data_5FRH # _entry.id 5FRH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5FRH pdb_00005frh 10.2210/pdb5frh/pdb PDBE EBI-65754 ? ? WWPDB D_1290065754 ? ? BMRB 25956 ? ? # _pdbx_database_related.db_id 25956 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 5FRH _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2015-12-17 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zdanowski, K.' 1 'Pecqueur, L.' 2 'Werner, J.' 3 'Potts, J.R.' 4 'Kleanthous, C.' 5 # _citation.id primary _citation.title 'The Anti-Sigma Factor Rsra Responds to Oxidative Stress by Reburying its Hydrophobic Core.' _citation.journal_abbrev Nat.Commun. _citation.journal_volume 7 _citation.page_first 12194 _citation.page_last ? _citation.year 2016 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2041-1723 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27432510 _citation.pdbx_database_id_DOI 10.1038/NCOMMS12194 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rajasekar, K.V.' 1 ? primary 'Zdanowski, K.' 2 ? primary 'Yan, J.' 3 ? primary 'Hopper, J.T.' 4 ? primary 'Francis, M.L.' 5 ? primary 'Seepersad, C.' 6 ? primary 'Sharp, C.' 7 ? primary 'Pecqueur, L.' 8 ? primary 'Werner, J.M.' 9 ? primary 'Robinson, C.V.' 10 ? primary 'Mohammed, S.' 11 ? primary 'Potts, J.R.' 12 ? primary 'Kleanthous, C.' 13 ? # _cell.entry_id 5FRH _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FRH _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ANTI-SIGMA FACTOR RSRA' _entity.formula_weight 11835.058 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation YES _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'REGULATOR OF SIGR, SIGMA-R ANTI-SIGMA FACTOR RSRA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMSAGEPHETDCSEILDHLYEFLDKEMPDSDAVKFEHHFEESSPCLEKYGLEQAVKKLVKRAAGQDDVPGDLRAKVMG RLDLIRSGQSVPEHDVAAAPSSSAPQES ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMSAGEPHETDCSEILDHLYEFLDKEMPDSDAVKFEHHFEESSPCLEKYGLEQAVKKLVKRAAGQDDVPGDLRAKVMG RLDLIRSGQSVPEHDVAAAPSSSAPQES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 ALA n 1 7 GLY n 1 8 GLU n 1 9 PRO n 1 10 HIS n 1 11 GLU n 1 12 THR n 1 13 ASP n 1 14 CYS n 1 15 SER n 1 16 GLU n 1 17 ILE n 1 18 LEU n 1 19 ASP n 1 20 HIS n 1 21 LEU n 1 22 TYR n 1 23 GLU n 1 24 PHE n 1 25 LEU n 1 26 ASP n 1 27 LYS n 1 28 GLU n 1 29 MET n 1 30 PRO n 1 31 ASP n 1 32 SER n 1 33 ASP n 1 34 ALA n 1 35 VAL n 1 36 LYS n 1 37 PHE n 1 38 GLU n 1 39 HIS n 1 40 HIS n 1 41 PHE n 1 42 GLU n 1 43 GLU n 1 44 SER n 1 45 SER n 1 46 PRO n 1 47 CYS n 1 48 LEU n 1 49 GLU n 1 50 LYS n 1 