data_5FOR # _entry.id 5FOR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5FOR PDBE EBI-65637 WWPDB D_1290065637 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 5FOR _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2015-11-25 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Halabi, S.' 1 'Gay, N.J.' 2 'Moncrieffe, M.C.' 3 # _citation.id primary _citation.title ;Structure of the Toll/Interleukin-1 Receptor (TIR) Domain of the B-cell Adaptor That Links Phosphoinositide Metabolism with the Negative Regulation of the Toll-like Receptor (TLR) Signalosome. ; _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_volume 292 _citation.page_first 652 _citation.page_last 660 _citation.year 2017 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 1083-351X _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27909057 _citation.pdbx_database_id_DOI 10.1074/jbc.M116.761528 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Halabi, S.' 1 primary 'Sekine, E.' 2 primary 'Verstak, B.' 3 primary 'Gay, N.J.' 4 primary 'Moncrieffe, M.C.' 5 # _cell.entry_id 5FOR _cell.length_a 135.042 _cell.length_b 135.042 _cell.length_c 42.912 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FOR _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PHOSPHOINOSITIDE 3-KINASE ADAPTER PROTEIN 1' 16023.324 1 ? ? 'TIR DOMAIN, RESIDUES 7-142' ? 2 non-polymer syn 'PENTAETHYLENE GLYCOL' 238.278 1 ? ? ? ? 3 non-polymer syn '5-amino-2,4,6-triiodobenzene-1,3-dicarboxylic acid' 558.835 1 ? ? ? ? 4 water nat water 18.015 20 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;B-CELL ADAPTER FOR PHOSPHOINOSITIDE 3-KINASE, B-CELL PHOSPHOINOSITIDE 3-KINASE ADAPTER PROTEIN 1, B CELL ADAPTOR FOR PHOSPHOINOSITIDE 3-KINASE, BCAP ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNAPRGCDILIVYSPDAEEWCQYLQTLFLSSRQVRSQ(MLY)ILTHRLGPEASFSAEDLSLFLSTRCVVVLLSAELVQHF H(MLY)PSLLPLLQRAFHPPHRVVRLLCGVRDSEEFLDFFPDWAHWQELTCDDEPETYVAAVK(MLY)AIS ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAPRGCDILIVYSPDAEEWCQYLQTLFLSSRQVRSQKILTHRLGPEASFSAEDLSLFLSTRCVVVLLSAELVQHFHKPS LLPLLQRAFHPPHRVVRLLCGVRDSEEFLDFFPDWAHWQELTCDDEPETYVAAVKKAIS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 PRO n 1 5 ARG n 1 6 GLY n 1 7 CYS n 1 8 ASP n 1 9 ILE n 1 10 LEU n 1 11 ILE n 1 12 VAL n 1 13 TYR n 1 14 SER n 1 15 PRO n 1 16 ASP n 1 17 ALA n 1 18 GLU n 1 19 GLU n 1 20 TRP n 1 21 CYS n 1 22 GLN n 1 23 TYR n 1 24 LEU n 1 25 GLN n 1 26 THR n 1 27 LEU n 1 28 PHE n 1 29 LEU n 1 30 SER n 1 31 SER n 1 32 ARG n 1 33 GLN n 1 34 VAL n 1 35 ARG n 1 36 SER n 1 37 GLN n 1 38 MLY n 1 39 ILE n 1 40 LEU n 1 41 THR n 1 42 HIS n 1 43 ARG n 1 44 LEU n 1 45 GLY n 1 46 PRO n 1 47 GLU n 1 48 ALA n 1 49 SER n 1 50 PHE n 1 51 SER n 1 52 ALA n 1 53 GLU n 1 54 ASP n 1 55 LEU n 1 56 SER n 1 57 LEU n 1 58 PHE n 1 59 LEU n 1 60 SER n 1 61 THR n 1 62 ARG n 1 63 CYS n 1 64 VAL n 1 65 VAL n 1 66 VAL n 1 67 LEU n 1 68 LEU n 1 69 SER n 1 70 ALA n 1 71 GLU n 1 72 LEU n 1 73 VAL n 1 74 GLN n 1 75 HIS n 1 76 PHE n 1 77 HIS n 1 78 MLY n 1 79 PRO n 1 80 SER n 1 81 LEU n 1 82 LEU n 1 83 PRO n 1 84 LEU n 1 85 LEU