data_5FIT # _entry.id 5FIT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5FIT WWPDB D_1000179708 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 5FIT _pdbx_database_status.recvd_initial_deposition_date 1997-09-25 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lima, C.D.' 1 'Klein, M.G.' 2 'Hendrickson, W.A.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure-based analysis of catalysis and substrate definition in the HIT protein family.' Science 278 286 290 1997 SCIEAS US 0036-8075 0038 ? 9323207 10.1126/science.278.5336.286 1 'MAD Analysis of Fhit, a Putative Human Tumor Suppressor from the Hit Protein Family' Structure 5 763 ? 1997 STRUE6 UK 0969-2126 2005 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lima, C.D.' 1 primary 'Klein, M.G.' 2 primary 'Hendrickson, W.A.' 3 1 'Lima, C.D.' 4 1 ;D'Amico, K.L. ; 5 1 'Naday, I.' 6 1 'Rosenbaum, G.' 7 1 'Westbrook, E.M.' 8 1 'Hendrickson, W.A.' 9 # _cell.entry_id 5FIT _cell.length_a 50.640 _cell.length_b 50.640 _cell.length_c 267.520 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FIT _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'FRAGILE HISTIDINE TRIAD PROTEIN' 16979.992 1 3.6.1.29 ? ? ? 2 non-polymer syn 'PHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' 425.228 1 ? ? ? ? 3 water nat water 18.015 54 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name FHIT # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTF S(MSE)QDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEE(MSE)AAEAAALRVYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTF SMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 PHE n 1 4 ARG n 1 5 PHE n 1 6 GLY n 1 7 GLN n 1 8 HIS n 1 9 LEU n 1 10 ILE n 1 11 LYS n 1 12 PRO n 1 13 SER n 1 14 VAL n 1 15 VAL n 1 16 PHE n 1 17 LEU n 1 18 LYS n 1 19 THR n 1 20 GLU n 1 21 LEU n 1 22 SER n 1 23 PHE n 1 24 ALA n 1 25 LEU n 1 26 VAL n 1 27 ASN n 1 28 ARG n 1 29 LYS n 1 30 PRO n 1 31 VAL n 1 32 VAL n 1 33 PRO n 1 34 GLY n 1 35 HIS n 1 36 VAL n 1 37 LEU n 1 38 VAL n 1 39 CYS n 1 40 PRO n 1 41 LEU n 1 42 ARG n 1 43 PRO n 1 44 VAL n 1 45 GLU n 1 46 ARG n 1 47 PHE n 1 48 HIS n 1 49 ASP n 1 50 LEU n 1 51 ARG n 1 52 PRO n 1 53 ASP n 1 54 GLU n 1 55 VAL n 1 56 ALA n 1 57 ASP n 1 58 LEU n 1 59 PHE n 1 60 GLN n 1 61 THR n 1 62 THR n 1 63 GLN n 1 64 ARG n 1 65 VAL n 1 66 GLY n 1 67 THR n 1 68 VAL n 1 69 VAL n 1 70 GLU n 1 71 LYS n 1 72 HIS n 1 73 PHE n 1 74 HIS n 1 75 GLY n 1 76 THR n 1 77 SER n 1 78 LEU n 1 79 THR n 1 80 PHE n 1 81 SER n 1 82 MSE n 1 83 GLN n 1 84 ASP n 1 85 GLY n 1 86 PRO n 1 87 GLU n 1 88 ALA n 1 89 GLY n 1 90 GLN n 1 91 THR n 1 92 VAL n 1 93 LYS n 1 94 HIS n 1 95 VAL n 1 96 HIS n 1 97 VAL n 1 98 HIS n 1 99 VAL n 1 100 LEU n 1 101 PRO n 1 102 ARG n 1 103 LYS n 1 104 ALA n 1 105 GLY n 1 106 ASP n 1 107 PHE n 1 108 HIS n 1 109 ARG n 1 110 ASN n 1 111 ASP n 1 112 SER n 1 113 ILE n 1 114 TYR n 1 115 GLU n 1 116 GLU n 1 117 LEU n 1 118 GLN n 1 119 LYS n 1 120 HIS n 1 121 ASP n 1 122 LYS n 1 123 GLU n 1 124 ASP n 1 125 PHE n 1 126 PRO n 1 127 ALA n 1 128 SER n 1 129 TRP n 1 130 ARG n 1 131 SER n 1 132 GLU n 1 133 GLU n 1 134 GLU n 1 135 MSE n 1 136 ALA n 1 137 ALA n 1 138 GLU n 1 139 ALA n 1 140 ALA n 1 141 ALA n 1 142 LEU n 1 143 ARG n 1 144 VAL n 1 145 TYR n 1 146 PHE n 1 147 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene FHIT _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene FHIT _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain DL41 