51 TYR n 1 52 GLY n 1 53 LEU n 1 54 GLU n 1 55 GLN n 1 56 ALA n 1 57 VAL n 1 58 LYS n 1 59 LYS n 1 60 LEU n 1 61 VAL n 1 62 LYS n 1 63 ARG n 1 64 ALA n 1 65 ALA n 1 66 GLY n 1 67 GLN n 1 68 ASP n 1 69 ASP n 1 70 VAL n 1 71 PRO n 1 72 GLY n 1 73 ASP n 1 74 LEU n 1 75 ARG n 1 76 ALA n 1 77 LYS n 1 78 VAL n 1 79 MET n 1 80 GLY n 1 81 ARG n 1 82 LEU n 1 83 ASP n 1 84 LEU n 1 85 ILE n 1 86 ARG n 1 87 SER n 1 88 GLY n 1 89 GLN n 1 90 SER n 1 91 VAL n 1 92 PRO n 1 93 GLU n 1 94 HIS n 1 95 ASP n 1 96 VAL n 1 97 ALA n 1 98 ALA n 1 99 ALA n 1 100 PRO n 1 101 SER n 1 102 SER n 1 103 SER n 1 104 ALA n 1 105 PRO n 1 106 GLN n 1 107 GLU n 1 108 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'STREPTOMYCES COELICOLOR' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1902 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant PLYSS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RSRA_STRCO _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q7AKG8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5FRH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7AKG8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FRH GLY A 1 ? UNP Q7AKG8 ? ? 'expression tag' -2 1 1 5FRH SER A 2 ? UNP Q7AKG8 ? ? 'expression tag' -1 2 1 5FRH HIS A 3 ? UNP Q7AKG8 ? ? 'expression tag' 0 3 1 5FRH ALA A 6 ? UNP Q7AKG8 CYS 3 'engineered mutation' 3 4 1 5FRH ALA A 34 ? UNP Q7AKG8 CYS 31 'engineered mutation' 31 5 1 5FRH SER A 44 ? UNP Q7AKG8 CYS 41 'engineered mutation' 41 6 1 5FRH ALA A 64 ? UNP Q7AKG8 CYS 61 'engineered mutation' 61 7 1 5FRH ALA A 65 ? UNP Q7AKG8 CYS 62 'engineered mutation' 62 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 'TOCSY (2D' 1 3 1 '3D)' 1 4 1 HNCA 1 5 1 HNCO 1 6 1 CBCANH 1 7 1 'CBCA(CO)NH' 1 8 1 'HN(CA)CO' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 7.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '5% D2O/(5% WATER' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 # _pdbx_nmr_details.entry_id 5FRH _pdbx_nmr_details.text NONE # _pdbx_nmr_ensemble.entry_id 5FRH _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-KUNSTLEVE, JIANG,KUSZEWSKI,NILGES,PANNU,READ,RICE,SIMONSON, WARREN' 1 'structure solution' 'CcpNmr Analysis' ? ? 2 # _exptl.entry_id 5FRH _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 5FRH _struct.title 'Solution structure of oxidised RsrA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5FRH _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'TRANSCRIPTION, ANTI-SIGMA FACTOR, STREPTOMYCES COELICOLOR, REDOX SENSING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 14 ? LYS A 27 ? CYS A 11 LYS A 24 1 ? 