n 1 86 GLN n 1 87 ARG n 1 88 ALA n 1 89 PHE n 1 90 HIS n 1 91 PRO n 1 92 PRO n 1 93 HIS n 1 94 ARG n 1 95 VAL n 1 96 VAL n 1 97 ARG n 1 98 LEU n 1 99 LEU n 1 100 CYS n 1 101 GLY n 1 102 VAL n 1 103 ARG n 1 104 ASP n 1 105 SER n 1 106 GLU n 1 107 GLU n 1 108 PHE n 1 109 LEU n 1 110 ASP n 1 111 PHE n 1 112 PHE n 1 113 PRO n 1 114 ASP n 1 115 TRP n 1 116 ALA n 1 117 HIS n 1 118 TRP n 1 119 GLN n 1 120 GLU n 1 121 LEU n 1 122 THR n 1 123 CYS n 1 124 ASP n 1 125 ASP n 1 126 GLU n 1 127 PRO n 1 128 GLU n 1 129 THR n 1 130 TYR n 1 131 VAL n 1 132 ALA n 1 133 ALA n 1 134 VAL n 1 135 LYS n 1 136 MLY n 1 137 ALA n 1 138 ILE n 1 139 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PMCSG7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BCAP_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q6ZUJ8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5FOR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 139 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6ZUJ8 _struct_ref_seq.db_align_beg 7 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 142 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 139 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FOR SER A 1 ? UNP Q6ZUJ8 ? ? 'expression tag' 1 1 1 5FOR ASN A 2 ? UNP Q6ZUJ8 ? ? 'expression tag' 2 2 1 5FOR ALA A 3 ? UNP Q6ZUJ8 ? ? 'expression tag' 3 3 1 5FOR SER A 80 ? UNP Q6ZUJ8 ALA 83 conflict 80 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1PE non-polymer . 'PENTAETHYLENE GLYCOL' PEG400 'C10 H22 O6' 238.278 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 I3C non-polymer . '5-amino-2,4,6-triiodobenzene-1,3-dicarboxylic acid' '5-Amino-2,4,6-triiodoisophthalic acid' 'C8 H4 I3 N O4' 558.835 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MLY 'L-peptide linking' n N-DIMETHYL-LYSINE ? 'C8 H18 N2 O2' 174.241 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 5FOR _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.6 _exptl_crystal.density_percent_sol 66 _exptl_crystal.description NONE _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.1 M MES PH 6.5 1-10% PEG400 1.5-2.3 M AMMONIUM SULPHATE .001M I3C' # _diffrn.id 1 _diffrn.ambient_temp 77 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2015-02-05 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 2.2 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_wavelength 2.2 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 5FOR _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 44.00 _reflns.d_resolution_high 2.50 _reflns.number_obs 15066 _reflns.number_all ? _reflns.percent_possible_obs 99.0 _reflns.pdbx_Rmerge_I_obs 0.05 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 25.00 _reflns.B_iso_Wilson_estimate 53.84 _reflns.pdbx_redundancy 6.6 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.percent_possible_all 98.0 _reflns_shell.Rmerge_I_obs 0.24 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 7.20 _reflns_shell.pdbx_redundancy 6.6 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5FOR _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 15066 