data_5GH9 # _entry.id 5GH9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5GH9 pdb_00005gh9 10.2210/pdb5gh9/pdb WWPDB D_1300000768 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-21 2 'Structure model' 1 1 2017-08-30 3 'Structure model' 1 2 2023-11-08 4 'Structure model' 1 3 2023-11-15 5 'Structure model' 1 4 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Data collection' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_database_2.pdbx_DOI' 10 3 'Structure model' '_database_2.pdbx_database_accession' 11 4 'Structure model' '_chem_comp_atom.atom_id' 12 4 'Structure model' '_chem_comp_bond.atom_id_2' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5GH9 _pdbx_database_status.recvd_initial_deposition_date 2016-06-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Xu, L.' _audit_author.pdbx_ordinal 1 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'FEBS J.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-4658 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural insight into CBP bromodomain-mediated recognition of acetylated histone H3K56ac' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/febs.14198 _citation.pdbx_database_id_PubMed 28815970 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, L.' 1 ? primary 'Cheng, A.' 2 ? primary 'Huang, M.' 3 ? primary 'Zhang, J.' 4 ? primary 'Jiang, Y.' 5 ? primary 'Wang, C.' 6 ? primary 'Li, F.' 7 ? primary 'Bao, H.' 8 ? primary 'Gao, J.' 9 ? primary 'Wang, N.' 10 ? primary 'Liu, J.' 11 ? primary 'Wu, J.' 12 ? primary 'Wong, C.C.L.' 13 ? primary 'Ruan, K.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CREB-binding protein' 14217.365 1 ? ? 'UNP residues 1081-1196' ? 2 polymer syn 'Histone H3' 1721.979 1 ? ? 'UNP residues 45-58' ? 3 water nat water 18.015 131 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;HMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVW LMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL ; ;HMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVW LMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL ; A ? 2 'polypeptide(L)' no yes 'GTVALREIRRYQ(ALY)S' GTVALREIRRYQKS B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 ARG n 1 4 LYS n 1 5 LYS n 1 6 ILE n 1 7 PHE n 1 8 LYS n 1 9 PRO n 1 10 GLU n 1 11 GLU n 1 12 LEU n 1 13 ARG n 1 14 GLN n 1 15 ALA n 1 16 LEU n 1 17 MET n 1 18 PRO n 1 19 THR n 1 20 LEU n 1 21 GLU n 1 22 ALA n 1 23 LEU n 1 24 TYR n 1 25 ARG n 1 26 GLN n 1 27 ASP n 1 28 PRO n 1 29 GLU n 1 30 SER n 1 31 LEU n 1 32 PRO n 1 33 PHE n 1 34 ARG n 1 35 GLN n 1 36 PRO n 1 37 VAL n 1 38 ASP n 1 39 PRO n 1 40 GLN n 1 41 LEU n 1 42 LEU n 1 43 GLY n 1 44 ILE n 1 45 PRO n 1 46 ASP n 1 47 TYR n 1 48 PHE n 1 49 ASP n 1 50 ILE n 1 51 VAL n 1 52 LYS n 1 53 ASN n 1 54 PRO n 1 55 MET n 1 56 ASP n 1 57 LEU n 1 58 SER n 1 59 THR n 1 60 ILE n 1 61 LYS n 1 62 ARG n 1 63 LYS n 1 64 LEU n 1 65 ASP n 1 66 THR n 1 67 GLY n 1 68 GLN n 1 69 TYR n 1 70 GLN n 1 71 GLU n 1 72 PRO n 1 73 TRP n 1 74 GLN n 1 75 TYR n 1 76 VAL n 1 77 ASP n 1 78 ASP n 1 79 VAL n 1 80 TRP n 1 81 LEU n 1 82 MET n 1 83 PHE n 1 84 ASN n 1 85 ASN n 1 86 ALA n 1 87 TRP n 1 88 LEU n 1 89 TYR n 1 90 ASN n 1 91 ARG n 1 92 LYS n 1 93 THR n 1 94 SER n 1 95 ARG n 1 96 VAL n 1 97 TYR n 1 98 LYS n 1 99 PHE n 1 100 CYS n 1 101 SER n 1 102 LYS n 1 103 LEU n 1 104 ALA n 1 105 GLU n 1 106 VAL n 1 107 PHE n 1 108 GLU n 1 109 GLN n 1 110 GLU n 1 111 ILE n 1 112 ASP n 1 113 PRO n 1 114 VAL n 1 115 MET n 1 116 GLN n 1 117 SER n 1 118 LEU n 2 1 GLY n 2 2 THR n 2 3 VAL n 2 4 ALA n 2 5 LEU n 2 6 ARG n 2 7 GLU n 2 8 ILE n 2 9 ARG n 2 10 ARG n 2 11 TYR n 2 12 GLN n 2 13 ALY n 2 14 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 118 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CREBBP, CBP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ;'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 14 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3' 188.224 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1079 ? ? ? A . n A 1 2 MET 2 1080 ? ? ? A . n A 1 3 ARG 3 1081 ? ? ? A . n A 1 4 LYS 4 1082 ? ? ? A . n A 1 5 LYS 5 1083 ? ? ? A . n A 1 6 ILE 6 1084 1084 ILE ILE A . n A 1 7 PHE 7 1085 1085 PHE PHE A . n A 1 8 LYS 8 1086 1086 LYS LYS A . n A 1 9 PRO 9 1087 1087 PRO PRO A . n A 1 10 GLU 10 1088 1088 GLU GLU A . n A 1 11 GLU 11 1089 1089 GLU GLU A . n A 1 12 LEU 12 1090 1090 LEU LEU A . n A 1 13 ARG 13 1091 1091 ARG ARG A . n A 1 14 GLN 14 1092 1092 GLN GLN A . n A 1 15 ALA 15 1093 1093 ALA ALA A . n A 1 16 LEU 16 1094 1094 LEU LEU A . n A 1 17 MET 17 1095 1095 MET MET A . n A 1 18 PRO 18 1096 1096 PRO PRO A . n A 1 19 THR 19 1097 1097 THR THR A . n A 1 20 LEU 