data_5GIT # _entry.id 5GIT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.303 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5GIT WWPDB D_1300000851 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5GIT _pdbx_database_status.recvd_initial_deposition_date 2016-06-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhu, L.L.' 1 'Li, H.L.' 2 'Wu, F.S.' 3 'Xiong, R.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Antioxid. Redox Signal.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1557-7716 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 754 _citation.page_last 768 _citation.title 'Britanin Ameliorates Cerebral Ischemia-Reperfusion Injury by Inducing the Nrf2 Protective Pathway.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1089/ars.2016.6885 _citation.pdbx_database_id_PubMed 28186440 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, G.Z.' 1 ? primary 'Zhu, L.L.' 2 ? primary 'Yuan, X.' 3 ? primary 'Chen, H.' 4 ? primary 'Xiong, R.' 5 ? primary 'Zhang, S.D.' 6 ? primary 'Cheng, H.' 7 ? primary 'Shen, Y.H.' 8 ? primary 'An, H.Z.' 9 ? primary 'Li, T.J.' 10 ? primary 'Li, H.L.' 11 ? primary 'Zhang, W.D.' 12 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5GIT _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.450 _cell.length_a_esd ? _cell.length_b 42.450 _cell.length_b_esd ? _cell.length_c 265.150 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5GIT _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Kelch-like ECH-associated protein 1' 15293.651 1 ? ? 'BTB, UNP residues 48-180' ? 2 non-polymer syn ;[(3aS,5R,5aS,6S,8S,8aS,9S,9aR)-9-acetyloxy-8-hydroxy-5,8a-dimethyl-1-methylidene-2-oxo-4,5,5a,6,7,8,9,9a-octahydro-3aH-azuleno[6,5-b]furan-6-yl] acetate ; 366.406 1 ? ? ? ? 3 water nat water 18.015 32 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Keap 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVV SIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACADFLVQQLD ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVV SIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACADFLVQQLD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 ASN n 1 7 ARG n 1 8 THR n 1 9 PHE n 1 10 SER n 1 11 TYR n 1 12 THR n 1 13 LEU n 1 14 GLU n 1 15 ASP n 1 16 HIS n 1 17 THR n 1 18 LYS n 1 19 GLN n 1 20 ALA n 1 21 PHE n 1 22 GLY n 1 23 ILE n 1 24 MET n 1 25 ASN n 1 26 GLU n 1 27 LEU n 1 28 ARG n 1 29 LEU n 1 30 SER n 1 31 GLN n 1 32 GLN n 1 33 LEU n 1 34 CYS n 1 35 ASP n 1 36 VAL n 1 37 THR n 1 38 LEU n 1 39 GLN n 1 40 VAL n 1 41 LYS n 1 42 TYR n 1 43 GLN n 1 44 ASP n 1 45 ALA n 1 46 PRO n 1 47 ALA n 1 48 ALA n 1 49 GLN n 1 50 PHE n 1 51 MET n 1 52 ALA n 1 53 HIS n 1 54 LYS n 1 55 VAL n 1 56 VAL n 1 57 LEU n 1 58 ALA n 1 59 SER n 1 60 SER n 1 61 SER n 1 62 PRO n 1 63 VAL n 1 64 PHE n 1 65 LYS n 1 66 ALA n 1 67 MET n 1 68 PHE n 1 69 THR n 1 70 ASN n 1 71 GLY n 1 72 LEU n 1 73 ARG n 1 74 GLU n 1 75 GLN n 1 76 GLY n 1 77 MET n 1 78 GLU n 1 79 VAL n 1 80 VAL n 1 81 SER n 1 82 ILE n 1 83 GLU n 1 84 GLY n 1 85 ILE n 1 86 HIS n 1 87 PRO n 1 88 LYS n 1 89 VAL n 1 90 MET n 1 91 GLU n 1 92 ARG n 1 93 LEU n 1 94 ILE n 1 95 GLU n 1 96 PHE n 1 97 ALA n 1 98 TYR n 1 99 THR n 1 100 ALA n 1 101 SER n 1 102 ILE n 1 103 SER n 1 104 MET n 1 105 GLY n 1 106 GLU n 1 107 LYS n 1 108 CYS n 1 109 VAL n 1 110 LEU n 1 111 HIS n 1 112 VAL n 1 113 MET n 1 114 ASN n 1 115 GLY n 1 116 ALA n 1 117 VAL