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX-2T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'EXPRESSED AS FUSION PROTEIN WITH GLUTATHIONE-S-TRANSFERASE IN ESCHERICHIA COLI' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FHIT_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P49789 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTF SMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5FIT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P49789 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 147 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FIT MSE A 82 ? UNP P49789 MET 82 'MODIFIED RESIDUE' 82 1 1 5FIT MSE A 135 ? UNP P49789 MET 135 'MODIFIED RESIDUE' 135 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 AP2 non-polymer . 'PHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' ? 'C11 H17 N5 O9 P2' 425.228 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 5FIT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.91 _exptl_crystal.density_percent_sol 57.79 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'GROWN FROM AMMONIUM SULFATE, PH 6.5' # _diffrn.id 1 _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type CUSTOM-MADE _diffrn_detector.pdbx_collection_date 1996-09-08 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0036 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength 1.0036 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 5FIT _reflns.observed_criterion_sigma_I 2. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 2.3 _reflns.number_obs 17347 _reflns.number_all ? _reflns.percent_possible_obs 95.7 _reflns.pdbx_Rmerge_I_obs 0.0330000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.5 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 5FIT _refine.ls_number_reflns_obs 16087 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2. _refine.pdbx_data_cutoff_high_absF 100000. _refine.pdbx_data_cutoff_low_absF 0.1 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8. _refine.ls_d_res_high 2.3 _refine.ls_percent_reflns_obs 95.9 _refine.ls_R_factor_obs 0.2260000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2260000 _refine.ls_R_factor_R_free 0.2580000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.00 _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 30.3 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1005 _refine_hist.pdbx_number_atoms_nucleic_acid 23 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 54 _refine_hist.number_atoms_total 1082 _refine_hist.d_res_high 2.3 _refine_hist.d_res_low 8. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.02 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 2.10 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 25.60 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.75 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 5FIT _struct.title 'FHIT-SUBSTRATE ANALOG' _struct.pdbx_descriptor 'FRAGILE HISTIDINE TRIAD PROTEIN, PHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5FIT _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;HYDROLASE, FRAGILE HISTIDINE TRIAD PROTEIN, FHIT, PUTATIVE TUMOR SUPPRESSOR, HIT PROTEIN FAMILY, HISTIDINE TRIAD PROTEIN FAMILY, NUCLEOTIDYL HYDROLASE, NUCLEOTIDYL TRANSFERASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 12 ? VAL A 14 ? PRO A 12 VAL A 14 5 ? 3 HELX_P HELX_P2 2 PHE A 47 ? ASP A 49 ? PHE A 47 ASP A 49 5 ? 3 HELX_P HELX_P3 3 PRO A 52 ? HIS A 72 ? PRO A 52 HIS A 72 1 ? 21 HELX_P HELX_P4 4 PRO A 86 ? ALA A 88 ? PRO A 86 ALA A 88 5 ? 