 29 ASP 29 167 167 ASP ASP A . n A 1 30 VAL 30 168 168 VAL VAL A . n A 1 31 GLU 31 169 169 GLU GLU A . n A 1 32 GLY 32 170 170 GLY GLY A . n A 1 33 PHE 33 171 171 PHE PHE A . n A 1 34 ALA 34 172 172 ALA ALA A . n A 1 35 TYR 35 173 173 TYR TYR A . n A 1 36 LYS 36 174 174 LYS LYS A . n A 1 37 GLU 37 175 175 GLU GLU A . n A 1 38 ILE 38 176 176 ILE ILE A . n A 1 39 ALA 39 177 177 ALA ALA A . n A 1 40 ASP 40 178 178 ASP ASP A . n A 1 41 ILE 41 179 179 ILE ILE A . n A 1 42 MSE 42 180 180 MSE MSE A . n A 1 43 GLY 43 181 181 GLY GLY A . n A 1 44 THR 44 182 182 THR THR A . n A 1 45 PRO 45 183 183 PRO PRO A . n A 1 46 ILE 46 184 184 ILE ILE A . n A 1 47 GLY 47 185 185 GLY GLY A . n A 1 48 THR 48 186 186 THR THR A . n A 1 49 VAL 49 187 187 VAL VAL A . n A 1 50 MSE 50 188 188 MSE MSE A . n A 1 51 SER 51 189 189 SER SER A . n A 1 52 ARG 52 190 190 ARG ARG A . n A 1 53 LEU 53 191 191 LEU LEU A . n A 1 54 HIS 54 192 192 HIS HIS A . n A 1 55 ARG 55 193 193 ARG ARG A . n A 1 56 GLY 56 194 194 GLY GLY A . n A 1 57 ARG 57 195 195 ARG ARG A . n A 1 58 ARG 58 196 196 ARG ARG A . n A 1 59 GLN 59 197 197 GLN GLN A . n A 1 60 LEU 60 198 198 LEU LEU A . n A 1 61 ARG 61 199 199 ARG ARG A . n A 1 62 GLY 62 200 200 GLY GLY A . n A 1 63 MSE 63 201 201 MSE MSE A . n A 1 64 LEU 64 202 202 LEU LEU A . n A 1 65 GLU 65 203 203 GLU GLU A . n A 1 66 ASP 66 204 204 ASP ASP A . n A 1 67 TYR 67 205 205 TYR TYR A . n A 1 68 ALA 68 206 206 ALA ALA A . n A 1 69 ARG 69 207 207 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 6 HOH HOH A . B 2 HOH 2 302 8 HOH HOH A . B 2 HOH 3 303 2 HOH HOH A . B 2 HOH 4 304 11 HOH HOH A . B 2 HOH 5 305 9 HOH HOH A . B 2 HOH 6 306 3 HOH HOH A . B 2 HOH 7 307 4 HOH HOH A . B 2 HOH 8 308 1 HOH HOH A . B 2 HOH 9 309 10 HOH HOH A . B 2 HOH 10 310 5 HOH HOH A . B 2 HOH 11 311 7 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.5.0110 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5FGM _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.139 _cell.length_a_esd ? _cell.length_b 42.139 _cell.length_b_esd ? _cell.length_c 102.016 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FGM _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5FGM _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.83 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.60 _exptl_crystal.description 'THE ENTRY CONTAINS FRIEDEL PAIRS IN F_PLUS/MINUS COLUMNS.' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M lithium sulfate, 0.1M Tris pH 8.5, 20-30%(w/v) PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-04 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5FGM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.6 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3011 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.1 _reflns.pdbx_Rmerge_I_obs 0.069 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 55.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.64 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 8.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.481 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 15 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 1.87 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 1.87 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -3.73 _refine.B_iso_max ? _refine.B_iso_mean 43.839 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.926 _refine.correlation_coeff_Fo_to_Fc_free 0.891 _refine.details 'SF FILE CONTAINS FRIEDEL PAIRS UNDER I/F_MINUS AND I/F_PLUS COLUMNS. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5FGM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.60 _refine.ls_d_res_low 38.95 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3011 _refine.ls_number_reflns_R_free 135 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.24 _refine.ls_percent_reflns_R_free 4.3 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.24240 _refine.ls_R_factor_R_free 0.31798 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.23879 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.481 _refine.pdbx_overall_ESU_R_Free 0.351 _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 12.842 _refine.overall_SU_ML 0.261 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 517 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 528 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 38.95 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.023 0.022 522 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.924 1.978 701 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.235 5.000 64 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.505 22.308 26 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 23.040 15.000 95 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.714 15.000 7 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.126 0.200 77 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.021 395 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 0.903 1.500 321 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.736 2.000 511 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.692 3.000 201 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 4.816 4.500 190 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.598 _refine_ls_shell.d_res_low 2.665 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 6 _refine_ls_shell.number_reflns_R_work 220 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.593 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.343 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5FGM _struct.title 'Streptomyces coelicolor SigR region 4' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5FGM _struct_keywords.text 'ECF sigma factors, sigma factor region 4, promoter -35 element binding, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SIGR_STRCO _struct_ref.pdbx_db_accession Q7AKG9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR _struct_ref.pdbx_align_begin 143 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5FGM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7AKG9 _struct_ref_seq.db_align_beg 143 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 207 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 143 _struct_ref_seq.pdbx_auth_seq_align_end 207 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FGM GLY A 1 ? UNP Q7AKG9 ? ? 'expression tag' 139 1 1 5FGM SER A 2 ? UNP Q7AKG9 ? ? 'expression tag' 140 2 1 5FGM HIS A 3 ? UNP Q7AKG9 ? ? 'expression tag' 141 3 1 5FGM MSE A 4 ? UNP Q7AKG9 ? ? 'expression tag' 142 4 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4480 ? 2 'ABSA (A^2)' 1270 ? 2 MORE -7 ? 2 'SSA (A^2)' 7700 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2 A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 42.1390000000 -1.0000000000 0.0000000000 0.0000000000 42.1390000000 0.0000000000 0.0000000000 -1.0000000000 51.0080000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 9 ? ALA A 16 ? ASP A 147 ALA A 154 1 ? 8 HELX_P HELX_P2 AA2 PRO A 18 ? VAL A 30 ? PRO A 156 VAL A 168 1 ? 