n 1 118 MET n 1 119 TYR n 1 120 GLN n 1 121 ILE n 1 122 ASP n 1 123 SER n 1 124 VAL n 1 125 VAL n 1 126 ARG n 1 127 ALA n 1 128 CYS n 1 129 ALA n 1 130 ASP n 1 131 PHE n 1 132 LEU n 1 133 VAL n 1 134 GLN n 1 135 GLN n 1 136 LEU n 1 137 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 137 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene KEAP1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KEAP1_HUMAN _struct_ref.pdbx_db_accession Q14145 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEG IHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD ; _struct_ref.pdbx_align_begin 48 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5GIT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 137 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14145 _struct_ref_seq.db_align_beg 48 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 180 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 48 _struct_ref_seq.pdbx_auth_seq_align_end 180 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5GIT GLY A 1 ? UNP Q14145 ? ? 'expression tag' 44 1 1 5GIT SER A 2 ? UNP Q14145 ? ? 'expression tag' 45 2 1 5GIT HIS A 3 ? UNP Q14145 ? ? 'expression tag' 46 3 1 5GIT MET A 4 ? UNP Q14145 ? ? 'expression tag' 47 4 1 5GIT ALA A 129 ? UNP Q14145 SER 172 conflict 172 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XXT non-polymer . ;[(3aS,5R,5aS,6S,8S,8aS,9S,9aR)-9-acetyloxy-8-hydroxy-5,8a-dimethyl-1-methylidene-2-oxo-4,5,5a,6,7,8,9,9a-octahydro-3aH-azuleno[6,5-b]furan-6-yl] acetate ; Britannin 'C19 H26 O7' 366.406 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5GIT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.25 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M lithium acetate, 16% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-19 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5GIT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.19 _reflns.d_resolution_low 36.76 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8098 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.03 _refine.aniso_B[1][2] -0.01 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.03 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 0.08 _refine.B_iso_max ? _refine.B_iso_mean 58.168 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.948 _refine.correlation_coeff_Fo_to_Fc_free 0.919 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5GIT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.19 _refine.ls_d_res_low 36.76 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7638 _refine.ls_number_reflns_R_free 439 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.24 _refine.ls_percent_reflns_R_free 5.4 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.21969 _refine.ls_R_factor_R_free 0.27809 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.21631 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.274 _refine.pdbx_overall_ESU_R_Free 0.233 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.833 _refine.overall_SU_ML 0.174 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1014 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 1072 _refine_hist.d_res_high 2.19 _refine_hist.d_res_low 36.76 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 0.019 1060 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1025 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.782 1.982 