data_5FZV # _entry.id 5FZV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5FZV pdb_00005fzv 10.2210/pdb5fzv/pdb PDBE EBI-66492 ? ? WWPDB D_1290066492 ? ? BMRB 26002 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 5FZW unspecified 'HIGH RESOLUTION SOLUTION NMR STRUCTURE OF THE SPIDER VENOM PEPTIDE U3-SCYTOTOXIN-STH1H' PDB 5FZX unspecified 'HIGH RESOLUTION SOLUTION NMR STRUCTURE OF THE SPIDER VENOM PEPTIDE U5-SCYTOTOXIN-STH1A' BMRB 26002 unspecified . # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 5FZV _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2016-03-15 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # _audit_author.name 'Loening, N.M.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Characterization of Three Venom Peptides from the Spitting Spider Scytodes Thoracica.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 11 _citation.page_first 56291 _citation.page_last ? _citation.year 2016 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27227898 _citation.pdbx_database_id_DOI 10.1371/JOURNAL.PONE.0156291 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ariki, N.K.' 1 ? primary 'Munoz, L.E.' 2 ? primary 'Armitage, E.L.' 3 ? primary 'Goodstein, F.R.' 4 ? primary 'George, K.G.' 5 ? primary 'Smith, V.L.' 6 ? primary 'Vetter, I.' 7 ? primary 'Herzig, V.' 8 ? primary 'King, G.F.' 9 ? primary 'Loening, N.M.' 10 ? # _cell.entry_id 5FZV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FZV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Venom peptide U3-SYTX-Sth1a' _entity.formula_weight 3461.108 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GLIESIACIQKGLPCMEHSDCCRGVCEALFCQ _entity_poly.pdbx_seq_one_letter_code_can GLIESIACIQKGLPCMEHSDCCRGVCEALFCQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 ILE n 1 4 GLU n 1 5 SER n 1 6 ILE n 1 7 ALA n 1 8 CYS n 1 9 ILE n 1 10 GLN n 1 11 LYS n 1 12 GLY n 1 13 LEU n 1 14 PRO n 1 15 CYS n 1 16 MET n 1 17 GLU n 1 18 HIS n 1 19 SER n 1 20 ASP n 1 21 CYS n 1 22 CYS n 1 23 ARG n 1 24 GLY n 1 25 VAL n 1 26 CYS n 1 27 GLU n 1 28 ALA n 1 29 LEU n 1 30 PHE n 1 31 CYS n 1 32 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 32 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Scytodes thoracica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1112478 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ 'VENOM GLAND' _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PLIC-MBP _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'TRANSCRIPT IDENTIFIED FROM CDNA LIBRARY CONSTRUCTED FROM VENOM GLAND MRNA' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0A0V662_9ARAC _struct_ref.pdbx_db_accession A0A0A0V662 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LIESIACIQKGLPCMEHSDCCRGVCEALFCQ _struct_ref.pdbx_align_begin 30 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5FZV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0A0V662 _struct_ref_seq.db_align_beg 30 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 60 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 32 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5FZV _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A0A0A0V662 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '13C ARO NOESY 160MS' 1 2 1 '13C AROMATIC HSQC' 1 3 1 '13C CT-HSQC' 1 4 1 '13C HSQC' 1 5 1 '13C NOESY 160MS' 1 6 1 '15N HMQC2' 1 7 1 '15N NOESY 160MS' 1 8 1 'HCCH TOCSY' 1 