13 HELX_P HELX_P3 AA3 ALA A 34 ? GLY A 43 ? ALA A 172 GLY A 181 1 ? 10 HELX_P HELX_P4 AA4 PRO A 45 ? TYR A 67 ? PRO A 183 TYR A 205 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ILE 41 C ? ? ? 1_555 A MSE 42 N ? ? A ILE 179 A MSE 180 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale2 covale both ? A MSE 42 C ? ? ? 1_555 A GLY 43 N ? ? A MSE 180 A GLY 181 1_555 ? ? ? ? ? ? ? 1.315 ? ? covale3 covale both ? A VAL 49 C ? ? ? 1_555 A MSE 50 N ? ? A VAL 187 A MSE 188 1_555 ? ? ? ? ? ? ? 1.308 ? ? covale4 covale both ? A MSE 50 C ? ? ? 1_555 A SER 51 N ? ? A MSE 188 A SER 189 1_555 ? ? ? ? ? ? ? 1.296 ? ? covale5 covale both ? A GLY 62 C ? ? ? 1_555 A MSE 63 N ? ? A GLY 200 A MSE 201 1_555 ? ? ? ? ? ? ? 1.313 ? ? covale6 covale both ? A MSE 63 C ? ? ? 1_555 A LEU 64 N ? ? A MSE 201 A LEU 202 1_555 ? ? ? ? ? ? ? 1.309 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 42 ? . . . . MSE A 180 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 50 ? . . . . MSE A 188 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 63 ? . . . . MSE A 201 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _pdbx_entry_details.entry_id 5FGM _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 144 ? ? -82.49 -156.89 2 1 ASP A 145 ? ? -68.89 -177.43 3 1 SER A 146 ? ? -75.90 45.76 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 SER _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 146 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASP _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 147 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 148.48 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 42 A MSE 180 ? MET 'modified residue' 2 A MSE 50 A MSE 188 ? MET 'modified residue' 3 A MSE 63 A MSE 201 ? MET 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 139 ? A GLY 1 2 1 Y 1 A SER 140 ? A SER 2 3 1 Y 1 A HIS 141 ? A HIS 3 4 1 Y 1 A MSE 142 ? A MSE 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 HOH O O N N 127 HOH H1 H N N 128 HOH H2 H N N 129 ILE N N N N 130 ILE CA C N S 131 ILE C C N N 132 ILE O O N N 133 ILE CB C N S 134 ILE CG1 C N N 135 ILE CG2 C N N 136 ILE CD1 C N N 137 ILE OXT O N N 138 ILE H H N N 139 ILE H2 H N N 140 ILE HA H N N 141 ILE HB H N N 142 ILE HG12 H N N 143 ILE HG13 H N N 144 ILE HG21 H N N 145 ILE HG22 H N N 146 ILE HG23 H N N 147 ILE HD11 H N N 148 ILE HD12 H N N 149 ILE HD13 H N N 150 ILE HXT H N N 151 LEU N N N N 152 LEU CA C N S 153 LEU C C N N 154 LEU O O N N 155 LEU CB C N N 156 LEU CG C N N 157 LEU CD1 C N N 158 LEU CD2 C N N 159 LEU OXT O N N 160 LEU H H N N 161 LEU H2 H N N 162 LEU HA H N N 163 LEU HB2 H N N 164 LEU HB3 H N N 165 LEU HG H N N 166 LEU HD11 H N N 167 LEU HD12 H N N 168 LEU HD13 H N N 169 LEU HD21 H N N 170 LEU HD22 H N N 171 LEU HD23 H N N 172 LEU HXT H N N 173 LYS N N N N 174 LYS CA C N S 175 LYS C C N N 176 LYS O O N N 177 LYS CB C N N 178 LYS CG C N N 179 LYS CD C N N 180 LYS CE C N N 181 LYS NZ N N N 182 LYS OXT O N N 183 LYS H H N N 184 LYS H2 H N N 185 LYS HA H N N 186 LYS HB2 H N N 187 LYS HB3 H N N 188 LYS HG2 H N N 189 LYS HG3 H N N 190 LYS HD2 H N N 191 LYS HD3 H N N 192 LYS HE2 H N N 193 LYS HE3 H N N 194 LYS HZ1 H N N 195 LYS HZ2 H N N 196 LYS HZ3 H N N 197 LYS HXT H N N 198 MSE N N N N 199 MSE CA C N S 200 MSE C C N N 201 MSE O O N N 202 MSE OXT O N N 203 MSE CB C N N 204 MSE CG C N N 205 MSE SE SE N N 206 MSE CE C N N 207 MSE H H N N 208 MSE H2 H N N 209 MSE HA H N N 210 MSE HXT H N N 211 MSE HB2 H N N 212 MSE HB3 H N N 213 MSE HG2 H N N 214 MSE