20 1098 1098 LEU LEU A . n A 1 21 GLU 21 1099 1099 GLU GLU A . n A 1 22 ALA 22 1100 1100 ALA ALA A . n A 1 23 LEU 23 1101 1101 LEU LEU A . n A 1 24 TYR 24 1102 1102 TYR TYR A . n A 1 25 ARG 25 1103 1103 ARG ARG A . n A 1 26 GLN 26 1104 1104 GLN GLN A . n A 1 27 ASP 27 1105 1105 ASP ASP A . n A 1 28 PRO 28 1106 1106 PRO PRO A . n A 1 29 GLU 29 1107 1107 GLU GLU A . n A 1 30 SER 30 1108 1108 SER SER A . n A 1 31 LEU 31 1109 1109 LEU LEU A . n A 1 32 PRO 32 1110 1110 PRO PRO A . n A 1 33 PHE 33 1111 1111 PHE PHE A . n A 1 34 ARG 34 1112 1112 ARG ARG A . n A 1 35 GLN 35 1113 1113 GLN GLN A . n A 1 36 PRO 36 1114 1114 PRO PRO A . n A 1 37 VAL 37 1115 1115 VAL VAL A . n A 1 38 ASP 38 1116 1116 ASP ASP A . n A 1 39 PRO 39 1117 1117 PRO PRO A . n A 1 40 GLN 40 1118 1118 GLN GLN A . n A 1 41 LEU 41 1119 1119 LEU LEU A . n A 1 42 LEU 42 1120 1120 LEU LEU A . n A 1 43 GLY 43 1121 1121 GLY GLY A . n A 1 44 ILE 44 1122 1122 ILE ILE A . n A 1 45 PRO 45 1123 1123 PRO PRO A . n A 1 46 ASP 46 1124 1124 ASP ASP A . n A 1 47 TYR 47 1125 1125 TYR TYR A . n A 1 48 PHE 48 1126 1126 PHE PHE A . n A 1 49 ASP 49 1127 1127 ASP ASP A . n A 1 50 ILE 50 1128 1128 ILE ILE A . n A 1 51 VAL 51 1129 1129 VAL VAL A . n A 1 52 LYS 52 1130 1130 LYS LYS A . n A 1 53 ASN 53 1131 1131 ASN ASN A . n A 1 54 PRO 54 1132 1132 PRO PRO A . n A 1 55 MET 55 1133 1133 MET MET A . n A 1 56 ASP 56 1134 1134 ASP ASP A . n A 1 57 LEU 57 1135 1135 LEU LEU A . n A 1 58 SER 58 1136 1136 SER SER A . n A 1 59 THR 59 1137 1137 THR THR A . n A 1 60 ILE 60 1138 1138 ILE ILE A . n A 1 61 LYS 61 1139 1139 LYS LYS A . n A 1 62 ARG 62 1140 1140 ARG ARG A . n A 1 63 LYS 63 1141 1141 LYS LYS A . n A 1 64 LEU 64 1142 1142 LEU LEU A . n A 1 65 ASP 65 1143 1143 ASP ASP A . n A 1 66 THR 66 1144 1144 THR THR A . n A 1 67 GLY 67 1145 1145 GLY GLY A . n A 1 68 GLN 68 1146 1146 GLN GLN A . n A 1 69 TYR 69 1147 1147 TYR TYR A . n A 1 70 GLN 70 1148 1148 GLN GLN A . n A 1 71 GLU 71 1149 1149 GLU GLU A . n A 1 72 PRO 72 1150 1150 PRO PRO A . n A 1 73 TRP 73 1151 1151 TRP TRP A . n A 1 74 GLN 74 1152 1152 GLN GLN A . n A 1 75 TYR 75 1153 1153 TYR TYR A . n A 1 76 VAL 76 1154 1154 VAL VAL A . n A 1 77 ASP 77 1155 1155 ASP ASP A . n A 1 78 ASP 78 1156 1156 ASP ASP A . n A 1 79 VAL 79 1157 1157 VAL VAL A . n A 1 80 TRP 80 1158 1158 TRP TRP A . n A 1 81 LEU 81 1159 1159 LEU LEU A . n A 1 82 MET 82 1160 1160 MET MET A . n A 1 83 PHE 83 1161 1161 PHE PHE A . n A 1 84 ASN 84 1162 1162 ASN ASN A . n A 1 85 ASN 85 1163 1163 ASN ASN A . n A 1 86 ALA 86 1164 1164 ALA ALA A . n A 1 87 TRP 87 1165 1165 TRP TRP A . n A 1 88 LEU 88 1166 1166 LEU LEU A . n A 1 89 TYR 89 1167 1167 TYR TYR A . n A 1 90 ASN 90 1168 1168 ASN ASN A . n A 1 91 ARG 91 1169 1169 ARG ARG A . n A 1 92 LYS 92 1170 1170 LYS LYS A . n A 1 93 THR 93 1171 1171 THR THR A . n A 1 94 SER 94 1172 1172 SER SER A . n A 1 95 ARG 95 1173 1173 ARG ARG A . n A 1 96 VAL 96 1174 1174 VAL VAL A . n A 1 97 TYR 97 1175 1175 TYR TYR A . n A 1 98 LYS 98 1176 1176 LYS LYS A . n A 1 99 PHE 99 1177 1177 PHE PHE A . n A 1 100 CYS 100 1178 1178 CYS CYS A . n A 1 101 SER 101 1179 1179 SER SER A . n A 1 102 LYS 102 1180 1180 LYS LYS A . n A 1 103 LEU 103 1181 1181 LEU LEU A . n A 1 104 ALA 104 1182 1182 ALA ALA A . n A 1 105 GLU 105 1183 1183 GLU GLU A . n A 1 106 VAL 106 1184 1184 VAL VAL A . n A 1 107 PHE 107 1185 1185 PHE PHE A . n A 1 108 GLU 108 1186 1186 GLU GLU A . n A 1 109 GLN 109 1187 1187 GLN GLN A . n A 1 110 GLU 110 1188 1188 GLU GLU A . n A 1 111 ILE 111 1189 1189 ILE ILE A . n A 1 112 ASP 112 1190 1190 ASP ASP A . n A 1 113 PRO 113 1191 1191 PRO PRO A . n A 1 114 VAL 114 1192 1192 VAL VAL A . n A 1 115 MET 115 1193 1193 MET MET A . n A 1 116 GLN 116 1194 1194 GLN GLN A . n A 1 117 SER 117 1195 1195 SER SER A . n A 1 118 LEU 118 1196 1196 LEU LEU A . n B 2 1 GLY 1 79 ? ? ? B . n B 2 2 THR 2 80 ? ? ? B . n B 2 3 VAL 3 81 ? ? ? B . n B 2 4 ALA 4 82 ? ? ? B . n B 2 5 LEU 5 83 ? ? ? B . n B 2 6 ARG 6 84 ? ? ? B . n B 2 7 GLU 7 85 ? ? ? B . n B 2 8 ILE 8 86 ? ? ? B . n B 2 9 ARG 9 87 87 ARG ARG B . n B 2 10 ARG 10 88 88 ARG ARG B . n B 2 11 TYR 11 89 89 TYR TYR B . n B 2 12 GLN 12 90 90 GLN GLN B . n B 2 13 ALY 13 91 91 ALY ALY B . n B 2 14 SER 14 92 92 SER SER B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 1201 1 HOH HOH A . C 3 HOH 2 1202 76 HOH HOH A . C 3 HOH 3 1203 142 HOH HOH A . C 3 HOH 4 1204 61 HOH HOH A . C 3 HOH 5 1205 107 HOH HOH A . C 3 HOH 6 1206 63 HOH HOH A . C 3 HOH 7 1207 2 HOH HOH A . C 3 HOH 8 1208 69 HOH HOH A . C 3 HOH 9 1209 70 HOH HOH A . C 3 HOH 10 1210 157 HOH HOH A . C 3 HOH 11 1211 87 HOH HOH A . C 3 HOH 12 1212 64 HOH HOH A . C 3 HOH 13 1213 