3 HELX_P HELX_P5 5 GLU A 132 ? TYR A 145 ? GLU A 132 TYR A 145 5 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 82 N ? ? ? 1_555 A SER 81 C ? ? A MSE 82 A SER 81 1_555 ? ? ? ? ? ? ? 1.319 ? covale2 covale ? ? A MSE 82 C ? ? ? 1_555 A GLN 83 N ? ? A MSE 82 A GLN 83 1_555 ? ? ? ? ? ? ? 1.325 ? covale3 covale ? ? A MSE 135 N ? ? ? 1_555 A GLU 134 C ? ? A MSE 135 A GLU 134 1_555 ? ? ? ? ? ? ? 1.332 ? covale4 covale ? ? A MSE 135 C ? ? ? 1_555 A ALA 136 N ? ? A MSE 135 A ALA 136 1_555 ? ? ? ? ? ? ? 1.321 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 3 ? PHE A 5 ? PHE A 3 PHE A 5 A 2 HIS A 8 ? ILE A 10 ? HIS A 8 ILE A 10 B 1 SER A 77 ? SER A 81 ? SER A 77 SER A 81 B 2 HIS A 96 ? ARG A 102 ? HIS A 96 ARG A 102 B 3 VAL A 36 ? PRO A 40 ? VAL A 36 PRO A 40 B 4 SER A 22 ? VAL A 26 ? SER A 22 VAL A 26 B 5 VAL A 15 ? LYS A 18 ? VAL A 15 LYS A 18 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 3 ? O PHE A 3 N ILE A 10 ? N ILE A 10 B 1 2 O SER A 77 ? O SER A 77 N ARG A 102 ? N ARG A 102 B 2 3 O VAL A 97 ? O VAL A 97 N VAL A 38 ? N VAL A 38 B 3 4 O LEU A 37 ? O LEU A 37 N LEU A 25 ? N LEU A 25 B 4 5 O ALA A 24 ? O ALA A 24 N LEU A 17 ? N LEU A 17 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details HNE Unknown ? ? ? ? 3 'HISTIDINE TRIAD FOR WHICH THIS FAMILY WAS NAMED.' AVE Unknown ? ? ? ? 1 'ACTIVE SITE HISTIDINE RESPONSIBLE FOR FORMING THE TRANSIENT NUCLEOTIDYL PHOSPHOHISTIDYL ENZYME INTERMEDIATE DURING CATALYSIS.' AC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE AP2 A 200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 HNE 3 HIS A 35 ? HIS A 35 . ? 1_555 ? 2 HNE 3 HIS A 96 ? HIS A 96 . ? 1_555 ? 3 HNE 3 HIS A 98 ? HIS A 98 . ? 1_555 ? 4 AVE 1 HIS A 96 ? HIS A 96 . ? 1_555 ? 5 AC1 16 HIS A 8 ? HIS A 8 . ? 1_555 ? 6 AC1 16 LEU A 25 ? LEU A 25 . ? 1_555 ? 7 AC1 16 VAL A 26 ? VAL A 26 . ? 1_555 ? 8 AC1 16 ASN A 27 ? ASN A 27 . ? 1_555 ? 9 AC1 16 ARG A 28 ? ARG A 28 . ? 1_555 ? 10 AC1 16 LYS A 29 ? LYS A 29 . ? 1_555 ? 11 AC1 16 HIS A 35 ? HIS A 35 . ? 1_555 ? 12 AC1 16 LEU A 37 ? LEU A 37 . ? 1_555 ? 13 AC1 16 GLN A 83 ? GLN A 83 . ? 1_555 ? 14 AC1 16 GLY A 89 ? GLY A 89 . ? 1_555 ? 15 AC1 16 THR A 91 ? THR A 91 . ? 1_555 ? 16 AC1 16 VAL A 92 ? VAL A 92 . ? 1_555 ? 17 AC1 16 HIS A 96 ? HIS A 96 . ? 1_555 ? 18 AC1 16 HIS A 98 ? HIS A 98 . ? 1_555 ? 19 AC1 16 HOH C . ? HOH A 249 . ? 1_555 ? 20 AC1 16 HOH C . ? HOH A 254 . ? 1_555 ? # _database_PDB_matrix.entry_id 5FIT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 5FIT _atom_sites.fract_transf_matrix[1][1] 0.019747 _atom_sites.fract_transf_matrix[1][2] 0.011401 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022802 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003738 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 MSE 82 82 82 MSE MSE A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 PHE 107 107 ? ? ? A . n A 1 108 HIS 108 108 ? ? ? A . n A 1 109 ARG 109 109 ? ? ? A . n A 1 110 ASN 110 110 ? ? ? A . n A 1 111 ASP 111 111 ? ? ? A . n A 1 112 SER 112 112 ? ? ? A . n A 1 113 ILE 113 113 ? ? ? A . n A 1 114 TYR 114 114 ? ? ? A . n A 1 115 GLU 115 115 ? ? ? A . n A 1 116 GLU 116 116 ? ? ? A . n A 1 117 LEU 117 117 ? ? ? A . n A 1 118 GLN 118 118 ? ? ? A . n A 1 119 LYS 119 119 ? ? ? A . n A 1 120 HIS 120 120 ? ? ? A . n A 1 121 ASP 121 121 ? ? ? A . n A 1 122 LYS 122 122 ? ? ? A . n A 1 123 GLU 123 123 ? ? ? A . n A 1 124 ASP 124 124 ? ? ? A . n A 1 125 PHE 125 125 ? ? ? A . n A 1 126 PRO 126 126 ? ? ? A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 TRP 129 129 129 TRP TRP