data_5GVQ # _entry.id 5GVQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5GVQ WWPDB D_1300001189 BMRB 36018 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2017-04-12 _pdbx_database_PDB_obs_spr.pdb_id 5GVQ _pdbx_database_PDB_obs_spr.replace_pdb_id 1X5U _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 1x5u re-refinement BMRB . 36018 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5GVQ _pdbx_database_status.recvd_initial_deposition_date 2016-09-06 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kuwasako, K.' 1 ? 'Nameki, N.' 2 ? 'Tsuda, K.' 3 ? 'Takahashi, M.' 4 ? 'Sato, A.' 5 ? 'Tochio, N.' 6 ? 'Inoue, M.' 7 ? 'Terada, T.' 8 ? 'Kigawa, T.' 9 ? 'Kobayashi, N.' 10 ? 'Shirouzu, M.' 11 ? 'Ito, T.' 12 ? 'Sakamoto, T.' 13 ? 'Wakamatsu, K.' 14 ? 'Guntert, P.' 15 ? 'Takahashi, S.' 16 ? 'Yokoyama, S.' 17 ? 'Muto, Y.' 18 ? 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 19 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 26 _citation.language ? _citation.page_first 280 _citation.page_last 291 _citation.title ;Solution structure of the first RNA recognition motif domain of human spliceosomal protein SF3b49 and its mode of interaction with a SF3b145 fragment. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.3080 _citation.pdbx_database_id_PubMed 27862552 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kuwasako, K.' 1 primary 'Nameki, N.' 2 primary 'Tsuda, K.' 3 primary 'Takahashi, M.' 4 primary 'Sato, A.' 5 primary 'Tochio, N.' 6 primary 'Inoue, M.' 7 primary 'Terada, T.' 8 primary 'Kigawa, T.' 9 primary 'Kobayashi, N.' 10 primary 'Shirouzu, M.' 11 primary 'Ito, T.' 12 primary 'Sakamoto, T.' 13 primary 'Wakamatsu, K.' 14 primary 'Guntert, P.' 15 primary 'Takahashi, S.' 16 primary 'Yokoyama, S.' 17 primary 'Muto, Y.' 18 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Splicing factor 3B subunit 4' _entity.formula_weight 11378.703 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'spliceosomal protein SF3b49, Pre-mRNA-splicing factor SF3b 49 kDa subunit,Spliceosome-associated protein 49,SAP 49' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMDMI KLYGKPIRVNKASAHNKNLSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMDMI KLYGKPIRVNKASAHNKNLSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 ILE n 1 10 SER n 1 11 GLU n 1 12 ARG n 1 13 ASN n 1 14 GLN n 1 15 ASP n 1 16 ALA n 1 17 THR n 1 18 VAL n 1 19 TYR n 1 20 VAL n 1 21 GLY n 1 22 GLY n 1 23 LEU n 1 24 ASP n 1 25 GLU n 1 26 LYS n 1 27 VAL n 1 28 SER n 1 29 GLU n 1 30 PRO n 1 31 LEU n 1 32 LEU n 1 33 TRP n 1 34 GLU n 1 35 LEU n 1 36 PHE n 1 37 LEU n 1 38 GLN n 1 39 ALA n 1 40 GLY n 1 41 PRO n 1 42 VAL n 1 43 VAL n 1 44 ASN n 1 45 THR n 1 46 HIS n 1 47 MET n 1 48 PRO n 1 49 LYS n 1 50 ASP n 1 51 ARG n 1 52 VAL n 1 53 THR n 1 54 GLY n 1 55 GLN n 1 56 HIS n 1 57 GLN n 1 58 GLY n 1 59 TYR n 1 60 GLY n 1 61 PHE n 1 62 VAL n 1 63 GLU n 1 64 PHE n 1 65 LEU n 1 66 SER n 1 67 GLU n 1 68 GLU n 1 69 ASP n 1 70 ALA n 1 71 ASP n 1 72 TYR n 1 73 ALA n 1 74 ILE n 1 75 LYS n 1 76 ILE n 1 77 MET n 1 78 ASP n 1 79 MET n 1 80 ILE n 1 81 LYS n 1 82 LEU n 1 83 TYR n 1 84 GLY n 1 85 LYS n 1 86 PRO n 1 87 ILE n 1 88 ARG n 1 89 VAL n 1 90 ASN n 1 91 LYS n 1 92 ALA n 