161 HOH HOH A . C 3 HOH 14 1214 60 HOH HOH A . C 3 HOH 15 1215 83 HOH HOH A . C 3 HOH 16 1216 74 HOH HOH A . C 3 HOH 17 1217 25 HOH HOH A . C 3 HOH 18 1218 37 HOH HOH A . C 3 HOH 19 1219 36 HOH HOH A . C 3 HOH 20 1220 10 HOH HOH A . C 3 HOH 21 1221 50 HOH HOH A . C 3 HOH 22 1222 27 HOH HOH A . C 3 HOH 23 1223 11 HOH HOH A . C 3 HOH 24 1224 105 HOH HOH A . C 3 HOH 25 1225 30 HOH HOH A . C 3 HOH 26 1226 8 HOH HOH A . C 3 HOH 27 1227 156 HOH HOH A . C 3 HOH 28 1228 16 HOH HOH A . C 3 HOH 29 1229 133 HOH HOH A . C 3 HOH 30 1230 41 HOH HOH A . C 3 HOH 31 1231 6 HOH HOH A . C 3 HOH 32 1232 3 HOH HOH A . C 3 HOH 33 1233 139 HOH HOH A . C 3 HOH 34 1234 21 HOH HOH A . C 3 HOH 35 1235 28 HOH HOH A . C 3 HOH 36 1236 141 HOH HOH A . C 3 HOH 37 1237 52 HOH HOH A . C 3 HOH 38 1238 79 HOH HOH A . C 3 HOH 39 1239 137 HOH HOH A . C 3 HOH 40 1240 24 HOH HOH A . C 3 HOH 41 1241 51 HOH HOH A . C 3 HOH 42 1242 62 HOH HOH A . C 3 HOH 43 1243 17 HOH HOH A . C 3 HOH 44 1244 86 HOH HOH A . C 3 HOH 45 1245 73 HOH HOH A . C 3 HOH 46 1246 12 HOH HOH A . C 3 HOH 47 1247 5 HOH HOH A . C 3 HOH 48 1248 42 HOH HOH A . C 3 HOH 49 1249 9 HOH HOH A . C 3 HOH 50 1250 136 HOH HOH A . C 3 HOH 51 1251 4 HOH HOH A . C 3 HOH 52 1252 48 HOH HOH A . C 3 HOH 53 1253 38 HOH HOH A . C 3 HOH 54 1254 144 HOH HOH A . C 3 HOH 55 1255 56 HOH HOH A . C 3 HOH 56 1256 130 HOH HOH A . C 3 HOH 57 1257 55 HOH HOH A . C 3 HOH 58 1258 45 HOH HOH A . C 3 HOH 59 1259 66 HOH HOH A . C 3 HOH 60 1260 85 HOH HOH A . C 3 HOH 61 1261 98 HOH HOH A . C 3 HOH 62 1262 54 HOH HOH A . C 3 HOH 63 1263 26 HOH HOH A . C 3 HOH 64 1264 59 HOH HOH A . C 3 HOH 65 1265 46 HOH HOH A . C 3 HOH 66 1266 49 HOH HOH A . C 3 HOH 67 1267 18 HOH HOH A . C 3 HOH 68 1268 23 HOH HOH A . C 3 HOH 69 1269 20 HOH HOH A . C 3 HOH 70 1270 33 HOH HOH A . C 3 HOH 71 1271 88 HOH HOH A . C 3 HOH 72 1272 132 HOH HOH A . C 3 HOH 73 1273 14 HOH HOH A . C 3 HOH 74 1274 152 HOH HOH A . C 3 HOH 75 1275 22 HOH HOH A . C 3 HOH 76 1276 146 HOH HOH A . C 3 HOH 77 1277 82 HOH HOH A . C 3 HOH 78 1278 162 HOH HOH A . C 3 HOH 79 1279 89 HOH HOH A . C 3 HOH 80 1280 32 HOH HOH A . C 3 HOH 81 1281 15 HOH HOH A . C 3 HOH 82 1282 153 HOH HOH A . C 3 HOH 83 1283 117 HOH HOH A . C 3 HOH 84 1284 7 HOH HOH A . C 3 HOH 85 1285 114 HOH HOH A . C 3 HOH 86 1286 149 HOH HOH A . C 3 HOH 87 1287 78 HOH HOH A . C 3 HOH 88 1288 13 HOH HOH A . C 3 HOH 89 1289 147 HOH HOH A . C 3 HOH 90 1290 148 HOH HOH A . C 3 HOH 91 1291 145 HOH HOH A . C 3 HOH 92 1292 112 HOH HOH A . C 3 HOH 93 1293 127 HOH HOH A . C 3 HOH 94 1294 140 HOH HOH A . C 3 HOH 95 1295 155 HOH HOH A . C 3 HOH 96 1296 47 HOH HOH A . C 3 HOH 97 1297 143 HOH HOH A . C 3 HOH 98 1298 35 HOH HOH A . C 3 HOH 99 1299 39 HOH HOH A . C 3 HOH 100 1300 159 HOH HOH A . C 3 HOH 101 1301 128 HOH HOH A . C 3 HOH 102 1302 113 HOH HOH A . C 3 HOH 103 1303 65 HOH HOH A . C 3 HOH 104 1304 135 HOH HOH A . C 3 HOH 105 1305 129 HOH HOH A . C 3 HOH 106 1306 43 HOH HOH A . C 3 HOH 107 1307 44 HOH HOH A . C 3 HOH 108 1308 151 HOH HOH A . C 3 HOH 109 1309 75 HOH HOH A . C 3 HOH 110 1310 84 HOH HOH A . C 3 HOH 111 1311 116 HOH HOH A . C 3 HOH 112 1312 68 HOH HOH A . C 3 HOH 113 1313 72 HOH HOH A . C 3 HOH 114 1314 118 HOH HOH A . C 3 HOH 115 1315 150 HOH HOH A . C 3 HOH 116 1316 111 HOH HOH A . C 3 HOH 117 1317 120 HOH HOH A . C 3 HOH 118 1318 104 HOH HOH A . D 3 HOH 1 101 40 HOH HOH B . D 3 HOH 2 102 71 HOH HOH B . D 3 HOH 3 103 154 HOH HOH B . D 3 HOH 4 104 53 HOH HOH B . D 3 HOH 5 105 34 HOH HOH B . D 3 HOH 6 106 126 HOH HOH B . D 3 HOH 7 107 67 HOH HOH B . D 3 HOH 8 108 29 HOH HOH B . D 3 HOH 9 109 131 HOH HOH B . D 3 HOH 10 110 134 HOH HOH B . D 3 HOH 11 111 58 HOH HOH B . D 3 HOH 12 112 97 HOH HOH B . D 3 HOH 13 113 160 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.entry_id 5GH9 _cell.length_a 42.826 _cell.length_b 45.832 _cell.length_c 66.038 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5GH9 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5GH9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.05 M Cadmium sulfate hydrate, 0.1 M HEPES, 1.0 M Sodium acetate trihydrate,' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-06-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9776 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9776 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 12.930 _reflns.entry_id 5GH9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.450 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24495 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.900 _reflns.pdbx_Rmerge_I_obs 0.061 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 33.113 _reflns.pdbx_netI_over_sigmaI 8.