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 44.203 _refine.ls_d_res_high 2.500 _refine.ls_percent_reflns_obs 99.34 _refine.ls_R_factor_obs 0.1907 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1878 _refine.ls_R_factor_R_free 0.2441 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.2 _refine.ls_number_reflns_R_free 785 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 59.7 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.35 _refine.pdbx_overall_phase_error 25.73 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1072 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 20 _refine_hist.number_atoms_total 1124 _refine_hist.d_res_high 2.500 _refine_hist.d_res_low 44.203 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.012 ? ? 1152 'X-RAY DIFFRACTION' ? f_angle_d 1.593 ? ? 1572 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 20.586 ? ? 419 'X-RAY DIFFRACTION' ? f_chiral_restr 0.066 ? ? 173 'X-RAY DIFFRACTION' ? f_plane_restr 0.009 ? ? 200 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.5002 2.6568 2365 0.2408 99.00 0.3153 . . 121 . . 'X-RAY DIFFRACTION' . 2.6568 2.8619 2346 0.2288 98.00 0.3215 . . 148 . . 'X-RAY DIFFRACTION' . 2.8619 3.1499 2391 0.2293 100.00 0.2401 . . 117 . . 'X-RAY DIFFRACTION' . 3.1499 3.6055 2368 0.2014 100.00 0.2477 . . 144 . . 'X-RAY DIFFRACTION' . 3.6055 4.5418 2376 0.1616 100.00 0.2205 . . 152 . . 'X-RAY DIFFRACTION' . 4.5418 44.2098 2435 0.1731 100.00 0.2346 . . 103 . . # _struct.entry_id 5FOR _struct.title 'Cryptic TIR' _struct.pdbx_descriptor 'PHOSPHOINOSITIDE 3-KINASE ADAPTER PROTEIN 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5FOR _struct_keywords.pdbx_keywords 'CELL CYCLE' _struct_keywords.text 'CELL CYCLE, TIR, IMMUME RESPONSE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 14 ? ASP A 16 ? SER A 14 ASP A 16 5 ? 3 HELX_P HELX_P2 2 ALA A 17 ? SER A 31 ? ALA A 17 SER A 31 1 ? 15 HELX_P HELX_P3 3 SER A 51 ? THR A 61 ? SER A 51 THR A 61 1 ? 11 HELX_P HELX_P4 4 SER A 69 ? HIS A 77 ? SER A 69 HIS A 77 1 ? 9 HELX_P HELX_P5 5 LEU A 81 ? PHE A 89 ? LEU A 81 PHE A 89 1 ? 9 HELX_P HELX_P6 6 PRO A 91 ? HIS A 93 ? PRO A 91 HIS A 93 5 ? 3 HELX_P HELX_P7 7 SER A 105 ? PHE A 111 ? SER A 105 PHE A 111 5 ? 7 HELX_P HELX_P8 8 ASP A 114 ? TRP A 118 ? ASP A 114 TRP A 118 5 ? 5 HELX_P HELX_P9 9 GLU A 126 ? SER A 139 ? GLU A 126 SER A 139 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A GLN 37 C ? ? ? 1_555 A MLY 38 N ? ? A GLN 37 A MLY 38 1_555 ? ? ? ? ? ? ? 1.332 ? covale2 covale ? ? A MLY 38 C ? ? ? 1_555 A ILE 39 N ? ? A MLY 38 A ILE 39 1_555 ? ? ? ? ? ? ? 1.330 ? covale3 covale ? ? A HIS 77 C ? ? ? 1_555 A MLY 78 N ? ? A HIS 77 A MLY 78 1_555 ? ? ? ? ? ? ? 1.331 ? covale4 covale ? ? A MLY 78 C ? ? ? 1_555 A PRO 79 N ? ? A MLY 78 A PRO 79 1_555 ? ? ? ? ? ? ? 1.345 ? covale5 covale ? ? A LYS 135 C ? ? ? 1_555 A MLY 136 N ? ? A LYS 135 A MLY 136 1_555 ? ? ? ? ? ? ? 1.331 ? covale6 covale ? ? A MLY 136 C ? ? ? 1_555 A ALA 137 N ? ? A MLY 136 A ALA 137 1_555 ? ? ? ? ? ? ? 