9 1 HNCACB 1 10 1 HNCACO 1 11 1 HNCO 1 12 1 HNCOCACB 1 13 2 '15N HMQC' 2 14 2 '15N HSQC-TOCSY' 2 15 2 '1H NOESY (200MS)' 2 16 2 '1H TOCSY' 2 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298.0 atm 1.0 6.5 0.03 ? pH K 2 298.0 atm 1.0 6.5 0.03 ? pH K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents 1 '95% H2O/5% D2O' 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 AVANCE Bruker 600 2 AVANCE Bruker 600 # _pdbx_nmr_refine.entry_id 5FZV _pdbx_nmr_refine.method CNS _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE PAPER CITATION.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 5FZV _pdbx_nmr_details.text ;THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C,15N-LABELED U3-SCYTOTOXIN-STH1A, AND CALCULATED USING ARIA2 WITH WATER REFINEMENT. ; # _pdbx_nmr_ensemble.entry_id 5FZV _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'TOTAL ENERGY' # _pdbx_nmr_representative.entry_id 5FZV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS 1.2 'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' TALOS-N 4.12 ? 2 'structure solution' 'CcpNmr Analysis' 2.4 ? 3 # _exptl.entry_id 5FZV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 5FZV _struct.title 'High resolution solution NMR structure of the spider venom peptide U3- scytotoxin-Sth1a' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5FZV _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'TOXIN, SPIDER VENOM PEPTIDE, ICK' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 8 A CYS 22 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 15 A CYS 26 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf3 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 21 A CYS 31 1_555 ? ? ? ? ? ? ? 2.035 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 26 ? GLU A 27 ? CYS A 26 GLU A 27 AA1 2 PHE A 30 ? CYS A 31 ? PHE A 30 CYS A 31 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 27 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 30 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 30 # _database_PDB_matrix.entry_id 5FZV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 5FZV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-08 2 'Structure model' 2 0 2017-06-14 3 'Structure model' 2 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Source and taxonomy' 5 2 'Structure model' 'Structure summary' 6 3 'Structure model' 'Data collection' 7 3 'Structure model' 'Database references' 8 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' entity 3 2 'Structure model' entity_src_gen 4 2 'Structure model' pdbx_struct_sheet_hbond 5 2 'Structure model' struct_ref 6 2 'Structure model' struct_ref_seq_dif 7 2 'Structure model' struct_sheet 8 2 'Structure model' struct_sheet_order 9 2 'Structure model' struct_sheet_range 10 3 'Structure model' database_2 11 3 'Structure model' pdbx_database_status 12 3 'Structure model' pdbx_nmr_software 13 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.Cartn_x' 2 2 'Structure model' '_atom_site.Cartn_y' 3 2 'Structure model' '_atom_site.Cartn_z' 4 2 'Structure model' '_entity.pdbx_description' 5 2 'Structure model' '_entity_src_gen.gene_src_common_name' 6 2 'Structure model' '_entity_src_gen.pdbx_beg_seq_num' 7 2 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 8 2 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 9 2 'Structure model' '_entity_src_gen.pdbx_seq_type' 10 2 