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.450 1.530 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.547 ? ? ? ? ? ? ? ? 5.500 ? ? ? ? ? ? ? 1 1 ? ? 1.530 1.550 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.480 ? ? ? ? ? ? ? ? 5.500 ? ? ? ? ? ? ? 2 1 ? ? 1.550 1.580 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.454 ? ? ? ? ? ? ? ? 5.100 ? ? ? ? ? ? ? 3 1 ? ? 1.580 1.620 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.424 ? ? ? ? ? ? ? ? 5.800 ? ? ? ? ? ? ? 4 1 ? ? 1.620 1.650 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.341 ? ? ? ? ? ? ? ? 6.200 ? ? ? ? ? ? ? 5 1 ? ? 1.650 1.690 ? ? ? ? ? ? ? 99.500 ? ? ? ? 0.317 ? ? ? ? ? ? ? ? 6.200 ? ? ? ? ? ? ? 6 1 ? ? 1.690 1.730 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.283 ? ? ? ? ? ? ? ? 6.200 ? ? ? ? ? ? ? 7 1 ? ? 1.730 1.780 ? ? ? ? ? ? ? 99.400 ? ? ? ? 0.234 ? ? ? ? ? ? ? ? 6.200 ? ? ? ? ? ? ? 8 1 ? ? 1.780 1.830 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.187 ? ? ? ? ? ? ? ? 6.200 ? ? ? ? ? ? ? 9 1 ? ? 1.830 1.890 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.155 ? ? ? ? ? ? ? ? 6.100 ? ? ? ? ? ? ? 10 1 ? ? 1.890 1.960 ? ? ? ? ? ? ? 99.500 ? ? ? ? 0.128 ? ? ? ? ? ? ? ? 5.700 ? ? ? ? ? ? ? 11 1 ? ? 1.960 2.040 ? ? ? ? ? ? ? 99.800 ? ? ? ? 0.101 ? ? ? ? ? ? ? ? 5.600 ? ? ? ? ? ? ? 12 1 ? ? 2.040 2.130 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 6.400 ? ? ? ? ? ? ? 13 1 ? ? 2.130 2.240 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 6.300 ? ? ? ? ? ? ? 14 1 ? ? 2.240 2.380 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 6.300 ? ? ? ? ? ? ? 15 1 ? ? 2.380 2.560 ? ? ? ? ? ? ? 99.700 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 6.100 ? ? ? ? ? ? ? 16 1 ? ? 2.560 2.820 ? ? ? ? ? ? ? 99.200 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 5.500 ? ? ? ? ? ? ? 17 1 ? ? 2.820 3.230 ? ? ? ? ? ? ? 99.900 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 6.100 ? ? ? ? ? ? ? 18 1 ? ? 3.230 4.070 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 6.100 ? ? ? ? ? ? ? 19 1 ? ? 4.070 50.000 ? ? ? ? ? ? ? 98.900 ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 5.500 ? ? ? ? ? ? ? 20 1 ? ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5GH9 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 23538 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 37.652 _refine.ls_d_res_high 1.451 _refine.ls_percent_reflns_obs 99.43 _refine.ls_R_factor_obs 0.1469 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1454 _refine.ls_R_factor_R_free 0.1764 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.09 _refine.ls_number_reflns_R_free 1199 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 4OUI _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.11 _refine.pdbx_overall_phase_error 15.50 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1014 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 131 _refine_hist.number_atoms_total 1145 _refine_hist.d_res_high 1.451 _refine_hist.d_res_low 37.652 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.005 ? ? 1060 'X-RAY DIFFRACTION' ? f_angle_d 0.835 ? ? 1439 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 18.567 ? ? 417 'X-RAY DIFFRACTION' ? f_chiral_restr 0.074 ? ? 148 'X-RAY DIFFRACTION' ? f_plane_restr 0.006 ? ? 189 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 1.4508 1.5089 2451 0.1491 99.00 0.2064 . . 115 . . . . 'X-RAY DIFFRACTION' . 1.5089 1.5776 2448 0.1330 100.00 0.2193 . . 136 . . . . 'X-RAY DIFFRACTION' . 1.5776 1.6607 2460 0.1253 100.00 0.1692 . . 128 . . . . 'X-RAY DIFFRACTION' . 1.6607 1.7648 2439 0.1281 99.00 0.1705 . . 132 . . . . 'X-RAY DIFFRACTION' . 1.7648 1.9010 2492 0.1272 100.00 0.1716 . . 119 . . . . 'X-RAY DIFFRACTION' . 1.9010 2.0923 2454 0.1339 99.00 0.1588 . . 135 . . . . 'X-RAY DIFFRACTION' . 2.0923 2.3950 2480 0.1363 100.00 0.1569 . . 154 . . . . 'X-RAY DIFFRACTION' . 2.3950 3.0173 2491 0.1574 99.00 0.1743 . . 150 . . . . 'X-RAY DIFFRACTION' . 3.0173 37.6651 2624 0.1580 99.00 0.1902 . . 130 . . . . # _struct.entry_id 5GH9 _struct.title 'Crystal structure of CBP Bromodomain with H3K56ac peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5GH9 _struct_keywords.text 'H3K56ac Bromodomain, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP CBP_HUMAN Q92793 ? 1 ;RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLM FNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL ; 1081 2 UNP K7EMV3_HUMAN K7EMV3 ? 2 GTVALREIRRYQKS 45 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5GH9 A 3 ? 118 ? Q92793 1081 ? 1196 ? 1081 1196 2 2 5GH9 B 1 ? 14 ? K7EMV3 45 ? 58 ? 