A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 MSE 135 135 135 MSE MSE A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 GLN 147 147 147 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AP2 1 200 200 AP2 AP2 A . C 3 HOH 1 201 1 HOH HOH A . C 3 HOH 2 202 2 HOH HOH A . C 3 HOH 3 203 3 HOH HOH A . C 3 HOH 4 204 4 HOH HOH A . C 3 HOH 5 205 5 HOH HOH A . C 3 HOH 6 206 6 HOH HOH A . C 3 HOH 7 207 7 HOH HOH A . C 3 HOH 8 208 8 HOH HOH A . C 3 HOH 9 209 9 HOH HOH A . C 3 HOH 10 210 10 HOH HOH A . C 3 HOH 11 211 11 HOH HOH A . C 3 HOH 12 212 12 HOH HOH A . C 3 HOH 13 213 13 HOH HOH A . C 3 HOH 14 214 14 HOH HOH A . C 3 HOH 15 215 15 HOH HOH A . C 3 HOH 16 216 16 HOH HOH A . C 3 HOH 17 217 17 HOH HOH A . C 3 HOH 18 218 18 HOH HOH A . C 3 HOH 19 219 19 HOH HOH A . C 3 HOH 20 220 20 HOH HOH A . C 3 HOH 21 221 21 HOH HOH A . C 3 HOH 22 222 22 HOH HOH A . C 3 HOH 23 223 23 HOH HOH A . C 3 HOH 24 224 24 HOH HOH A . C 3 HOH 25 225 25 HOH HOH A . C 3 HOH 26 226 26 HOH HOH A . C 3 HOH 27 227 27 HOH HOH A . C 3 HOH 28 228 28 HOH HOH A . C 3 HOH 29 229 29 HOH HOH A . C 3 HOH 30 230 30 HOH HOH A . C 3 HOH 31 231 31 HOH HOH A . C 3 HOH 32 232 32 HOH HOH A . C 3 HOH 33 233 33 HOH HOH A . C 3 HOH 34 234 34 HOH HOH A . C 3 HOH 35 235 35 HOH HOH A . C 3 HOH 36 236 36 HOH HOH A . C 3 HOH 37 237 37 HOH HOH A . C 3 HOH 38 238 38 HOH HOH A . C 3 HOH 39 239 39 HOH HOH A . C 3 HOH 40 240 40 HOH HOH A . C 3 HOH 41 241 41 HOH HOH A . C 3 HOH 42 242 42 HOH HOH A . C 3 HOH 43 243 43 HOH HOH A . C 3 HOH 44 244 44 HOH HOH A . C 3 HOH 45 245 45 HOH HOH A . C 3 HOH 46 246 46 HOH HOH A . C 3 HOH 47 247 47 HOH HOH A . C 3 HOH 48 248 48 HOH HOH A . C 3 HOH 49 249 49 HOH HOH A . C 3 HOH 50 250 50 HOH HOH A . C 3 HOH 51 251 51 HOH HOH A . C 3 HOH 52 252 52 HOH HOH A . C 3 HOH 53 253 53 HOH HOH A . C 3 HOH 54 254 54 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 82 A MSE 82 ? MET SELENOMETHIONINE 2 A MSE 135 A MSE 135 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_555 x,x-y,-z+1/6 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 44.5866666667 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-03-25 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 MADNES 'data reduction' . ? 3 XDS 'data scaling' . ? 4 SCALEPACK 'data scaling' . ? 5 X-PLOR phasing 3.1 ? 6 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A CYS 39 ? ? SG A CYS 39 ? ? 1.707 1.812 -0.105 0.016 N 2 1 SE A MSE 82 ? ? CE A MSE 82 ? ? 1.576 1.950 -0.374 0.059 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 19 ? ? -106.83 -164.94 2 1 THR A 91 ? ? -90.45 -61.99 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A AP2 200 ? PB ? B AP2 1 PB 2 1 N 1 A AP2 200 ? O1B ? B AP2 1 O1B 3 1 N 1 A AP2 200 ? O2B ? B AP2 1 O2B 4 1 N 1 A AP2 200 ? O3B ? B AP2 1 O3B # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PHE 107 ? A PHE 107 3 1 Y 1 A HIS 108 ? A HIS 108 4 1 Y 1 A ARG 109 ? A ARG 109 5 1 Y 1 A ASN 110 ? A ASN 110 6 1 Y 1 A ASP 111 ? A ASP 111 7 1 Y 1 A SER 112 ? A SER 112 8 1 Y 1 A ILE 113 ? A ILE 113 9 1 Y 1 A TYR 114 ? A TYR 114 10 1 Y 1 A GLU 115 ? A GLU 115 11 1 Y 1 A GLU 116 ? A GLU 116 12 1 Y 1 A LEU 117 ? A LEU 117 13 1 Y 1 A GLN 118 ? A GLN 118 14 1 Y 1 A LYS 119 ? A LYS 119 15 1 Y 1 A HIS 120 ? A HIS 120 16 1 Y 1 A ASP 121 ? A ASP 121 17 1 Y 1 A LYS 122 ? A LYS 122 18 1 Y 1 A GLU 123 ? A GLU 123 19 1 Y 1 A ASP 124 ? A ASP 124 20 1 Y 1 A PHE 125 ? A PHE 125 21 1 Y 1 A PRO 126 ? A PRO 126 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' AP2 3 water HOH #