1 93 SER n 1 94 ALA n 1 95 HIS n 1 96 ASN n 1 97 LYS n 1 98 ASN n 1 99 LEU n 1 100 SER n 1 101 GLY n 1 102 PRO n 1 103 SER n 1 104 SER n 1 105 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 105 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SF3B4, SAP49' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5GVQ _struct_ref.pdbx_db_accession 5GVQ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5GVQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5GVQ _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 1 isotropic 2 1 1 '3D 1H-13C NOESY' 1 isotropic 3 1 1 '2D 1H-15N HSQC' 1 isotropic 4 1 1 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condistions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8 mM [U-100% 13C; U-100% 15N] human spliceosomal protein SF3b49, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 5GVQ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 5GVQ _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5GVQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement AMBER ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'data analysis' kujira ? 'Kobayashi N' 4 'data analysis' NMRView ? 'Johnson, One Moon Scientific' 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5GVQ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5GVQ _struct.title 'Solution structure of the first RRM domain of human spliceosomal protein SF3b49' _struct.pdbx_descriptor 'Splicing factor 3B subunit 4' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5GVQ _struct_keywords.text 'RRM, SF3b49, SF3b145, U2 snRNP, RNA BINDING PROTEIN, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? SER A 5 ? GLY A 1 SER A 5 5 ? 5 HELX_P HELX_P2 AA2 SER A 28 ? LEU A 37 ? SER A 28 LEU A 37 1 ? 10 HELX_P HELX_P3 AA3 SER A 66 ? ASP A 78 ? SER A 66 ASP A 78 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 42 ? HIS A 46 ? VAL A 42 HIS A 46 AA1 2 TYR A 59 ? PHE A 64 ? TYR A 59 PHE A 64 AA1 3 THR A 17 ? GLY A 21 ? THR A 17 GLY A 21 AA1 4 ARG A 88 ? LYS A 91 ? ARG A 88 LYS A 91 AA2 1 LYS A 81 ? LEU A 82 ? LYS A 81 LEU A 82 AA2 2 LYS A 85 ? PRO A 86 ? LYS A 85 PRO A 86 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 43 ? N VAL A 43 O GLU A 63 ? O GLU A 63 AA1 2 3 O VAL A 62 ? O VAL A 62 N VAL A 18 ? N VAL A 18 AA1 3 4 N TYR A 19 ? N TYR A 19 O ASN A 90 ? O ASN A 90 AA2 1 2 N LEU A 82 ? N LEU A 82 O LYS A 85 ? O LYS A 85 # _atom_sites.entry_id 5GVQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLY 105 105 105 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7310 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2017-04-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'human spliceosomal protein SF3b49' _pdbx_nmr_exptl_sample.concentration 0.8 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.43 120.30 3.13 0.50 N 2 2 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.97 120.30 3.67 0.50 N 3 3 NE A ARG 88 ? ? CZ A ARG 88 ? ? NH1 A ARG 88 ? ? 123.53 120.30 3.23 0.50 N 4 16 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.41 120.30 3.11 0.50 N 5 17 NE A ARG 88 ? ? CZ A ARG 88 ? ? NH1 A ARG 88 ? ? 