data_5H0P # _entry.id 5H0P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5H0P pdb_00005h0p 10.2210/pdb5h0p/pdb WWPDB D_1300001806 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5H0P _pdbx_database_status.recvd_initial_deposition_date 2016-10-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Park, K.R.' 1 'An, J.Y.' 2 'Kang, J.Y.' 3 'Lee, J.G.' 4 'Youn, H.S.' 5 'Lee, Y.' 6 'Mun, S.A.' 7 'Jun, C.D.' 8 'Song, W.K.' 9 'Eom, S.H.' 10 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochem. Biophys. Res. Commun.' _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 483 _citation.language ? _citation.page_first 442 _citation.page_last 448 _citation.title 'Structural mechanism underlying regulation of human EFhd2/Swiprosin-1 actin-bundling activity by Ser183 phosphorylation.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2016.12.124 _citation.pdbx_database_id_PubMed 28011271 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Park, K.R.' 1 ? primary 'An, J.Y.' 2 ? primary 'Kang, J.Y.' 3 ? primary 'Lee, J.G.' 4 ? primary 'Lee, Y.' 5 ? primary 'Mun, S.A.' 6 ? primary 'Jun, C.D.' 7 ? primary 'Song, W.K.' 8 ? primary 'Eom, S.H.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5H0P _cell.details ? _cell.formula_units_Z ? _cell.length_a 36.675 _cell.length_a_esd ? _cell.length_b 51.105 _cell.length_b_esd ? _cell.length_c 53.650 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5H0P _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'EF-hand domain-containing protein D2' 13751.778 1 ? S183E 'UNP RESIDUES 70-184' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 water nat water 18.015 39 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Swiprosin-1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMGSGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDF DSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVES ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGSGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDF DSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 GLY n 1 7 GLU n 1 8 PRO n 1 9 GLN n 1 10 SER n 1 11 PRO n 1 12 SER n 1 13 ARG n 1 14 ARG n 1 15 VAL n 1 16 PHE n 1 17 ASN n 1 18 PRO n 1 19 TYR n 1 20 THR n 1 21 GLU n 1 22 PHE n 1 23 LYS n 1 24 GLU n 1 25 PHE n 1 26 SER n 1 27 ARG n 1 28 LYS n 1 29 GLN n 1 30 ILE n 1 31 LYS n 1 32 ASP n 1 33 MET n 1 34 GLU n 1 35 LYS n 1 36 MET n 1 37 PHE n 1 38 LYS n 1 39 GLN n 1 40 TYR n 1 41 ASP n 1 42 ALA n 1 43 GLY n 1 44 ARG n 1 45 ASP n 1 46 GLY n 1 47 PHE n 1 48 ILE n 1 49 ASP n 1 50 LEU n 1 51 MET n 1 52 GLU n 1 53 LEU n 1 54 LYS n 1 55 LEU n 1 56 MET n 1 57 MET n 1 58 GLU n 1 59 LYS n 1 60 LEU n 1 61 GLY n 1 62 ALA n 1 63 PRO n 1 64 GLN n 1 65 THR n 1 66 HIS n 1 67 LEU n 1 68 GLY n 1 69 LEU n 1 70 LYS n 1 71 ASN n 1 72 MET n 1 73 ILE n 1 74 LYS n 1 75 GLU n 1 76 VAL n 1 77 ASP n 1 78 GLU n 1 79 ASP n 1 80 PHE n 1 81 ASP n 1 82 SER n 1 83 LYS n 1 84 LEU n 1 85 SER n 1 86 PHE n 1 87 ARG n 1 88 GLU n 1 89 PHE n 1 90 LEU n 1 91 LEU n 1 92 ILE n 1 93 PHE n 1 94 ARG n 1 95 LYS n 1 96 ALA n 1 97 ALA n 1 98 ALA n 1 99 GLY n 1 100 GLU n 1 101 LEU n 1 102 GLN n 1 103 GLU n 1 104 ASP n 1 105 SER n 1 106 GLY n 1 107 LEU n 1 108 CYS n 1 109 VAL n 1 110 LEU n 1 111 ALA n 1 112 ARG n 1 113 LEU n 1 114 SER n 1 115 GLU n 1 116 ILE n 1 117 ASP n 1 118 VAL n 1 119 GLU n 1 120 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 120 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EFHD2, SWS1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'modified pET28a' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EFHD2_HUMAN _struct_ref.pdbx_db_accession