79 92 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5GH9 HIS A 1 ? UNP Q92793 ? ? 'expression tag' 1079 1 1 5GH9 MET A 2 ? UNP Q92793 ? ? 'expression tag' 1080 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1080 ? 1 MORE -4 ? 1 'SSA (A^2)' 7050 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 8 ? ARG A 25 ? LYS A 1086 ARG A 1103 1 ? 18 HELX_P HELX_P2 AA2 SER A 30 ? ARG A 34 ? SER A 1108 ARG A 1112 5 ? 5 HELX_P HELX_P3 AA3 ASP A 38 ? GLY A 43 ? ASP A 1116 GLY A 1121 1 ? 6 HELX_P HELX_P4 AA4 ASP A 46 ? VAL A 51 ? ASP A 1124 VAL A 1129 1 ? 6 HELX_P HELX_P5 AA5 ASP A 56 ? THR A 66 ? ASP A 1134 THR A 1144 1 ? 11 HELX_P HELX_P6 AA6 GLU A 71 ? ASN A 90 ? GLU A 1149 ASN A 1168 1 ? 20 HELX_P HELX_P7 AA7 SER A 94 ? LEU A 118 ? SER A 1172 LEU A 1196 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B GLN 12 C ? ? ? 1_555 B ALY 13 N ? ? B GLN 90 B ALY 91 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? B ALY 13 C ? ? ? 1_555 B SER 14 N ? ? B ALY 91 B SER 92 1_555 ? ? ? ? ? ? ? 1.331 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id ALY _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 13 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id ALY _pdbx_modification_feature.auth_asym_id B _pdbx_modification_feature.auth_seq_id 91 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id LYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id ALY _pdbx_modification_feature.type Acetylation _pdbx_modification_feature.category 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 27 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 1105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 28 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 1106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 12.34 # _pdbx_entry_details.entry_id 5GH9 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 1265 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 1269 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id ALY _pdbx_struct_mod_residue.label_seq_id 13 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id ALY _pdbx_struct_mod_residue.auth_seq_id 91 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 1079 ? A HIS 1 2 1 Y 1 A MET 1080 ? A MET 2 3 1 Y 1 A ARG 1081 ? A ARG 3 4 1 Y 1 A LYS 1082 ? A LYS 4 5 1 Y 1 A LYS 1083 ? A LYS 5 6 1 Y 1 B GLY 79 ? B GLY 1 7 1 Y 1 B THR 80 ? B THR 2 8 1 Y 1 B VAL 81 ? B VAL 3 9 1 Y 1 B ALA 82 ? B ALA 4 10 1 Y 1 B LEU 83 ? B LEU 5 11 1 Y 1 B ARG 84 ? B ARG 6 12 1 Y 1 B GLU 85 ? B GLU 7 13 1 Y 1 B ILE 86 ? B ILE 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ALY OH O N N 14 ALY CH C N N 15 ALY CH3 C N N 16 ALY NZ N N N 17 ALY CE C N N 18 ALY CD C N N 19 ALY CG C N N 20 ALY CB C N N 21 ALY CA C N S 22 ALY N N N N 23 ALY C C N N 24 ALY O O N N 25 ALY OXT O N N 26 ALY HH31 H N N 27 ALY HH32 H N N 28 ALY HH33 H N N 29 ALY HZ H N N 30 ALY HE3 H N N 31 ALY HE2 H N N 32 ALY HD3 H N N 33 ALY HD2 H N N 34 ALY HG3 H N N 35 ALY HG2 H N N 36 ALY HB3 H N N 37 ALY HB2 H N N 38 ALY HA H N N 39 ALY H H N N 40 ALY H2 H N N 41 ALY HXT H N N 42 ARG N N N N 43 ARG CA C N S 44 ARG C C N N 45 ARG O O N N 46 ARG CB C N N 47 ARG CG C N N 48 ARG CD C N N 49 ARG NE N N N 50 ARG CZ C N N 51 ARG NH1 N N N 52 ARG NH2 N N N 53 ARG OXT O N N 54 ARG H H N N 55 ARG H2 H N N 56 ARG HA H N N 57 ARG HB2 H N N 58 ARG HB3 H N N 59 ARG HG2 H N N 60 ARG HG3 H N N 61 ARG HD2 H N N 62 ARG HD3 H N N 63 ARG HE H N N 64 ARG HH11 H N N 65 ARG HH12 H N N 66 ARG HH21 H N N 67 ARG HH22 H N N 68 ARG HXT H N N 69 ASN N N N N 70 ASN CA C N S 71 ASN C C N N 72 ASN O O N N 73 ASN CB C N N 74 ASN CG C N N 75 ASN OD1 O N N 76 ASN ND2 N N N 77 ASN OXT O N N 78 ASN H H N N 79 ASN H2 H N N 80 ASN HA H N N 81 ASN HB2 H N N 82 ASN HB3 H N N 83 ASN HD21 H N N 84 ASN HD22 H N N 85 ASN HXT H N N 86 ASP N N N N 87 ASP CA C N S 88 ASP C C N N 89 ASP O O N N 90 ASP CB C N N 91 ASP CG C N N 92 ASP OD1 O N N 93 ASP OD2 O N N 94 ASP OXT O N N 95 ASP H H N N 96 ASP H2 H N N 97 ASP HA H N N 98 ASP HB2 H N N 99 ASP HB3 H N N 100 ASP HD2 H N N 101 ASP HXT H N N 102 CYS N N N N 103 CYS CA C N R 104 CYS C C N N 105 CYS O O N N 106 CYS CB C N N 107 CYS SG S N N 108 CYS OXT O N N 109 CYS H H N N 110 CYS H2 H N N 111 CYS HA H N N 112 CYS HB2 H N N 113 CYS HB3 H N N 114 CYS HG H N N 115 CYS HXT H N N 116 GLN N N N N 117 GLN CA C N S 118 GLN C C N N 119 GLN O O N N 120 GLN CB C N N 121 GLN CG C N N 122 GLN CD C N N 123 GLN OE1 O N N 124 GLN NE2 N N N 125 GLN OXT O N N 126 GLN H H N N 127 GLN H2 H N N 128 GLN HA H N N 129 GLN HB2 H N N 130 GLN HB3 H N N 131 GLN HG2 H N N 132 GLN HG3 H N N 133 GLN HE21 H N N 134 GLN HE22 H N N 135 GLN HXT H N N 136 GLU N N N N 137 GLU CA C N S 138 