123.47 120.30 3.17 0.50 N 6 20 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.84 120.30 3.54 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 52 ? ? -131.31 -37.36 2 1 LYS A 81 ? ? -104.64 72.07 3 1 TYR A 83 ? ? 46.44 28.69 4 1 HIS A 95 ? ? -120.49 -69.99 5 2 VAL A 52 ? ? -135.01 -31.55 6 2 MET A 79 ? ? 59.03 13.97 7 2 LYS A 81 ? ? -113.70 71.01 8 2 TYR A 83 ? ? 46.89 28.55 9 2 ALA A 94 ? ? 40.64 75.76 10 3 ASN A 13 ? ? -69.31 98.19 11 3 VAL A 52 ? ? -132.16 -37.88 12 3 MET A 79 ? ? 59.88 11.81 13 3 LYS A 81 ? ? -108.86 70.52 14 4 GLN A 14 ? ? -145.78 -40.79 15 4 VAL A 52 ? ? -131.36 -37.48 16 4 LYS A 81 ? ? -118.83 71.23 17 4 TYR A 83 ? ? 46.27 27.58 18 4 LYS A 97 ? ? -81.98 44.63 19 5 VAL A 52 ? ? -132.06 -37.94 20 5 MET A 79 ? ? 58.26 9.58 21 5 TYR A 83 ? ? 45.97 27.18 22 5 LEU A 99 ? ? -152.72 -45.94 23 5 SER A 103 ? ? 62.00 169.40 24 6 ARG A 12 ? ? 48.64 -94.55 25 6 VAL A 52 ? ? -131.40 -38.79 26 6 LYS A 81 ? ? -100.61 70.54 27 6 TYR A 83 ? ? 45.85 27.44 28 6 ALA A 94 ? ? -78.38 46.13 29 7 GLU A 11 ? ? 58.63 -28.93 30 7 ASN A 13 ? ? 46.10 27.88 31 7 VAL A 52 ? ? -135.54 -31.53 32 7 LYS A 81 ? ? -119.90 69.52 33 7 TYR A 83 ? ? 46.17 27.37 34 8 ARG A 12 ? ? 45.35 -136.68 35 8 VAL A 52 ? ? -131.51 -38.56 36 8 LYS A 81 ? ? -117.91 71.52 37 8 TYR A 83 ? ? 45.82 29.90 38 9 VAL A 52 ? ? -132.91 -40.30 39 9 MET A 79 ? ? 58.21 13.38 40 9 LYS A 81 ? ? -113.28 71.42 41 9 TYR A 83 ? ? 47.01 28.61 42 9 LYS A 97 ? ? 60.97 166.89 43 10 SER A 6 ? ? 59.31 13.53 44 10 ASN A 13 ? ? -75.46 43.09 45 10 VAL A 52 ? ? -132.13 -37.44 46 10 MET A 79 ? ? 59.61 9.59 47 10 LYS A 81 ? ? -112.78 70.21 48 10 TYR A 83 ? ? 46.00 28.77 49 10 HIS A 95 ? ? -89.00 38.86 50 10 ASN A 96 ? ? -76.41 47.59 51 11 ARG A 12 ? ? 55.34 -168.88 52 11 ASN A 13 ? ? -85.95 30.09 53 11 VAL A 52 ? ? -131.12 -37.20 54 11 MET A 79 ? ? 58.31 10.47 55 11 LYS A 81 ? ? -112.06 69.98 56 11 SER A 104 ? ? 60.87 166.43 57 12 SER A 10 ? ? 59.79 -38.68 58 12 GLU A 11 ? ? -80.90 31.73 59 12 ARG A 12 ? ? -140.16 -55.41 60 12 ASN A 13 ? ? 48.79 24.33 61 12 VAL A 52 ? ? -136.28 -31.66 62 12 LYS A 81 ? ? -110.58 70.74 63 13 PRO A 8 ? ? -78.32 46.60 64 13 VAL A 52 ? ? -132.41 -37.70 65 13 ALA A 94 ? ? 53.28 18.57 66 14 ASN A 13 ? ? 55.70 -94.47 67 14 GLN A 14 ? ? 61.69 -4.27 68 14 VAL A 52 ? ? -130.24 -37.38 69 14 MET A 79 ? ? 59.01 17.70 70 15 SER A 2 ? ? 61.89 167.75 71 15 SER A 6 ? ? 55.34 -175.27 72 15 VAL A 52 ? ? -131.33 -37.88 73 15 MET A 79 ? ? 59.71 12.25 74 15 LYS A 81 ? ? -111.54 69.50 75 15 TYR A 83 ? ? 46.21 27.93 76 15 SER A 93 ? ? -89.03 -73.63 77 16 VAL A 52 ? ? -130.67 -37.10 78 16 ASN A 96 ? ? -152.63 9.71 79 17 GLU A 11 ? ? -85.00 33.54 80 17 ARG A 12 ? ? -80.15 44.00 81 17 VAL A 52 ? ? -131.31 -37.54 82 17 MET A 79 ? ? 58.80 15.00 83 18 VAL A 52 ? ? -132.47 -37.26 84 18 MET A 79 ? ? 58.67 14.07 85 18 LYS A 81 ? ? -111.33 69.63 86 18 SER A 93 ? ? -71.21 -70.15 87 18 ALA A 94 ? ? 55.61 -21.51 88 19 GLU A 11 ? ? -143.14 -21.81 89 19 ASN A 13 ? ? -69.57 70.16 90 19 VAL A 52 ? ? -132.29 -39.61 91 19 MET A 79 ? ? 58.92 14.44 92 19 LYS A 81 ? ? -113.89 70.04 93 19 ALA A 94 ? ? -65.96 19.46 94 20 VAL A 52 ? ? -135.29 -31.63 95 20 MET A 79 ? ? 56.79 16.67 96 20 LYS A 81 ? ? -108.72 70.04 97 20 TYR A 83 ? ? 46.81 29.44 98 20 HIS A 95 ? ? -157.06 -36.37 99 20 SER A 100 ? ? 58.57 179.21 #