1435 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.891 3.001 2355 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.242 5.000 129 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.589 25.000 46 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.684 15.000 186 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 26.534 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.103 0.200 170 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1177 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 235 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 5.086 5.402 519 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.046 5.398 518 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 7.606 8.060 647 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.609 8.068 648 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.758 6.258 540 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.754 6.267 541 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.700 9.126 789 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 11.046 42.038 1166 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 11.047 42.100 1167 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.190 _refine_ls_shell.d_res_low 2.247 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 27 _refine_ls_shell.number_reflns_R_work 561 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.265 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.238 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5GIT _struct.title 'BTB domain of KEAP1 in complex with XX3' _struct.pdbx_descriptor 'Kelch-like ECH-associated protein 1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5GIT _struct_keywords.text 'SIGNALING PROTEIN, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 15 ? SER A 30 ? ASP A 58 SER A 73 1 ? 16 HELX_P HELX_P2 AA2 HIS A 53 ? SER A 61 ? HIS A 96 SER A 104 1 ? 9 HELX_P HELX_P3 AA3 SER A 61 ? THR A 69 ? SER A 104 THR A 112 1 ? 9 HELX_P HELX_P4 AA4 HIS A 86 ? ALA A 100 ? HIS A 129 ALA A 143 1 ? 15 HELX_P HELX_P5 AA5 GLY A 105 ? LYS A 107 ? GLY A 148 LYS A 150 5 ? 3 HELX_P HELX_P6 AA6 CYS A 108 ? TYR A 119 ? CYS A 151 TYR A 162 1 ? 12 HELX_P HELX_P7 AA7 ILE A 121 ? GLN A 135 ? ILE A 164 GLN A 178 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 108 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id XXT _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C14 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 151 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id XXT _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.846 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 48 ? ALA A 52 ? ALA A 91 ALA A 95 AA1 2 VAL A 36 ? VAL A 40 ? VAL A 79 VAL A 83 AA1 3 GLU A 78 ? ILE A 82 ? GLU A 121 ILE A 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 50 ? O PHE A 93 N LEU A 38 ? N LEU A 81 AA1 2 3 N GLN A 39 ? N GLN A 82 O VAL A 80 ? O VAL A 123 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id XXT _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue XXT A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ARG A 92 ? ARG A 135 . ? 1_555 ? 2 AC1 3 LYS A 107 ? LYS A 150 . ? 1_555 ? 3 AC1 3 CYS A 108 ? CYS A 151 . ? 