'Structure model' '_pdbx_struct_sheet_hbond.sheet_id' 11 2 'Structure model' '_struct_ref.db_code' 12 2 'Structure model' '_struct_ref.pdbx_align_begin' 13 2 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 14 2 'Structure model' '_struct_ref_seq_dif.db_mon_id' 15 2 'Structure model' '_struct_ref_seq_dif.pdbx_seq_db_accession_code' 16 2 'Structure model' '_struct_sheet.id' 17 2 'Structure model' '_struct_sheet_order.sheet_id' 18 2 'Structure model' '_struct_sheet_range.sheet_id' 19 3 'Structure model' '_database_2.pdbx_DOI' 20 3 'Structure model' '_database_2.pdbx_database_accession' 21 3 'Structure model' '_pdbx_database_status.status_code_cs' 22 3 'Structure model' '_pdbx_database_status.status_code_mr' 23 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 24 3 'Structure model' '_pdbx_nmr_software.name' 25 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_entry_details.entry_id 5FZV _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;SEQUENCE DEPOSITED IN THE ARACHNOSERVER SPIDER TOXIN DATABASE (WWW.ARACHNOSERVER.ORG) ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE A ARG 23 ? ? OXT A GLN 32 ? ? 1.60 2 8 HE A ARG 23 ? ? O A GLN 32 ? ? 1.58 3 12 HZ2 A LYS 11 ? ? O A GLN 32 ? ? 1.58 4 12 HE A ARG 23 ? ? OXT A GLN 32 ? ? 1.59 5 17 HZ1 A LYS 11 ? ? O A GLN 32 ? ? 1.58 6 17 HE A ARG 23 ? ? OXT A GLN 32 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -160.00 82.33 2 1 ILE A 6 ? ? 60.21 77.37 3 1 ALA A 7 ? ? 61.07 -165.68 4 1 GLU A 17 ? ? -170.98 141.82 5 2 ILE A 3 ? ? 64.83 68.08 6 2 ILE A 6 ? ? -55.16 103.78 7 2 CYS A 8 ? ? 53.58 149.12 8 3 ILE A 3 ? ? 62.46 79.07 9 3 GLU A 4 ? ? -141.31 -2.00 10 3 ILE A 6 ? ? 58.51 75.50 11 3 ALA A 7 ? ? 62.95 -156.61 12 4 ILE A 3 ? ? -119.11 -93.39 13 4 CYS A 8 ? ? 50.40 -174.60 14 5 ILE A 3 ? ? 60.92 86.76 15 5 GLU A 4 ? ? -125.64 -60.94 16 5 SER A 5 ? ? -101.34 57.56 17 5 ILE A 6 ? ? 66.11 99.52 18 5 ALA A 7 ? ? 64.71 178.21 19 5 MET A 16 ? ? -133.45 -31.50 20 6 ILE A 3 ? ? 67.54 63.11 21 6 SER A 5 ? ? -165.56 80.63 22 6 ILE A 6 ? ? 51.08 81.26 23 6 CYS A 8 ? ? 65.05 158.13 24 7 ILE A 3 ? ? 74.90 112.22 25 7 SER A 5 ? ? -168.89 91.29 26 7 ILE A 6 ? ? 61.71 97.66 27 7 ALA A 7 ? ? 68.12 140.36 28 8 ILE A 3 ? ? 74.61 103.52 29 8 CYS A 8 ? ? 53.19 -179.74 30 9 ILE A 3 ? ? 67.61 81.31 31 9 CYS A 8 ? ? 64.35 178.23 32 10 LEU A 2 ? ? 67.74 176.46 33 10 ILE A 3 ? ? 58.91 76.65 34 10 GLU A 4 ? ? -153.99 -52.10 35 10 ALA A 7 ? ? 70.22 -44.45 36 10 CYS A 8 ? ? 176.47 160.76 37 11 ILE A 6 ? ? 67.53 -79.23 38 12 GLU A 4 ? ? -53.89 94.87 39 12 SER A 5 ? ? -168.42 -84.80 40 12 ILE A 6 ? ? -128.16 -50.81 41 13 ILE A 3 ? ? -65.88 -73.69 42 13 GLU A 4 ? ? -93.70 -62.10 43 13 CYS A 8 ? ? 57.85 176.52 44 14 ILE A 3 ? ? 71.91 80.37 45 14 ILE A 6 ? ? 58.08 83.40 46 14 ALA A 7 ? ? 65.84 178.30 47 15 GLU A 4 ? ? -168.41 -67.47 48 15 CYS A 8 ? ? 49.17 170.33 49 16 LEU A 2 ? ? -131.10 -62.76 50 16 ILE A 3 ? ? -178.84 -23.60 51 16 ILE A 6 ? ? 70.51 -64.74 52 17 ILE A 3 ? ? -101.52 -67.10 53 17 GLU A 4 ? ? -124.90 -89.53 54 17 ALA A 7 ? ? 71.78 -50.70 55 18 ILE A 3 ? ? 66.77 95.48 56 18 GLU A 4 ? ? -130.75 -62.90 57 18 ALA A 7 ? ? 56.64 -103.75 58 19 ILE A 3 ? ? 70.61 106.51 59 19 GLU A 4 ? ? -162.72 -36.95 60 19 SER A 5 ? ? -111.70 77.32 61 19 ILE A 6 ? ? 58.22 82.05 62 19 ALA A 7 ? ? 61.27 -157.31 63 20 LEU A 2 ? ? 73.30 153.58 64 20 ILE A 3 ? ? 67.13 86.32 65 20 CYS A 8 ? ? 51.26 172.55 #