HG3 H N N 215 MSE HE1 H N N 216 MSE HE2 H N N 217 MSE HE3 H N N 218 PHE N N N N 219 PHE CA C N S 220 PHE C C N N 221 PHE O O N N 222 PHE CB C N N 223 PHE CG C Y N 224 PHE CD1 C Y N 225 PHE CD2 C Y N 226 PHE CE1 C Y N 227 PHE CE2 C Y N 228 PHE CZ C Y N 229 PHE OXT O N N 230 PHE H H N N 231 PHE H2 H N N 232 PHE HA H N N 233 PHE HB2 H N N 234 PHE HB3 H N N 235 PHE HD1 H N N 236 PHE HD2 H N N 237 PHE HE1 H N N 238 PHE HE2 H N N 239 PHE HZ H N N 240 PHE HXT H N N 241 PRO N N N N 242 PRO CA C N S 243 PRO C C N N 244 PRO O O N N 245 PRO CB C N N 246 PRO CG C N N 247 PRO CD C N N 248 PRO OXT O N N 249 PRO H H N N 250 PRO HA H N N 251 PRO HB2 H N N 252 PRO HB3 H N N 253 PRO HG2 H N N 254 PRO HG3 H N N 255 PRO HD2 H N N 256 PRO HD3 H N N 257 PRO HXT H N N 258 SER N N N N 259 SER CA C N S 260 SER C C N N 261 SER O O N N 262 SER CB C N N 263 SER OG O N N 264 SER OXT O N N 265 SER H H N N 266 SER H2 H N N 267 SER HA H N N 268 SER HB2 H N N 269 SER HB3 H N N 270 SER HG H N N 271 SER HXT H N N 272 THR N N N N 273 THR CA C N S 274 THR C C N N 275 THR O O N N 276 THR CB C N R 277 THR OG1 O N N 278 THR CG2 C N N 279 THR OXT O N N 280 THR H H N N 281 THR H2 H N N 282 THR HA H N N 283 THR HB H N N 284 THR HG1 H N N 285 THR HG21 H N N 286 THR HG22 H N N 287 THR HG23 H N N 288 THR HXT H N N 289 TYR N N N N 290 TYR CA C N S 291 TYR C C N N 292 TYR O O N N 293 TYR CB C N N 294 TYR CG C Y N 295 TYR CD1 C Y N 296 TYR CD2 C Y N 297 TYR CE1 C Y N 298 TYR CE2 C Y N 299 TYR CZ C Y N 300 TYR OH O N N 301 TYR OXT O N N 302 TYR H H N N 303 TYR H2 H N N 304 TYR HA H N N 305 TYR HB2 H N N 306 TYR HB3 H N N 307 TYR HD1 H N N 308 TYR HD2 H N N 309 TYR HE1 H N N 310 TYR HE2 H N N 311 TYR HH H N N 312 TYR HXT H N N 313 VAL N N N N 314 VAL CA C N S 315 VAL C C N N 316 VAL O O N N 317 VAL CB C N N 318 VAL CG1 C N N 319 VAL CG2 C N N 320 VAL OXT O N N 321 VAL H H N N 322 VAL H2 H N N 323 VAL HA H N N 324 VAL HB H N N 325 VAL HG11 H N N 326 VAL HG12 H N N 327 VAL HG13 H N N 328 VAL HG21 H N N 329 VAL HG22 H N N 330 VAL HG23 H N N 331 VAL HXT H N N 332 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 HOH O H1 sing N N 121 HOH O H2 sing N N 122 ILE N CA sing N N 123 ILE N H sing N N 124 ILE N H2 sing N N 125 ILE CA C sing N N 126 ILE CA CB sing N N 127 ILE CA HA sing N N 128 ILE C O doub N N 129 ILE C OXT sing N N 130 ILE CB CG1 sing N N 131 ILE CB CG2 sing N N 132 ILE CB HB sing N N 133 ILE CG1 CD1 sing N N 134 ILE CG1 HG12 sing N N 135 ILE CG1 HG13 sing N N 136 ILE CG2 HG21 sing N N 137 ILE CG2 HG22 sing N N 138 ILE CG2 HG23 sing N N 139 ILE CD1 HD11 sing N N 140 ILE CD1 HD12 sing N N 141 ILE CD1 HD13 sing N N 142 ILE OXT HXT sing N N 143 LEU N CA sing N N 144 LEU N H sing N N 145 LEU N H2 sing N N 146 LEU CA C sing N N 147 LEU CA CB sing N N 148 LEU CA HA sing N N 149 LEU C O doub N N 150 LEU C OXT sing N N 151 LEU CB CG sing N N 152 LEU CB HB2 sing N N 153 LEU CB HB3 sing N N 154 LEU CG CD1 sing N N 155 LEU CG CD2 sing N N 156 LEU CG HG sing N N 157 LEU CD1 HD11 sing N N 158 LEU CD1 HD12 sing N N 159 LEU CD1 HD13 sing N N 160 LEU CD2 HD21 sing N N 161 LEU CD2 HD22 sing N N 162 LEU CD2 HD23 sing N N 163 LEU OXT HXT sing N N 164 LYS N CA sing N N 165 LYS N H sing N N 166 LYS N H2 sing N N 167 LYS CA C sing N N 168 LYS CA CB sing N N 169 LYS CA HA sing N N 170 LYS C O doub N N 171 LYS C OXT sing N N 172 LYS CB CG sing N N 173 LYS CB HB2 sing N N 174 LYS CB HB3 sing N N 175 LYS CG CD sing N N 176 LYS CG HG2 sing N N 177 LYS CG HG3 sing N N 178 LYS CD CE sing N N 179 LYS CD