Q96C19 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLS FREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSS ; _struct_ref.pdbx_align_begin 70 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5H0P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 120 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96C19 _struct_ref_seq.db_align_beg 70 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 184 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 70 _struct_ref_seq.pdbx_auth_seq_align_end 184 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5H0P GLY A 1 ? UNP Q96C19 ? ? 'expression tag' 65 1 1 5H0P ALA A 2 ? UNP Q96C19 ? ? 'expression tag' 66 2 1 5H0P MET A 3 ? UNP Q96C19 ? ? 'expression tag' 67 3 1 5H0P GLY A 4 ? UNP Q96C19 ? ? 'expression tag' 68 4 1 5H0P SER A 5 ? UNP Q96C19 ? ? 'expression tag' 69 5 1 5H0P GLU A 119 ? UNP Q96C19 SER 183 'engineered mutation' 183 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5H0P _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.83 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.71 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M trimethlyamine-N-oxide dihydrate, 0.1 M Tris-HCl (pH 8.5), 20% (w/v) PEG 2000 MME' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-10-23 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9897 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9897 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5H0P _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.86 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8596 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.86 _reflns_shell.d_res_low 1.89 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 6.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 98.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.315 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5H0P _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.862 _refine.ls_d_res_low 29.796 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8596 _refine.ls_number_reflns_R_free 873 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.92 _refine.ls_percent_reflns_R_free 10.16 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2009 _refine.ls_R_factor_R_free 0.2463 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1960 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5I2L _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.37 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 830 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 871 _refine_hist.d_res_high 1.862 _refine_hist.d_res_low 29.796 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 842 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.013 ? 1120 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.984 ? 332 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.078 ? 119 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 145 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8624 1.9791 . . 145 1270 98.00 . . . 0.3114 . 0.2180 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9791 2.1318 . . 146 1296 99.00 . . . 0.2761 . 0.1973 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1318 2.3463 . . 140 1294 99.00 . . . 0.2671 . 0.1904 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3463 2.6856 . . 151 1318 100.00 . . . 0.2694 . 0.1894 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6856 3.3828 . . 152 1318 99.00 . . . 0.2606 . 0.2014 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3828 29.8001 . . 139 1227 87.00 . . . 0.2133 . 