1.328 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 6 A . ? GLY 6 A CYS 7 A ? CYS 7 A 1 5.73 2 GLY 45 A . ? GLY 45 A PRO 46 A ? PRO 46 A 1 -9.29 3 HIS 90 A . ? HIS 90 A PRO 91 A ? PRO 91 A 1 -7.61 # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AA 2 3 ? parallel AA 3 4 ? parallel AA 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ILE A 39 ? ARG A 43 ? ILE A 39 ARG A 43 AA 2 ILE A 9 ? TYR A 13 ? ILE A 9 TYR A 13 AA 3 CYS A 63 ? LEU A 68 ? CYS A 63 LEU A 68 AA 4 VAL A 95 ? LEU A 99 ? VAL A 95 LEU A 99 AA 5 GLN A 119 ? LEU A 121 ? GLN A 119 LEU A 121 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N LEU A 40 ? N LEU A 40 O ILE A 9 ? O ILE A 9 AA 2 3 N LEU A 10 ? N LEU A 10 O CYS A 63 ? O CYS A 63 AA 3 4 N VAL A 66 ? N VAL A 66 O VAL A 96 ? O VAL A 96 AA 4 5 N ARG A 97 ? N ARG A 97 O GLN A 119 ? O GLN A 119 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE 1PE A 1140' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE I3C A 1141' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 GLU A 19 ? GLU A 19 . ? 1_555 ? 2 AC1 7 TRP A 20 ? TRP A 20 . ? 1_555 ? 3 AC1 7 TYR A 23 ? TYR A 23 . ? 1_555 ? 4 AC1 7 ARG A 103 ? ARG A 103 . ? 10_664 ? 5 AC1 7 GLU A 107 ? GLU A 107 . ? 10_664 ? 6 AC1 7 PHE A 108 ? PHE A 108 . ? 10_664 ? 7 AC1 7 HOH D . ? HOH A 2014 . ? 10_664 ? 8 AC2 6 LEU A 27 ? LEU A 27 . ? 1_555 ? 9 AC2 6 SER A 30 ? SER A 30 . ? 1_555 ? 10 AC2 6 SER A 31 ? SER A 31 . ? 1_555 ? 11 AC2 6 GLN A 33 ? GLN A 33 . ? 1_555 ? 12 AC2 6 VAL A 131 ? VAL A 131 . ? 1_555 ? 13 AC2 6 HOH D . ? HOH A 2005 . ? 1_555 ? # _database_PDB_matrix.entry_id 5FOR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 5FOR _atom_sites.fract_transf_matrix[1][1] 0.007405 _atom_sites.fract_transf_matrix[1][2] 0.004275 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008551 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023304 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C I N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 ARG 5 5 ? ? ? A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 MLY 38 38 38 MLY MLY A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 MLY 78 78 78 MLY MLY A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 CYS 100 100 100 CYS CYS A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 TRP 118 118 118 TRP TRP A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 CYS 123 123 123 CYS CYS A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 MLY 136 136 136 MLY MLY A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 SER 139 139 139 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 1PE 1 1140 1140 1PE 1PE A . C 3 I3C 1 1141 1141 I3C I3C A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MLY 38 A MLY 38 ? LYS N-DIMETHYL-LYSINE 2 A MLY 78 A MLY 78 ? LYS N-DIMETHYL-LYSINE 3 A MLY 136 A MLY 136 ? LYS N-DIMETHYL-LYSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-12-07 2 'Structure model' 1 1 2016-12-14 3 'Structure model' 1 2 2017-03-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 86.3123 19.5105 8.2347 0.5824 0.4896 0.3825 -0.1352 -0.0632 0.0697 0.6265 0.7389 0.4777 -0.0265 0.3187 -0.1918 0.2988 -0.3877 -0.1775 0.4465 -0.2204 -0.3400 -0.2223 -0.0572 -0.0007 'X-RAY DIFFRACTION' 2 ? refined 83.9809 11.7095 -2.8267 0.3606 0.2645 0.4805 -0.0099 0.0637 0.0777 2.3107 1.1519 1.1012 0.2584 1.4905 -0.3508 0.0795 0.0211 -0.6481 -0.3264 -0.0605 0.0046 -0.0886 0.0066 -0.0519 'X-RAY DIFFRACTION' 3 ? refined 75.6949 20.3848 -2.0165 0.3966 0.4521 0.3921 -0.0082 0.0149 -0.0117 1.6186 1.1609 0.5811 0.2598 0.6502 -0.5456 0.1733 -0.1357 -0.1942 -0.3401 -0.2215 0.0226 -0.5789 -0.4854 -0.0000 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;CHAIN 'A' AND (RESID 6 THROUGH 43 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;CHAIN 'A' AND (RESID 44 THROUGH 105 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;CHAIN 'A' AND (RESID 106 THROUGH 139 ) ; # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language PHENIX refinement '(PHENIX.REFINE)' ? 1 ? ? ? ? XDS 'data reduction' . ? 2 ? ? ? ? Aimless 'data scaling' . ? 3 ? ? ? ? SHELX phasing . ? 4 ? ? ? ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NE2 A GLN 33 ? ? O8 A I3C 1141 ? ? 1.31 2 1 OD1 A ASP 124 ? A O A HOH 2018 ? ? 2.05 3 1 OE1 A GLU 18 ? ? NH2 A ARG 43 ? ? 2.08 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE2 A GLU 107 ? ? 1_555 OH2 A 1PE 1140 ? ? 10_664 1.27 2 1 CD A GLU 107 ? ? 1_555 OH2 A 1PE 1140 ? ? 10_664 1.98 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLN _pdbx_validate_rmsd_angle.auth_seq_id_1 119 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLN _pdbx_validate_rmsd_angle.auth_seq_id_2 119 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLN _pdbx_validate_rmsd_angle.auth_seq_id_3 119 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 130.44 _pdbx_validate_rmsd_angle.angle_target_value 113.40 _pdbx_validate_rmsd_angle.angle_deviation 17.04 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 49 ? ? -101.65 -169.33 2 1 CYS A 100 ? ? -108.77 78.56 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id GLN _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 119 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.071 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 32 ? CG ? A ARG 32 CG 2 1 Y 1 A ARG 32 ? CD ? A ARG 32 CD 3 1 Y 1 A ARG 32 ? NE ? A ARG 32 NE 4 1 Y 1 A ARG 32 ? CZ ? A ARG 32 CZ 5 1 Y 1 A ARG 32 ? NH1 ? A ARG 32 NH1 6 1 Y 1 A ARG 32 ? NH2 ? A ARG 32 NH2 7 1 Y 1 A SER 49 ? OG ? A SER 49 OG 8 1 Y 1 A PHE 50 ? CG ? A PHE 50 CG 9 1 Y 1 A PHE 50 ? CD1 ? A PHE 50 CD1 10 1 Y 1 A PHE 50 ? CD2 ? A PHE 50 CD2 11 1 Y 1 A PHE 50 ? CE1 ? A PHE 50 CE1 12 1 Y 1 A PHE 50 ? CE2 ? A PHE 50 CE2 13 1 Y 1 A PHE 50 ? CZ ? A PHE 50 CZ 14 1 Y 1 A SER 51 ? OG ? A SER 51 OG 15 1 Y 1 A GLU 53 ? CG ? A GLU 53 CG 16 1 Y 1 A GLU 53 ? CD ? A GLU 53 CD 17 1 Y 1 A GLU 53 ? OE1 ? A GLU 53 OE1 18 1 Y 1 A GLU 53 ? OE2 ? A GLU 53 OE2 19 1 Y 1 A LEU 57 ? CG ? A LEU 57 CG 20 1 Y 1 A LEU 57 ? CD1 ? A LEU 57 CD1 21 1 Y 1 A LEU 57 ? CD2 ? A LEU 57 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A ARG 5 ? A ARG 5 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PENTAETHYLENE GLYCOL' 1PE 3 '5-amino-2,4,6-triiodobenzene-1,3-dicarboxylic acid' I3C 4 water HOH #