HD2 sing N N 180 LYS CD HD3 sing N N 181 LYS CE NZ sing N N 182 LYS CE HE2 sing N N 183 LYS CE HE3 sing N N 184 LYS NZ HZ1 sing N N 185 LYS NZ HZ2 sing N N 186 LYS NZ HZ3 sing N N 187 LYS OXT HXT sing N N 188 MSE N CA sing N N 189 MSE N H sing N N 190 MSE N H2 sing N N 191 MSE CA C sing N N 192 MSE CA CB sing N N 193 MSE CA HA sing N N 194 MSE C O doub N N 195 MSE C OXT sing N N 196 MSE OXT HXT sing N N 197 MSE CB CG sing N N 198 MSE CB HB2 sing N N 199 MSE CB HB3 sing N N 200 MSE CG SE sing N N 201 MSE CG HG2 sing N N 202 MSE CG HG3 sing N N 203 MSE SE CE sing N N 204 MSE CE HE1 sing N N 205 MSE CE HE2 sing N N 206 MSE CE HE3 sing N N 207 PHE N CA sing N N 208 PHE N H sing N N 209 PHE N H2 sing N N 210 PHE CA C sing N N 211 PHE CA CB sing N N 212 PHE CA HA sing N N 213 PHE C O doub N N 214 PHE C OXT sing N N 215 PHE CB CG sing N N 216 PHE CB HB2 sing N N 217 PHE CB HB3 sing N N 218 PHE CG CD1 doub Y N 219 PHE CG CD2 sing Y N 220 PHE CD1 CE1 sing Y N 221 PHE CD1 HD1 sing N N 222 PHE CD2 CE2 doub Y N 223 PHE CD2 HD2 sing N N 224 PHE CE1 CZ doub Y N 225 PHE CE1 HE1 sing N N 226 PHE CE2 CZ sing Y N 227 PHE CE2 HE2 sing N N 228 PHE CZ HZ sing N N 229 PHE OXT HXT sing N N 230 PRO N CA sing N N 231 PRO N CD sing N N 232 PRO N H sing N N 233 PRO CA C sing N N 234 PRO CA CB sing N N 235 PRO CA HA sing N N 236 PRO C O doub N N 237 PRO C OXT sing N N 238 PRO CB CG sing N N 239 PRO CB HB2 sing N N 240 PRO CB HB3 sing N N 241 PRO CG CD sing N N 242 PRO CG HG2 sing N N 243 PRO CG HG3 sing N N 244 PRO CD HD2 sing N N 245 PRO CD HD3 sing N N 246 PRO OXT HXT sing N N 247 SER N CA sing N N 248 SER N H sing N N 249 SER N H2 sing N N 250 SER CA C sing N N 251 SER CA CB sing N N 252 SER CA HA sing N N 253 SER C O doub N N 254 SER C OXT sing N N 255 SER CB OG sing N N 256 SER CB HB2 sing N N 257 SER CB HB3 sing N N 258 SER OG HG sing N N 259 SER OXT HXT sing N N 260 THR N CA sing N N 261 THR N H sing N N 262 THR N H2 sing N N 263 THR CA C sing N N 264 THR CA CB sing N N 265 THR CA HA sing N N 266 THR C O doub N N 267 THR C OXT sing N N 268 THR CB OG1 sing N N 269 THR CB CG2 sing N N 270 THR CB HB sing N N 271 THR OG1 HG1 sing N N 272 THR CG2 HG21 sing N N 273 THR CG2 HG22 sing N N 274 THR CG2 HG23 sing N N 275 THR OXT HXT sing N N 276 TYR N CA sing N N 277 TYR N H sing N N 278 TYR N H2 sing N N 279 TYR CA C sing N N 280 TYR CA CB sing N N 281 TYR CA HA sing N N 282 TYR C O doub N N 283 TYR C OXT sing N N 284 TYR CB CG sing N N 285 TYR CB HB2 sing N N 286 TYR CB HB3 sing N N 287 TYR CG CD1 doub Y N 288 TYR CG CD2 sing Y N 289 TYR CD1 CE1 sing Y N 290 TYR CD1 HD1 sing N N 291 TYR CD2 CE2 doub Y N 292 TYR CD2 HD2 sing N N 293 TYR CE1 CZ doub Y N 294 TYR CE1 HE1 sing N N 295 TYR CE2 CZ sing Y N 296 TYR CE2 HE2 sing N N 297 TYR CZ OH sing N N 298 TYR OH HH sing N N 299 TYR OXT HXT sing N N 300 VAL N CA sing N N 301 VAL N H sing N N 302 VAL N H2 sing N N 303 VAL CA C sing N N 304 VAL CA CB sing N N 305 VAL CA HA sing N N 306 VAL C O doub N N 307 VAL C OXT sing N N 308 VAL CB CG1 sing N N 309 VAL CB CG2 sing N N 310 VAL CB HB sing N N 311 VAL CG1 HG11 sing N N 312 VAL CG1 HG12 sing N N 313 VAL CG1 HG13 sing N N 314 VAL CG2 HG21 sing N N 315 VAL CG2 HG22 sing N N 316 VAL CG2 HG23 sing N N 317 VAL OXT HXT sing N N 318 # _atom_sites.entry_id 5FGM _atom_sites.fract_transf_matrix[1][1] 0.023731 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023731 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009802 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_