14 HELX_P HELX_P2 2 ASP A 33 ? SER A 44 ? ASP A 30 SER A 41 1 ? 12 HELX_P HELX_P3 3 SER A 45 ? LEU A 48 ? SER A 42 LEU A 45 5 ? 4 HELX_P HELX_P4 4 LEU A 53 ? ALA A 64 ? LEU A 50 ALA A 61 1 ? 12 HELX_P HELX_P5 5 LEU A 74 ? ARG A 86 ? LEU A 71 ARG A 83 1 ? 13 HELX_P HELX_P6 6 GLU A 93 ? ALA A 99 ? GLU A 90 ALA A 96 5 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 14 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 47 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 11 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 44 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.035 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 5FRH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 5FRH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 -2 GLY GLY A . n A 1 2 SER 2 -1 -1 SER SER A . n A 1 3 HIS 3 0 0 HIS HIS A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 ALA 6 3 3 ALA ALA A . n A 1 7 GLY 7 4 4 GLY GLY A . n A 1 8 GLU 8 5 5 GLU GLU A . n A 1 9 PRO 9 6 6 PRO PRO A . n A 1 10 HIS 10 7 7 HIS HIS A . n A 1 11 GLU 11 8 8 GLU GLU A . n A 1 12 THR 12 9 9 THR THR A . n A 1 13 ASP 13 10 10 ASP ASP A . n A 1 14 CYS 14 11 11 CYS CYS A . n A 1 15 SER 15 12 12 SER SER A . n A 1 16 GLU 16 13 13 GLU GLU A . n A 1 17 ILE 17 14 14 ILE ILE A . n A 1 18 LEU 18 15 15 LEU LEU A . n A 1 19 ASP 19 16 16 ASP ASP A . n A 1 20 HIS 20 17 17 HIS HIS A . n A 1 21 LEU 21 18 18 LEU LEU A . n A 1 22 TYR 22 19 19 TYR TYR A . n A 1 23 GLU 23 20 20 GLU GLU A . n A 1 24 PHE 24 21 21 PHE PHE A . n A 1 25 LEU 25 22 22 LEU LEU A . n A 1 26 ASP 26 23 23 ASP ASP A . n A 1 27 LYS 27 24 24 LYS LYS A . n A 1 28 GLU 28 25 25 GLU GLU A . n A 1 29 MET 29 26 26 MET MET A . n A 1 30 PRO 30 27 27 PRO PRO A . n A 1 31 ASP 31 28 28 ASP ASP A . n A 1 32 SER 32 29 29 SER SER A . n A 1 33 ASP 33 30 30 ASP ASP A . n A 1 34 ALA 34 31 31 ALA ALA A . n A 1 35 VAL 35 32 32 VAL VAL A . n A 1 36 LYS 36 33 33 LYS LYS A . n A 1 37 PHE 37 34 34 PHE PHE A . n A 1 38 GLU 38 35 35 GLU GLU A . n A 1 39 HIS 39 36 36 HIS HIS A . n A 1 40 HIS 40 37 37 HIS HIS A . n A 1 41 PHE 41 38 38 PHE PHE A . n A 1 42 GLU 42 39 39 GLU GLU A . n A 1 43 GLU 43 40 40 GLU GLU A . n A 1 44 SER 44 41 41 SER SER A . n A 1 45 SER 45 42 42 SER SER A . n A 1 46 PRO 46 43 43 PRO PRO A . n A 1 47 CYS 47 44 44 CYS CYS A . n A 1 48 LEU 48 45 45 LEU LEU A . n A 1 49 GLU 49 46 46 GLU GLU A . n A 1 50 LYS 50 47 47 LYS LYS A . n A 1 51 TYR 51 48 48 TYR TYR A . n A 1 52 GLY 52 49 49 GLY GLY A . n A 1 53 LEU 53 50 50 LEU LEU A . n A 1 54 GLU 54 51 51 GLU GLU A . n A 1 55 GLN 55 52 52 GLN GLN A . n A 1 56 ALA 56 53 53 ALA ALA A . n A 1 57 VAL 57 54 54 VAL VAL A . n A 1 58 LYS 58 55 55 LYS LYS A . n A 1 59 LYS 59 56 56 LYS LYS A . n A 1 60 LEU 60 57 57 LEU LEU A . n A 1 61 VAL 61 58 58 VAL VAL A . n A 1 62 LYS 62 59 59 LYS LYS A . n A 1 63 ARG 63 60 60 ARG ARG A . n A 1 64 ALA 64 61 61 ALA ALA A . n A 1 65 ALA 65 62 62 ALA ALA A . n A 1 66 GLY 66 63 63 GLY GLY A . n A 1 67 GLN 67 64 64 GLN GLN A . n A 1 68 ASP 68 65 65 ASP ASP A . n A 1 69 ASP 69 66 66 ASP ASP A . n A 1 70 VAL 70 67 67 VAL VAL A . n A 1 71 PRO 71 68 68 PRO PRO A . n A 1 72 GLY 72 69 69 GLY GLY A . n A 1 73 ASP 73 70 70 ASP ASP A . n A 1 74 LEU 74 71 71 LEU LEU A . n A 1 75 ARG 75 72 72 ARG ARG A . n A 1 76 ALA 76 73 73 ALA ALA A . n A 1 77 LYS 77 74 74 LYS LYS A . n A 1 78 VAL 78 75 75 VAL VAL A . n A 1 79 MET 79 76 76 MET MET A . n A 1 80 GLY 80 77 77 GLY GLY A . n A 1 81 ARG 81 78 78 ARG ARG A . n A 1 82 LEU 82 79 79 LEU LEU A . n A 1 83 ASP 83 80 80 ASP ASP A . n A 1 84 LEU 84 81 81 LEU LEU A . n A 1 85 ILE 85 82 82 ILE ILE A . n A 1 86 ARG 86 83 83 ARG ARG A . n A 1 87 SER 87 84 84 SER SER A . n A 1 88 GLY 88 85 85 GLY GLY A . n A 1 89 GLN 89 86 86 GLN GLN A . n A 1 90 SER 90 87 87 SER SER A . n A 1 91 VAL 91 88 88 VAL VAL A . n A 1 92 PRO 92 89 89 PRO PRO A . n A 1 93 GLU 93 90 90 GLU GLU A . n A 1 94 HIS 94 91 91 HIS HIS A . n A 1 95 ASP 95 92 92 ASP ASP A . n A 1 96 VAL 96 93 93 VAL VAL A . n A 1 97 ALA 97 94 94 ALA ALA A . n A 1 98 ALA 98 95 95 ALA ALA A . n A 1 99 ALA 99 96 96 ALA ALA A . n A 1 100 PRO 100 97 97 PRO PRO A . n A 1 101 SER 101 98 98 SER SER A . n A 1 102 SER 102 99 99 SER SER A . n A 1 103 SER 103 100 100 SER SER A . n A 1 104 ALA 104 101 101 ALA ALA A . n A 1 105 PRO 105 102 102 PRO PRO A . n A 1 106 GLN 106 103 103 GLN GLN A . n A 1 107 GLU 107 104 104 GLU GLU A . n A 1 108 SER 108 105 105 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-08-03 2 'Structure model' 2 0 2019-10-23 3 'Structure model' 2 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' Other 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.Cartn_x' 2 2 'Structure model' '_atom_site.Cartn_y' 3 2 'Structure model' '_atom_site.Cartn_z' 4 2 'Structure model' '_pdbx_database_status.status_code_cs' 5 2 'Structure model' '_pdbx_database_status.status_code_mr' 6 2 'Structure model' '_pdbx_nmr_software.name' 7 2 'Structure model' '_pdbx_nmr_spectrometer.model' 8 3 'Structure model' '_database_2.pdbx_DOI' 9 3 'Structure model' '_database_2.pdbx_database_accession' 10 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_entry_details.entry_id 5FRH _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;COMPARED TO THE SEQUENCE CORRESPONDING TO THIS SEQUENCE ACCESSION NUMBER THERE ARE THREE N-TERMINAL NON-NATIVE RESIDUES AND FIVE MUTATIONS (AS STATED ABOVE) IN THE SUBMITTED PDB FILES. ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ARG 78 ? ? H A ILE 82 ? ? 1.43 2 1 O A LEU 79 ? ? H A ARG 83 ? ? 1.55 3 1 O A HIS 17 ? ? H A PHE 21 ? ? 1.59 4 2 O A LEU 50 ? ? H A VAL 54 ? ? 1.40 5 2 O A ARG 72 ? ? H A MET 76 ? ? 1.45 6 2 O A ARG 78 ? ? H A ILE 82 ? ? 1.55 7 2 O A LEU 71 ? ? H A VAL 75 ? ? 1.59 8 3 O A ARG 72 ? ? H A MET 76 ? ? 1.55 9 4 O A LEU 50 ? ? H A VAL 54 ? ? 1.45 10 4 O A ARG 78 ? ? H A ILE 82 ? ? 1.58 11 5 O A ARG 72 ? ? H A MET 76 ? ? 1.55 12 6 O A HIS 17 ? ? H A PHE 21 ? ? 1.52 13 6 O A ARG 72 ? ? H A MET 76 ? ? 1.57 14 7 O A HIS 17 ? ? H A PHE 21 ? ? 1.57 15 8 O A ASP 65 ? ? H A VAL 67 ? ? 1.53 16 8 O A HIS 17 ? ? H A PHE 21 ? ? 1.57 17 8 O A SER 12 ? ? H A ASP 16 ? ? 1.58 18 9 O A LEU 79 ? ? H A ARG 83 ? ? 1.56 19 9 O A ARG 72 ? ? H A MET 76 ? ? 1.58 20 10 O A ARG 78 ? ? H A ILE 82 ? ? 1.58 21 10 O A SER 12 ? ? H A ASP 16 ? ? 1.58 22 10 O A ARG 72 ? ? H A MET 76 ? ? 1.59 23 10 O A LEU 79 ? ? H A ARG 83 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 9 ? ? -136.23 -58.33 2 1 CYS A 11 ? ? -147.68 -48.76 3 1 ASP A 16 ? ? -36.96 -36.78 4 1 LEU A 18 ? ? -37.87 -31.53 5 1 GLU A 25 ? ? -134.54 -71.14 6 1 MET A 26 ? ? -178.24 86.44 7 1 SER A 29 ? ? -85.97 48.55 8 1 GLU A 35 ? ? -23.94 -47.15 9 1 ALA A 61 ? ? 56.56 176.16 10 1 GLN A 64 ? ? -81.31 -149.55 11 1 ASP A 66 ? ? 60.04 -60.18 12 1 VAL A 67 ? ? 171.29 98.86 13 1 ALA A 96 ? ? 77.48 98.86 14 1 SER A 98 ? ? -169.56 44.85 15 1 SER A 100 ? ? -148.25 -50.41 16 1 GLU A 104 ? ? 50.33 87.45 17 2 GLU A 5 ? ? 48.09 83.13 18 2 PRO A 6 ? ? -80.66 -152.48 19 2 GLU A 8 ? ? 61.41 167.78 20 2 THR A 9 ? ? -164.18 -49.23 21 2 ASP A 16 ? ? -39.95 -31.42 22 2 MET A 26 ? ? 179.06 89.10 23 2 SER A 29 ? ? -86.53 45.01 24 2 ASP A 30 ? ? -142.60 -12.72 25 2 ALA A 61 ? ? 59.42 159.80 26 2 GLN A 64 ? ? -94.28 -115.65 27 2 ASP A 66 ? ? -31.06 135.20 28 2 VAL A 67 ? ? 5.27 94.62 29 2 GLU A 90 ? ? -179.48 44.97 30 2 HIS A 91 ? ? -117.48 63.68 31 2 ALA A 95 ? ? -135.59 -46.86 32 2 SER A 98 ? ? -154.61 58.88 33 2 SER A 100 ? ? -160.77 -55.15 34 2 GLN A 103 ? ? -164.41 57.20 35 3 ALA A 3 ? ? -146.11 51.23 36 3 PRO A 6 ? ? -77.23 -157.86 37 3 THR A 9 ? ? -148.88 -53.46 38 3 GLU A 25 ? ? -70.38 -74.43 39 3 MET A 26 ? ? -176.18 87.14 40 3 SER A 29 ? ? -89.66 45.96 41 3 PHE A 34 ? ? -61.92 -70.09 42 3 GLU A 35 ? ? -24.09 -48.83 43 3 ALA A 61 ? ? 