1_555 ? # _atom_sites.entry_id 5GIT _atom_sites.fract_transf_matrix[1][1] 0.023557 _atom_sites.fract_transf_matrix[1][2] 0.013601 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027201 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003771 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 44 ? ? ? A . n A 1 2 SER 2 45 ? ? ? A . n A 1 3 HIS 3 46 ? ? ? A . n A 1 4 MET 4 47 ? ? ? A . n A 1 5 GLY 5 48 ? ? ? A . n A 1 6 ASN 6 49 ? ? ? A . n A 1 7 ARG 7 50 ? ? ? A . n A 1 8 THR 8 51 51 THR THR A . n A 1 9 PHE 9 52 52 PHE PHE A . n A 1 10 SER 10 53 53 SER SER A . n A 1 11 TYR 11 54 54 TYR TYR A . n A 1 12 THR 12 55 55 THR THR A . n A 1 13 LEU 13 56 56 LEU LEU A . n A 1 14 GLU 14 57 57 GLU GLU A . n A 1 15 ASP 15 58 58 ASP ASP A . n A 1 16 HIS 16 59 59 HIS HIS A . n A 1 17 THR 17 60 60 THR THR A . n A 1 18 LYS 18 61 61 LYS LYS A . n A 1 19 GLN 19 62 62 GLN GLN A . n A 1 20 ALA 20 63 63 ALA ALA A . n A 1 21 PHE 21 64 64 PHE PHE A . n A 1 22 GLY 22 65 65 GLY GLY A . n A 1 23 ILE 23 66 66 ILE ILE A . n A 1 24 MET 24 67 67 MET MET A . n A 1 25 ASN 25 68 68 ASN ASN A . n A 1 26 GLU 26 69 69 GLU GLU A . n A 1 27 LEU 27 70 70 LEU LEU A . n A 1 28 ARG 28 71 71 ARG ARG A . n A 1 29 LEU 29 72 72 LEU LEU A . n A 1 30 SER 30 73 73 SER SER A . n A 1 31 GLN 31 74 74 GLN GLN A . n A 1 32 GLN 32 75 75 GLN GLN A . n A 1 33 LEU 33 76 76 LEU LEU A . n A 1 34 CYS 34 77 77 CYS CYS A . n A 1 35 ASP 35 78 78 ASP ASP A . n A 1 36 VAL 36 79 79 VAL VAL A . n A 1 37 THR 37 80 80 THR THR A . n A 1 38 LEU 38 81 81 LEU LEU A . n A 1 39 GLN 39 82 82 GLN GLN A . n A 1 40 VAL 40 83 83 VAL VAL A . n A 1 41 LYS 41 84 84 LYS LYS A . n A 1 42 TYR 42 85 85 TYR TYR A . n A 1 43 GLN 43 86 86 GLN GLN A . n A 1 44 ASP 44 87 87 ASP ASP A . n A 1 45 ALA 45 88 88 ALA ALA A . n A 1 46 PRO 46 89 89 PRO PRO A . n A 1 47 ALA 47 90 90 ALA ALA A . n A 1 48 ALA 48 91 91 ALA ALA A . n A 1 49 GLN 49 92 92 GLN GLN A . n A 1 50 PHE 50 93 93 PHE PHE A . n A 1 51 MET 51 94 94 MET MET A . n A 1 52 ALA 52 95 95 ALA ALA A . n A 1 53 HIS 53 96 96 HIS HIS A . n A 1 54 LYS 54 97 97 LYS LYS A . n A 1 55 VAL 55 98 98 VAL VAL A . n A 1 56 VAL 56 99 99 VAL VAL A . n A 1 57 LEU 57 100 100 LEU LEU A . n A 1 58 ALA 58 101 101 ALA ALA A . n A 1 59 SER 59 102 102 SER SER A . n A 1 60 SER 60 103 103 SER SER A . n A 1 61 SER 61 104 104 SER SER A . n A 1 62 PRO 62 105 105 PRO PRO A . n A 1 63 VAL 63 106 106 VAL VAL A . n A 1 64 PHE 64 107 107 PHE PHE A . n A 1 65 LYS 65 108 108 LYS LYS A . n A 1 66 ALA 66 109 109 ALA ALA A . n A 1 67 MET 67 110 110 MET MET A . n A 1 68 PHE 68 111 111 PHE PHE A . n A 1 69 THR 69 112 112 THR THR A . n A 1 70 ASN 70 113 113 ASN ASN A . n A 1 71 GLY 71 114 114 GLY GLY A . n A 1 72 LEU 72 115 115 LEU LEU A . n A 1 73 ARG 73 116 116 ARG ARG A . n A 1 74 GLU 74 117 117 GLU GLU A . n A 1 75 GLN 75 118 118 GLN GLN A . n A 1 76 GLY 76 119 119 GLY GLY A . n A 1 77 MET 77 120 120 MET MET A . n A 1 78 GLU 78 121 121 GLU GLU A . n A 1 79 VAL 79 122 122 VAL VAL A . n A 1 80 VAL 80 123 123 VAL VAL A . n A 1 81 SER 81 124 124 SER SER A . n A 1 82 ILE 82 125 125 ILE ILE A . n A 1 83 GLU 83 126 126 GLU GLU A . n A 1 84 GLY 84 127 127 GLY GLY A . n A 1 85 ILE 85 128 128 ILE ILE A . n A 1 86 HIS 86 129 129 HIS HIS A . n A 1 87 PRO 87 130 130 PRO PRO A . n A 1 88 LYS 88 131 131 LYS LYS A . n A 1 89 VAL 89 132 132 VAL VAL A . n A 1 90 MET 90 133 133 MET MET A . n A 1 91 GLU 91 134 134 GLU GLU A . n A 1 92 ARG 92 135 135 ARG ARG A . n A 1 93 LEU 93 136 136 LEU LEU A . n A 1 94 ILE 94 137 137 ILE ILE A . n A 1 95 GLU 95 138 138 GLU GLU A . n A 1 96 