GLU C C N N 139 GLU O O N N 140 GLU CB C N N 141 GLU CG C N N 142 GLU CD C N N 143 GLU OE1 O N N 144 GLU OE2 O N N 145 GLU OXT O N N 146 GLU H H N N 147 GLU H2 H N N 148 GLU HA H N N 149 GLU HB2 H N N 150 GLU HB3 H N N 151 GLU HG2 H N N 152 GLU HG3 H N N 153 GLU HE2 H N N 154 GLU HXT H N N 155 GLY N N N N 156 GLY CA C N N 157 GLY C C N N 158 GLY O O N N 159 GLY OXT O N N 160 GLY H H N N 161 GLY H2 H N N 162 GLY HA2 H N N 163 GLY HA3 H N N 164 GLY HXT H N N 165 HIS N N N N 166 HIS CA C N S 167 HIS C C N N 168 HIS O O N N 169 HIS CB C N N 170 HIS CG C Y N 171 HIS ND1 N Y N 172 HIS CD2 C Y N 173 HIS CE1 C Y N 174 HIS NE2 N Y N 175 HIS OXT O N N 176 HIS H H N N 177 HIS H2 H N N 178 HIS HA H N N 179 HIS HB2 H N N 180 HIS HB3 H N N 181 HIS HD1 H N N 182 HIS HD2 H N N 183 HIS HE1 H N N 184 HIS HE2 H N N 185 HIS HXT H N N 186 HOH O O N N 187 HOH H1 H N N 188 HOH H2 H N N 189 ILE N N N N 190 ILE CA C N S 191 ILE C C N N 192 ILE O O N N 193 ILE CB C N S 194 ILE CG1 C N N 195 ILE CG2 C N N 196 ILE CD1 C N N 197 ILE OXT O N N 198 ILE H H N N 199 ILE H2 H N N 200 ILE HA H N N 201 ILE HB H N N 202 ILE HG12 H N N 203 ILE HG13 H N N 204 ILE HG21 H N N 205 ILE HG22 H N N 206 ILE HG23 H N N 207 ILE HD11 H N N 208 ILE HD12 H N N 209 ILE HD13 H N N 210 ILE HXT H N N 211 LEU N N N N 212 LEU CA C N S 213 LEU C C N N 214 LEU O O N N 215 LEU CB C N N 216 LEU CG C N N 217 LEU CD1 C N N 218 LEU CD2 C N N 219 LEU OXT O N N 220 LEU H H N N 221 LEU H2 H N N 222 LEU HA H N N 223 LEU HB2 H N N 224 LEU HB3 H N N 225 LEU HG H N N 226 LEU HD11 H N N 227 LEU HD12 H N N 228 LEU HD13 H N N 229 LEU HD21 H N N 230 LEU HD22 H N N 231 LEU HD23 H N N 232 LEU HXT H N N 233 LYS N N N N 234 LYS CA C N S 235 LYS C C N N 236 LYS O O N N 237 LYS CB C N N 238 LYS CG C N N 239 LYS CD C N N 240 LYS CE C N N 241 LYS NZ N N N 242 LYS OXT O N N 243 LYS H H N N 244 LYS H2 H N N 245 LYS HA H N N 246 LYS HB2 H N N 247 LYS HB3 H N N 248 LYS HG2 H N N 249 LYS HG3 H N N 250 LYS HD2 H N N 251 LYS HD3 H N N 252 LYS HE2 H N N 253 LYS HE3 H N N 254 LYS HZ1 H N N 255 LYS HZ2 H N N 256 LYS HZ3 H N N 257 LYS HXT H N N 258 MET N N N N 259 MET CA C N S 260 MET C C N N 261 MET O O N N 262 MET CB C N N 263 MET CG C N N 264 MET SD S N N 265 MET CE C N N 266 MET OXT O N N 267 MET H H N N 268 MET H2 H N N 269 MET HA H N N 270 MET HB2 H N N 271 MET HB3 H N N 272 MET HG2 H N N 273 MET HG3 H N N 274 MET HE1 H N N 275 MET HE2 H N N 276 MET HE3 H N N 277 MET HXT H N N 278 PHE N N N N 279 PHE CA C N S 280 PHE C C N N 281 PHE O O N N 282 PHE CB C N N 283 PHE CG C Y N 284 PHE CD1 C Y N 285 PHE CD2 C Y N 286 PHE CE1 C Y N 287 PHE CE2 C Y N 288 PHE CZ C Y N 289 PHE OXT O N N 290 PHE H H N N 291 PHE H2 H N N 292 PHE HA H N N 293 PHE HB2 H N N 294 PHE HB3 H N N 295 PHE HD1 H N N 296 PHE HD2 H N N 297 PHE HE1 H N N 298 PHE HE2 H N N 299 PHE HZ H N N 300 PHE HXT H N N 301 PRO N N N N 302 PRO CA C N S 303 PRO C C N N 304 PRO O O N N 305 PRO CB C N N 306 PRO CG C N N 307 PRO CD C N N 308 PRO OXT O N N 309 PRO H H N N 310 PRO HA H N N 311 PRO HB2 H N N 312 PRO HB3 H N N 313 PRO HG2 H N N 314 PRO HG3 H N N 315 PRO HD2 H N N 316 PRO HD3 H N N 317 PRO HXT H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TRP N N N N 350 TRP CA C N S 351 TRP C C N N 352 TRP O O N N 353 TRP CB C N N 354 TRP CG C Y N 355 TRP CD1 C Y N 356 TRP CD2 C Y N 357 TRP NE1 N Y N 358 TRP CE2 C Y N 359 TRP CE3 C Y N 360 TRP CZ2 C Y N 361 TRP CZ3 C Y N 362 TRP CH2 C Y N 363 TRP OXT O N N 364 TRP H H N N 365 TRP H2 H N N 366 TRP HA H N N 367 TRP HB2 H N N 368 TRP HB3 H N N 369 TRP HD1 H N N 370 TRP HE1 H N N 371 TRP HE3 H N N 372 TRP HZ2 H N N 373 TRP HZ3 H N N 374 TRP HH2 H N N 375 TRP HXT H N N 376 TYR N N N N 377 TYR CA C N S 378 TYR C C N N 379 TYR O O N N 380 TYR CB C N N 381 TYR CG C Y N 382 TYR CD1 C Y N 383 TYR CD2 C Y N 384 TYR CE1 C Y N 385 TYR CE2 C Y N 386 TYR CZ C Y N 387 TYR OH O N N 388 TYR OXT O N N 389 TYR H H N N 390 TYR H2 H N N 391 TYR HA H N N 392 TYR HB2 H N N 393 TYR HB3 H N N 394 TYR HD1 H N N 395 TYR HD2 H N N 396 TYR HE1 H N N 397 TYR HE2 H N N 398 TYR HH H N N 399 TYR HXT H N N 400 VAL N N N N 401 VAL CA C N S 402 VAL C C N N 403 VAL O O N N 404 VAL CB C N N 405 VAL CG1 C N N 406 VAL CG2 C N N 407 VAL OXT O N N 408 VAL H H N N 409 VAL H2 H N N 410 VAL HA H N N 411 VAL HB H N N 412 VAL HG11 H N N 413 VAL HG12 H N N 414 VAL HG13 H N N 415 VAL HG21 H N N 416 VAL HG22 H N N 417 VAL HG23 H N N 418 VAL HXT H N N 419 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ALY OH CH doub N N 13 ALY CH CH3 sing N N 14 ALY CH NZ sing N N 15 ALY CH3 HH31 sing N N 16 ALY CH3 HH32 sing N N 17 ALY CH3 HH33 sing N N 18 ALY NZ CE sing N N 19 ALY NZ HZ sing N N 20 ALY CE CD sing N N 21 ALY CE HE3 sing N N 22 ALY CE HE2 sing N N 23 ALY CD CG sing N N 24 ALY CD HD3 sing N N 25 ALY CD HD2 sing N N 26 ALY CG CB sing N N 27 ALY CG HG3 sing N N 28 ALY CG HG2 sing N N 29 ALY CB CA sing N N 30 ALY CB HB3 sing N N 31 ALY CB HB2 sing N N 32 ALY CA N sing N N 33 ALY CA C sing N N 34 ALY CA HA sing N N 35 ALY N H sing N N 36 ALY N H2 sing N N 37 ALY C O doub N N 38 ALY C OXT sing N N 39 ALY OXT HXT sing N N 40 ARG N CA sing N N 41 ARG N H sing N N 42 ARG N H2 sing N N 43 ARG CA C sing N N 44 ARG CA CB sing N N 45 ARG CA HA sing N N 46 ARG C O doub N N 47 ARG C OXT sing N N 48 ARG CB CG sing N N 49 ARG CB HB2 sing N N 50 ARG CB HB3 sing N N 51 ARG CG CD sing N N 52 ARG CG HG2 sing N N 53 ARG CG HG3 sing N N 54 ARG CD NE sing N N 55 ARG CD HD2 sing N N 56 ARG CD HD3 sing N N 57 ARG NE CZ sing N N 58 ARG NE HE sing N N 59 ARG CZ NH1 sing N N 60 ARG CZ NH2 doub N N 61 ARG NH1 HH11 sing N N 62 ARG NH1 HH12 sing N N 63 ARG NH2 HH21 sing N N 64 ARG NH2 HH22 sing N N 65 ARG OXT HXT sing N N 66 ASN N CA sing N N 67 ASN N H sing N N 68 ASN N H2 sing N N 69 ASN CA C sing N N 70 ASN CA CB sing N N 71 ASN CA HA sing N N 72 ASN C O doub N N 73 ASN C OXT sing N N 74 ASN CB CG sing N N 75 ASN CB HB2 sing N N 76 ASN CB HB3 sing N N 77 ASN CG OD1 doub N N 78 ASN CG ND2 sing N N 79 ASN ND2 HD21 sing N N 80 ASN ND2 HD22 sing N N 81 ASN OXT HXT sing N N 82 ASP N CA sing N N 83 ASP N H sing N N 84 ASP N H2 sing N N 85 ASP CA C sing N N 86 ASP CA CB sing N N 87 ASP CA HA sing N N 88 ASP C O doub N N 89 ASP C OXT sing N N 90 ASP CB CG sing N N 91 ASP CB HB2 sing N N 92 ASP CB HB3 sing N N 93 ASP CG OD1 doub N N 94 ASP CG OD2 sing N N 95 ASP OD2 HD2 sing N N 96 ASP OXT HXT sing N N 97 CYS N CA sing N N 98 CYS N H sing N N 99 CYS N H2 sing N N 100 CYS CA C sing N N 101 CYS CA CB sing N N 102 CYS CA HA sing N N 103 CYS C O doub N N 104 CYS C OXT sing N N 105 CYS CB SG sing N N 106 CYS CB HB2 sing N N 107 CYS CB HB3 sing N N 108 CYS SG HG sing N N 109 CYS OXT HXT sing N N 110 GLN N CA sing N N 111 GLN N H sing N N 112 GLN N H2 sing N N 113 GLN CA C sing N N 114 GLN CA CB sing N N 115 GLN CA HA sing N N 116 GLN C O doub N N 117 GLN C OXT sing N N 118 GLN CB CG sing N N 119 GLN CB HB2 sing N N 120 GLN CB HB3 sing N N 121 GLN CG CD sing N N 122 GLN CG HG2 sing N N 123 GLN CG HG3 sing N N 124 GLN CD OE1 doub N N 125 GLN CD NE2 sing N N 126 GLN NE2 HE21 sing N N 127 GLN NE2 HE22 sing N N 128 GLN OXT HXT sing N N 129 GLU N CA sing N N 130 GLU N H sing N N 131 GLU N H2 sing N N 132 GLU CA C sing N N 133 GLU CA CB sing N N 134 GLU CA HA sing N N 135 GLU C O doub N N 136 GLU C OXT sing N N 137 GLU CB CG sing N N 138 GLU CB HB2 sing N N 139 GLU CB HB3 sing N N 140 GLU CG CD sing N N 141 GLU CG HG2 sing N N 142 GLU CG HG3 sing N N 143 GLU CD OE1 doub N N 144 GLU CD OE2 sing N N 145 GLU OE2 HE2 sing N N 146 GLU OXT HXT sing N N 147 GLY N CA sing N N 148 GLY N H sing N N 149 GLY N H2 sing N N 150 GLY CA C sing N N 151 GLY CA HA2 sing N N 152 GLY CA HA3 sing N N 153 GLY C O doub N N 154 GLY C OXT sing N N 155 GLY OXT HXT sing N N 156 HIS N CA sing N N 157 HIS N H sing N N 158 HIS N H2 sing N N 159 HIS CA C sing N N 160 HIS CA CB sing N N 161 HIS CA HA sing N N 162 HIS C O doub N N 163 HIS C OXT sing N N 164 HIS CB CG sing N N 165 HIS CB HB2 sing N N 166 HIS CB HB3 sing N N 167 HIS CG ND1 sing Y N 168 HIS CG CD2 doub Y N 169 HIS ND1 CE1 doub Y N 170 HIS ND1 HD1 sing N N 171 HIS CD2 NE2 sing Y N 172 HIS CD2 HD2 sing N N 173 HIS CE1 NE2 sing Y N 174 HIS CE1 HE1 sing N N 175 HIS NE2 HE2 sing N N 176 HIS OXT HXT sing N N 177 HOH O H1 sing N N 178 HOH O H2 sing N N 179 ILE N CA sing N N 180 ILE N H sing N N 181 ILE N H2 sing N N 182 ILE CA C sing N N 183 ILE CA CB sing N N 184 ILE CA HA sing N N 185 ILE C O doub N N 186 ILE C OXT sing N N 187 ILE CB CG1 sing N N 188 ILE CB CG2 sing N N 189 ILE CB HB sing N N 190 ILE CG1 CD1 sing N N 191 ILE CG1 HG12 sing N N 192 ILE CG1 HG13 sing N N 193 ILE CG2 HG21 sing N N 194 ILE CG2 HG22 sing N N 195 ILE CG2 HG23 sing N N 196 ILE CD1 HD11 sing N N 197 ILE CD1 HD12 sing N N 198 ILE CD1 HD13 sing N N 199 ILE OXT HXT sing N N 200 LEU N CA sing N N 201 LEU N H sing N N 202 LEU N H2 sing N N 203 LEU CA C sing N N 204 LEU CA CB sing N N 205 LEU CA HA sing N N 206 LEU C O doub N N 207 LEU C OXT sing N N 208 LEU CB CG sing N N 209 LEU CB HB2 sing N N 210 LEU CB HB3 sing N N 211 LEU CG CD1 sing N N 212 LEU CG CD2 sing N N 213 LEU CG HG sing N N 214 LEU CD1 HD11 sing N N 215 LEU CD1 HD12 sing N N 216 LEU CD1 HD13 sing N N 217 LEU CD2 HD21 sing N N 218 LEU CD2 HD22 sing N N 219 LEU CD2 HD23 sing N N 220 LEU OXT HXT sing