63.08 166.83 44 3 GLN A 64 ? ? -142.48 -119.37 45 3 ASP A 66 ? ? -35.37 136.01 46 3 VAL A 67 ? ? 1.27 83.51 47 3 GLN A 86 ? ? -152.68 -41.66 48 3 GLU A 90 ? ? 63.67 155.53 49 3 ASP A 92 ? ? 55.62 -91.24 50 3 VAL A 93 ? ? -155.98 26.08 51 3 ALA A 95 ? ? -171.42 97.09 52 3 ALA A 96 ? ? 49.41 78.35 53 3 SER A 98 ? ? -164.68 52.93 54 3 SER A 100 ? ? -134.40 -51.49 55 3 GLN A 103 ? ? -158.39 55.16 56 4 SER A -1 ? ? 61.56 97.14 57 4 ALA A 3 ? ? -152.13 50.75 58 4 HIS A 7 ? ? 47.45 78.17 59 4 CYS A 11 ? ? -137.25 -58.83 60 4 MET A 26 ? ? 176.31 94.97 61 4 SER A 29 ? ? -85.92 47.60 62 4 ASP A 65 ? ? 113.92 -25.18 63 4 ASP A 66 ? ? 52.62 -77.36 64 4 VAL A 67 ? ? -175.91 83.21 65 4 GLN A 86 ? ? -142.02 -55.65 66 4 GLU A 90 ? ? 59.88 102.58 67 4 HIS A 91 ? ? -160.86 34.58 68 4 VAL A 93 ? ? 60.51 -1.94 69 4 ALA A 94 ? ? 51.12 16.05 70 4 ALA A 95 ? ? -144.67 21.33 71 4 ALA A 96 ? ? -168.28 81.16 72 4 SER A 98 ? ? -159.75 50.10 73 4 SER A 100 ? ? -136.04 -51.10 74 4 GLU A 104 ? ? 48.19 81.75 75 5 ALA A 3 ? ? -96.70 53.45 76 5 THR A 9 ? ? -140.65 -58.73 77 5 LEU A 18 ? ? -39.80 -27.30 78 5 LYS A 24 ? ? -133.74 -35.78 79 5 MET A 26 ? ? 175.61 68.91 80 5 PRO A 27 ? ? -22.41 -54.15 81 5 SER A 29 ? ? -87.34 41.52 82 5 PHE A 34 ? ? -61.92 -71.58 83 5 GLU A 35 ? ? -21.43 -49.13 84 5 ALA A 61 ? ? 11.78 -101.12 85 5 ALA A 62 ? ? -152.14 -53.64 86 5 VAL A 67 ? ? 30.69 79.07 87 5 SER A 87 ? ? -49.82 153.19 88 5 PRO A 89 ? ? -61.41 -173.99 89 5 ALA A 95 ? ? -131.05 -49.82 90 5 SER A 98 ? ? -162.61 50.87 91 5 SER A 100 ? ? -128.02 -52.13 92 5 GLN A 103 ? ? -156.44 55.05 93 6 ALA A 3 ? ? -91.88 58.38 94 6 HIS A 7 ? ? 50.62 90.37 95 6 THR A 9 ? ? -123.73 -79.70 96 6 ASP A 16 ? ? -37.99 -33.00 97 6 TYR A 19 ? ? -87.21 -71.67 98 6 MET A 26 ? ? -179.38 92.09 99 6 SER A 29 ? ? -86.06 44.62 100 6 ALA A 61 ? ? 49.50 -167.79 101 6 ALA A 62 ? ? -102.60 69.63 102 6 GLN A 64 ? ? -78.60 -133.81 103 6 ASP A 66 ? ? 52.77 -75.76 104 6 VAL A 67 ? ? -167.20 89.68 105 6 GLN A 86 ? ? -143.33 -50.67 106 6 GLU A 90 ? ? 62.79 140.42 107 6 ASP A 92 ? ? 55.13 -90.48 108 6 VAL A 93 ? ? -156.98 27.72 109 6 ALA A 96 ? ? 48.27 82.57 110 6 SER A 98 ? ? -167.27 41.97 111 6 SER A 100 ? ? -126.71 -50.96 112 6 GLN A 103 ? ? -143.69 47.61 113 6 GLU A 104 ? ? 47.98 82.82 114 7 PRO A 6 ? ? -74.84 -169.42 115 7 GLU A 8 ? ? -118.63 -165.83 116 7 THR A 9 ? ? -132.07 -75.67 117 7 ASP A 16 ? ? -39.74 -31.29 118 7 LEU A 18 ? ? -36.70 -29.99 119 7 GLU A 25 ? ? -65.97 -74.43 120 7 MET A 26 ? ? 178.51 90.22 121 7 SER A 29 ? ? -87.85 36.90 122 7 ALA A 61 ? ? 36.00 -94.29 123 7 GLN A 64 ? ? -79.14 -162.20 124 7 ASP A 66 ? ? 59.10 -72.16 125 7 VAL A 67 ? ? -164.40 74.35 126 7 GLN A 86 ? ? -138.81 -153.35 127 7 VAL A 88 ? ? -150.90 89.22 128 7 GLU A 90 ? ? -166.28 80.72 129 7 HIS A 91 ? ? -140.62 51.50 130 7 SER A 98 ? ? 58.18 93.11 131 7 GLN A 103 ? ? -154.73 56.71 132 8 THR A 9 ? ? -150.03 -51.63 133 8 ASP A 16 ? ? -37.57 -34.87 134 8 LEU A 18 ? ? -37.76 -29.69 135 8 GLU A 25 ? ? -70.01 -71.90 136 8 MET A 26 ? ? 176.62 93.21 137 8 SER A 29 ? ? -89.89 44.00 138 8 PHE A 34 ? ? -65.88 -70.08 139 8 GLU A 35 ? ? -23.73 -45.46 140 8 ARG A 60 ? ? -51.44 -72.00 141 8 ALA A 61 ? ? 49.41 -86.65 142 8 GLN A 64 ? ? -110.47 -90.05 143 8 ASP A 66 ? ? 59.12 -55.45 144 8 VAL A 67 ? ? 40.70 71.55 145 8 VAL A 88 ? ? -154.84 77.01 146 8 GLU A 90 ? ? 57.04 159.55 147 8 HIS A 91 ? ? -169.67 99.58 148 8 ALA A 95 ? ? 123.24 51.54 149 8 GLN A 103 ? ? -154.69 55.76 150 9 ALA A 3 ? ? -140.40 46.90 151 9 PRO A 6 ? ? -76.63 -169.36 152 9 THR A 9 ? ? -148.10 -51.82 153 9 CYS A 11 ? ? -150.31 -51.44 154 9 ASP A 16 ? ? -38.17 -33.49 155 9 LEU A 18 ? ? -38.15 -27.71 156 9 GLU A 25 ? ? 63.24 143.10 157 9 MET A 26 ? ? 154.32 -50.76 158 9 PRO A 27 ? ? -28.19 -43.80 159 9 ASP A 30 ? ? -149.07 -16.71 160 9 ALA A 61 ? ? 49.82 -169.63 161 9 GLN A 64 ? ? -76.04 -149.96 162 9 ASP A 65 ? ? -80.91 33.79 163 9 ASP A 66 ? ? -31.89 134.80 164 9 VAL A 67 ? ? 29.58 88.18 165 9 GLN A 86 ? ? -138.59 -156.30 166 9 SER A 87 ? ? 54.78 104.23 167 9 GLU A 90 ? ? 56.80 70.65 168 9 HIS A 91 ? ? -145.32 41.62 169 9 ALA A 95 ? ? -135.83 -49.24 170 9 SER A 98 ? ? -151.31 68.11 171 9 SER A 100 ? ? -142.57 -52.13 172 9 GLN A 103 ? ? -156.17 54.19 173 10 ALA A 3 ? ? -143.46 48.82 174 10 HIS A 7 ? ? 60.34 105.44 175 10 THR A 9 ? ? -161.64 -53.69 176 10 CYS A 11 ? ? -136.70 -50.14 177 10 ASP A 16 ? ? -36.87 -35.83 178 10 LEU A 18 ? ? -39.04 -24.21 179 10 TYR A 19 ? ? -90.36 -73.66 180 10 GLU A 25 ? ? -142.97 -92.93 181 10 MET A 26 ? ? -169.64 89.72 182 10 SER A 29 ? ? -91.89 34.48 183 10 ALA A 61 ? ? 32.28 -101.91 184 10 ASP A 66 ? ? 47.43 134.97 185 10 VAL A 67 ? ? 10.65 72.08 186 10 GLN A 86 ? ? 50.06 107.32 187 10 GLU A 90 ? ? 63.23 167.07 188 10 ASP A 92 ? ? 53.97 -89.05 189 10 VAL A 93 ? ? -156.26 25.67 190 10 ALA A 95 ? ? -169.34 97.85 191 10 ALA A 96 ? ? 46.28 79.15 192 10 SER A 100 ? ? 67.18 63.59 193 10 GLN A 103 ? ? -159.59 61.78 #