PHE 96 139 139 PHE PHE A . n A 1 97 ALA 97 140 140 ALA ALA A . n A 1 98 TYR 98 141 141 TYR TYR A . n A 1 99 THR 99 142 142 THR THR A . n A 1 100 ALA 100 143 143 ALA ALA A . n A 1 101 SER 101 144 144 SER SER A . n A 1 102 ILE 102 145 145 ILE ILE A . n A 1 103 SER 103 146 146 SER SER A . n A 1 104 MET 104 147 147 MET MET A . n A 1 105 GLY 105 148 148 GLY GLY A . n A 1 106 GLU 106 149 149 GLU GLU A . n A 1 107 LYS 107 150 150 LYS LYS A . n A 1 108 CYS 108 151 151 CYS CYS A . n A 1 109 VAL 109 152 152 VAL VAL A . n A 1 110 LEU 110 153 153 LEU LEU A . n A 1 111 HIS 111 154 154 HIS HIS A . n A 1 112 VAL 112 155 155 VAL VAL A . n A 1 113 MET 113 156 156 MET MET A . n A 1 114 ASN 114 157 157 ASN ASN A . n A 1 115 GLY 115 158 158 GLY GLY A . n A 1 116 ALA 116 159 159 ALA ALA A . n A 1 117 VAL 117 160 160 VAL VAL A . n A 1 118 MET 118 161 161 MET MET A . n A 1 119 TYR 119 162 162 TYR TYR A . n A 1 120 GLN 120 163 163 GLN GLN A . n A 1 121 ILE 121 164 164 ILE ILE A . n A 1 122 ASP 122 165 165 ASP ASP A . n A 1 123 SER 123 166 166 SER SER A . n A 1 124 VAL 124 167 167 VAL VAL A . n A 1 125 VAL 125 168 168 VAL VAL A . n A 1 126 ARG 126 169 169 ARG ARG A . n A 1 127 ALA 127 170 170 ALA ALA A . n A 1 128 CYS 128 171 171 CYS CYS A . n A 1 129 ALA 129 172 172 ALA ALA A . n A 1 130 ASP 130 173 173 ASP ASP A . n A 1 131 PHE 131 174 174 PHE PHE A . n A 1 132 LEU 132 175 175 LEU LEU A . n A 1 133 VAL 133 176 176 VAL VAL A . n A 1 134 GLN 134 177 177 GLN GLN A . n A 1 135 GLN 135 178 178 GLN GLN A . n A 1 136 LEU 136 179 179 LEU LEU A . n A 1 137 ASP 137 180 180 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 XXT 1 201 1 XXT XX3 A . C 3 HOH 1 301 11 HOH HOH A . C 3 HOH 2 302 24 HOH HOH A . C 3 HOH 3 303 34 HOH HOH A . C 3 HOH 4 304 4 HOH HOH A . C 3 HOH 5 305 1 HOH HOH A . C 3 HOH 6 306 6 HOH HOH A . C 3 HOH 7 307 2 HOH HOH A . C 3 HOH 8 308 10 HOH HOH A . C 3 HOH 9 309 32 HOH HOH A . C 3 HOH 10 310 30 HOH HOH A . C 3 HOH 11 311 15 HOH HOH A . C 3 HOH 12 312 14 HOH HOH A . C 3 HOH 13 313 31 HOH HOH A . C 3 HOH 14 314 35 HOH HOH A . C 3 HOH 15 315 3 HOH HOH A . C 3 HOH 16 316 9 HOH HOH A . C 3 HOH 17 317 22 HOH HOH A . C 3 HOH 18 318 18 HOH HOH A . C 3 HOH 19 319 29 HOH HOH A . C 3 HOH 20 320 26 HOH HOH A . C 3 HOH 21 321 23 HOH HOH A . C 3 HOH 22 322 5 HOH HOH A . C 3 HOH 23 323 7 HOH HOH A . C 3 HOH 24 324 12 HOH HOH A . C 3 HOH 25 325 33 HOH HOH A . C 3 HOH 26 326 27 HOH HOH A . C 3 HOH 27 327 17 HOH HOH A . C 3 HOH 28 328 21 HOH HOH A . C 3 HOH 29 329 13 HOH HOH A . C 3 HOH 30 330 28 HOH HOH A . C 3 HOH 31 331 16 HOH HOH A . C 3 HOH 32 332 20 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8670 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 328 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-28 2 'Structure model' 1 1 2019-01-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 86 ? ? 28.21 -100.21 2 1 GLU A 117 ? ? -49.89 153.44 3 1 ASP A 165 ? ? -23.18 -61.04 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 44 ? A GLY 1 2 1 Y 1 A SER 45 ? A SER 2 3 1 Y 1 A HIS 46 ? A HIS 3 4 1 Y 1 A MET 47 ? A MET 4 5 1 Y 1 A GLY 48 ? A GLY 5 6 1 Y 1 A ASN 49 ? A ASN 6 7 1 Y 1 A ARG 50 ? A ARG 7 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;[(3aS,5R,5aS,6S,8S,8aS,9S,9aR)-9-acetyloxy-8-hydroxy-5,8a-dimethyl-1-methylidene-2-oxo-4,5,5a,6,7,8,9,9a-octahydro-3aH-azuleno[6,5-b]furan-6-yl] acetate ; XXT 3 water HOH #