N N 221 LYS N CA sing N N 222 LYS N H sing N N 223 LYS N H2 sing N N 224 LYS CA C sing N N 225 LYS CA CB sing N N 226 LYS CA HA sing N N 227 LYS C O doub N N 228 LYS C OXT sing N N 229 LYS CB CG sing N N 230 LYS CB HB2 sing N N 231 LYS CB HB3 sing N N 232 LYS CG CD sing N N 233 LYS CG HG2 sing N N 234 LYS CG HG3 sing N N 235 LYS CD CE sing N N 236 LYS CD HD2 sing N N 237 LYS CD HD3 sing N N 238 LYS CE NZ sing N N 239 LYS CE HE2 sing N N 240 LYS CE HE3 sing N N 241 LYS NZ HZ1 sing N N 242 LYS NZ HZ2 sing N N 243 LYS NZ HZ3 sing N N 244 LYS OXT HXT sing N N 245 MET N CA sing N N 246 MET N H sing N N 247 MET N H2 sing N N 248 MET CA C sing N N 249 MET CA CB sing N N 250 MET CA HA sing N N 251 MET C O doub N N 252 MET C OXT sing N N 253 MET CB CG sing N N 254 MET CB HB2 sing N N 255 MET CB HB3 sing N N 256 MET CG SD sing N N 257 MET CG HG2 sing N N 258 MET CG HG3 sing N N 259 MET SD CE sing N N 260 MET CE HE1 sing N N 261 MET CE HE2 sing N N 262 MET CE HE3 sing N N 263 MET OXT HXT sing N N 264 PHE N CA sing N N 265 PHE N H sing N N 266 PHE N H2 sing N N 267 PHE CA C sing N N 268 PHE CA CB sing N N 269 PHE CA HA sing N N 270 PHE C O doub N N 271 PHE C OXT sing N N 272 PHE CB CG sing N N 273 PHE CB HB2 sing N N 274 PHE CB HB3 sing N N 275 PHE CG CD1 doub Y N 276 PHE CG CD2 sing Y N 277 PHE CD1 CE1 sing Y N 278 PHE CD1 HD1 sing N N 279 PHE CD2 CE2 doub Y N 280 PHE CD2 HD2 sing N N 281 PHE CE1 CZ doub Y N 282 PHE CE1 HE1 sing N N 283 PHE CE2 CZ sing Y N 284 PHE CE2 HE2 sing N N 285 PHE CZ HZ sing N N 286 PHE OXT HXT sing N N 287 PRO N CA sing N N 288 PRO N CD sing N N 289 PRO N H sing N N 290 PRO CA C sing N N 291 PRO CA CB sing N N 292 PRO CA HA sing N N 293 PRO C O doub N N 294 PRO C OXT sing N N 295 PRO CB CG sing N N 296 PRO CB HB2 sing N N 297 PRO CB HB3 sing N N 298 PRO CG CD sing N N 299 PRO CG HG2 sing N N 300 PRO CG HG3 sing N N 301 PRO CD HD2 sing N N 302 PRO CD HD3 sing N N 303 PRO OXT HXT sing N N 304 SER N CA sing N N 305 SER N H sing N N 306 SER N H2 sing N N 307 SER CA C sing N N 308 SER CA CB sing N N 309 SER CA HA sing N N 310 SER C O doub N N 311 SER C OXT sing N N 312 SER CB OG sing N N 313 SER CB HB2 sing N N 314 SER CB HB3 sing N N 315 SER OG HG sing N N 316 SER OXT HXT sing N N 317 THR N CA sing N N 318 THR N H sing N N 319 THR N H2 sing N N 320 THR CA C sing N N 321 THR CA CB sing N N 322 THR CA HA sing N N 323 THR C O doub N N 324 THR C OXT sing N N 325 THR CB OG1 sing N N 326 THR CB CG2 sing N N 327 THR CB HB sing N N 328 THR OG1 HG1 sing N N 329 THR CG2 HG21 sing N N 330 THR CG2 HG22 sing N N 331 THR CG2 HG23 sing N N 332 THR OXT HXT sing N N 333 TRP N CA sing N N 334 TRP N H sing N N 335 TRP N H2 sing N N 336 TRP CA C sing N N 337 TRP CA CB sing N N 338 TRP CA HA sing N N 339 TRP C O doub N N 340 TRP C OXT sing N N 341 TRP CB CG sing N N 342 TRP CB HB2 sing N N 343 TRP CB HB3 sing N N 344 TRP CG CD1 doub Y N 345 TRP CG CD2 sing Y N 346 TRP CD1 NE1 sing Y N 347 TRP CD1 HD1 sing N N 348 TRP CD2 CE2 doub Y N 349 TRP CD2 CE3 sing Y N 350 TRP NE1 CE2 sing Y N 351 TRP NE1 HE1 sing N N 352 TRP CE2 CZ2 sing Y N 353 TRP CE3 CZ3 doub Y N 354 TRP CE3 HE3 sing N N 355 TRP CZ2 CH2 doub Y N 356 TRP CZ2 HZ2 sing N N 357 TRP CZ3 CH2 sing Y N 358 TRP CZ3 HZ3 sing N N 359 TRP CH2 HH2 sing N N 360 TRP OXT HXT sing N N 361 TYR N CA sing N N 362 TYR N H sing N N 363 TYR N H2 sing N N 364 TYR CA C sing N N 365 TYR CA CB sing N N 366 TYR CA HA sing N N 367 TYR C O doub N N 368 TYR C OXT sing N N 369 TYR CB CG sing N N 370 TYR CB HB2 sing N N 371 TYR CB HB3 sing N N 372 TYR CG CD1 doub Y N 373 TYR CG CD2 sing Y N 374 TYR CD1 CE1 sing Y N 375 TYR CD1 HD1 sing N N 376 TYR CD2 CE2 doub Y N 377 TYR CD2 HD2 sing N N 378 TYR CE1 CZ doub Y N 379 TYR CE1 HE1 sing N N 380 TYR CE2 CZ sing Y N 381 TYR CE2 HE2 sing N N 382 TYR CZ OH sing N N 383 TYR OH HH sing N N 384 TYR OXT HXT sing N N 385 VAL N CA sing N N 386 VAL N H sing N N 387 VAL N H2 sing N N 388 VAL CA C sing N N 389 VAL CA CB sing N N 390 VAL CA HA sing N N 391 VAL C O doub N N 392 VAL C OXT sing N N 393 VAL CB CG1 sing N N 394 VAL CB CG2 sing N N 395 VAL CB HB sing N N 396 VAL CG1 HG11 sing N N 397 VAL CG1 HG12 sing N N 398 VAL CG1 HG13 sing N N 399 VAL CG2 HG21 sing N N 400 VAL CG2 HG22 sing N N 401 VAL CG2 HG23 sing N N 402 VAL OXT HXT sing N N 403 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4OUI _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5GH9 _atom_sites.fract_transf_matrix[1][1] 0.023350 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021819 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015143 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ # loop_ #