0.1938 . . . . . . . . . . # _struct.entry_id 5H0P _struct.title 'Crystal structure of EF-hand protein mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5H0P _struct_keywords.text 'EF-hand, Phosphorylation, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 17 ? PHE A 22 ? ASN A 81 PHE A 86 1 ? 6 HELX_P HELX_P2 AA2 SER A 26 ? ASP A 41 ? SER A 90 ASP A 105 1 ? 16 HELX_P HELX_P3 AA3 ASP A 49 ? GLY A 61 ? ASP A 113 GLY A 125 1 ? 13 HELX_P HELX_P4 AA4 THR A 65 ? ASP A 77 ? THR A 129 ASP A 141 1 ? 13 HELX_P HELX_P5 AA5 SER A 85 ? ALA A 98 ? SER A 149 ALA A 162 1 ? 14 HELX_P HELX_P6 AA6 SER A 105 ? SER A 114 ? SER A 169 SER A 178 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 41 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 105 A CA 201 1_555 ? ? ? ? ? ? ? 2.294 ? ? metalc2 metalc ? ? A ASP 45 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 109 A CA 201 1_555 ? ? ? ? ? ? ? 2.387 ? ? metalc3 metalc ? ? A PHE 47 O ? ? ? 1_555 B CA . CA ? ? A PHE 111 A CA 201 1_555 ? ? ? ? ? ? ? 2.423 ? ? metalc4 metalc ? ? A GLU 52 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 116 A CA 201 1_555 ? ? ? ? ? ? ? 2.482 ? ? metalc5 metalc ? ? A GLU 52 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 116 A CA 201 1_555 ? ? ? ? ? ? ? 2.307 ? ? metalc6 metalc ? ? A ASP 77 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 141 A CA 202 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc7 metalc ? ? A ASP 79 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 143 A CA 202 1_555 ? ? ? ? ? ? ? 2.283 ? ? metalc8 metalc ? ? A ASP 81 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 145 A CA 202 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc9 metalc ? ? A LYS 83 O ? ? ? 1_555 C CA . CA ? ? A LYS 147 A CA 202 1_555 ? ? ? ? ? ? ? 2.374 ? ? metalc10 metalc ? ? A GLU 88 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 152 A CA 202 1_555 ? ? ? ? ? ? ? 2.454 ? ? metalc11 metalc ? ? A GLU 88 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 152 A CA 202 1_555 ? ? ? ? ? ? ? 2.517 ? ? metalc12 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 201 A HOH 303 1_555 ? ? ? ? ? ? ? 2.570 ? ? metalc13 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 201 A HOH 337 1_555 ? ? ? ? ? ? ? 2.584 ? ? metalc14 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 202 A HOH 320 1_555 ? ? ? ? ? ? ? 2.405 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 201 ? 6 'binding site for residue CA A 201' AC2 Software A CA 202 ? 6 'binding site for residue CA A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 41 ? ASP A 105 . ? 1_555 ? 2 AC1 6 ASP A 45 ? ASP A 109 . ? 1_555 ? 3 AC1 6 PHE A 47 ? PHE A 111 . ? 1_555 ? 4 AC1 6 GLU A 52 ? GLU A 116 . ? 1_555 ? 5 AC1 6 HOH D . ? HOH A 303 . ? 1_555 ? 6 AC1 6 HOH D . ? HOH A 337 . ? 1_555 ? 7 AC2 6 ASP A 77 ? ASP A 141 . ? 1_555 ? 8 AC2 6 ASP A 79 ? ASP A 143 . ? 1_555 ? 9 AC2 6 ASP A 81 ? ASP A 145 . ? 1_555 ? 10 AC2 6 LYS A 83 ? LYS A 147 . ? 1_555 ? 11 AC2 6 GLU A 88 ? GLU A 152 . ? 1_555 ? 12 AC2 6 HOH D . ? HOH A 320 . ? 1_555 ? # _atom_sites.entry_id 5H0P _atom_sites.fract_transf_matrix[1][1] 0.027267 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019568 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018639 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 65 ? ? ? A . n A 1 2 ALA 2 66 ? ? ? A . n A 1 3 MET 3 67 ? ? ? A . n A 1 4 GLY 4 68 ? ? ? A . n A 1 5 SER 5 69 ? ? ? A . n A 1 6 GLY 6 70 ? ? ? A . n A 1 7 GLU 7 71 ? ? ? A . n A 1 8 PRO 8 72 ? ? ? A . n A 1 9 GLN 9 73 ? ? ? A . n A 1 10 SER 10 74 ? ? ? A . n A 1 11 PRO 11 75 ? ? ? A . n A 1 12 SER 12 76 ? ? ? A . n A 1 13 ARG 13 77 ? ? ? A . n A 1 14 ARG 14 78 ? ? ? A . n A 1 15 VAL 15 79 ? ? ? A . n A 1 16 PHE 16 80 ? ? ? A . n A 1 17 ASN 17 81 81 ASN ASN A . n A 1 18 PRO 18 82 82 PRO PRO A . n A 1 19 TYR 19 83 83 TYR TYR A . n A 1 20 THR 20 84 84 THR THR A . n A 1 21 GLU 21 85 85 GLU GLU A . n A 1 22 PHE 22 86 86 PHE PHE A . n A 1 23 LYS 23 87 87 LYS LYS A . n A 1 24 GLU 24 88 88 GLU GLU A . n A 1 25 PHE 25 89 89 PHE PHE A . n A 1 26 SER 26 90 90 SER SER A . n A 1 27 ARG 27 91 91 ARG ARG A . n A 1 28 LYS 28 92 92 LYS LYS A . n A 1 29 GLN 29 93 93 GLN GLN A . n A 1 30 ILE 30 94 94 ILE ILE A . n A 1 31 LYS 31 95 95 LYS LYS A . n A 1 32 ASP 32 96 96 ASP ASP A . n A 1 33 MET 33 97 97 MET MET A . n A 1 34 GLU 34 98 98 GLU GLU A . n A 1 35 LYS 35 99 99 LYS LYS A . n A 1 36 MET 36 100 100 MET MET A . n A 1 37 PHE 37 101 101 PHE PHE A . n A 1 38 LYS 38 102 102 LYS LYS A . n A 1 39 GLN 39 103 103 GLN GLN A . n A 1 40 TYR 40 104 104 TYR TYR A . n A 1 41 ASP 41 105 105 ASP ASP A . n A 1 42 ALA 42 106 106 ALA ALA A . n A 1 43 GLY 43 107 107 GLY GLY A . n A 1 44 ARG 44 108 108 ARG ARG A . n A 1 45 ASP 45 109 109 ASP ASP A . n A 1 46 GLY 46 110 110 GLY GLY A . n A 1 47 PHE 47 111 111 PHE PHE A . n A 1 48 ILE 48 112 112 ILE ILE A . n A 1 49 ASP 49 113 113 ASP ASP A . n A 1 50 LEU 50 114 114 LEU LEU A . n A 1 51 MET 51 115 115 MET MET A . n A 1 52 GLU 52 116 116 GLU GLU A . n A 1 53 LEU 53 117 117 LEU LEU A . n A 1 54 LYS 54 118 118 LYS LYS A . n A 1 55 LEU 55 119 119 LEU LEU A . n A 1 56 MET 56 120 120 MET MET A . n A 1 57 MET 57 121 121 MET MET A . n A 1 58 GLU 58 122 122 GLU GLU A . n A 1 59 LYS 59 123 123 LYS LYS A . n A 1 60 LEU 60 124 124 LEU LEU A . n A 1 61 GLY 61 125 125 GLY GLY A . n A 1 62 ALA 62 126 126 ALA ALA A . n A 1 63 PRO 63 127 127 PRO PRO A . n A 1 64 GLN 64 128 128 GLN GLN A . n A 1 65 THR 65 129 129 THR THR A . n A 1 66 HIS 66 130 130 HIS HIS A . n A 1 67 LEU 67 131 131 LEU LEU A . n A 1 68 GLY 68 132 132 GLY GLY A . n A 1 69 LEU 69 133 133 LEU LEU A . n A 1 70 LYS 70 134 134 LYS LYS A . n A 1 71 ASN 71 135 135 ASN ASN A . n A 1 72 MET 72 136 136 MET MET A . n A 1 73 ILE 73 137 137 ILE ILE A . n A 1 74 LYS 74 138 138 LYS LYS A . n A 1 75 GLU 75 139 139 GLU GLU A . n A 1 76 VAL 76 140 140 VAL VAL A . n A 1 77 ASP 77 141 141 ASP ASP A . n A 1 78 GLU 78 142 142 GLU GLU A . n A 1 79 ASP 79 143 143 ASP ASP A . n A 1 80 PHE 80 144 144 PHE PHE A . n A 1 81 ASP 81 145 145 ASP ASP A . n A 1 82 SER 82 146 146 SER SER A . n A 1 83 LYS 83 147 147 LYS LYS A . n A 1 84 LEU 84 148 148 LEU LEU A . n A 1 85 SER 85 149 149 SER SER A . n A 1 86 PHE 86 150 150 PHE PHE A . n A 1 87 ARG 87 151 151 ARG ARG A . n A 1 88 GLU 88 152 152 GLU GLU A . n A 1 89 PHE 89 153 153 PHE PHE A . n A 1 90 LEU 90 154 154 LEU LEU A . n A 1 91 LEU 91 155 155 LEU LEU A . n A 1 92 ILE 92 156 156 ILE ILE A . n A 1 93 PHE 93 157 157 PHE PHE A . n A 1 94 ARG 94 158 158 ARG ARG A . n A 1 95 LYS 95 159 159 LYS LYS A . n A 1 96 ALA 96 160 160 ALA ALA A . n A 1 97 ALA 97 161 161 ALA ALA A . n A 1 98 ALA 98 162 162 ALA ALA A . n A 1 99 GLY 99 163 163 GLY GLY A . n A 1 100 GLU 100 164 164 GLU GLU A . n A 1 101 LEU 101 165 165 LEU LEU A . n A 1 102 GLN 102 166 166 GLN GLN A . n A 1 103 GLU 103 167 167 GLU GLU A . n A 1 104 ASP 104 168 168 ASP ASP A . n A 1 105 SER 105 169 169 SER SER A . n A 1 106 GLY 106 170 170 GLY GLY A . n A 1 107 LEU 107 171 171 LEU LEU A . n A 1 108 CYS 108 172 172 CYS CYS A . n A 1 109 VAL 109 173 173 VAL VAL A . n A 1 110 LEU 110 174 174 LEU LEU A . n A 1 111 ALA 111 175 175 ALA ALA A . n A 1 112 ARG 112 176 176 ARG ARG A . n A 1 113 LEU 113 177 177 LEU LEU A . n A 1 114 SER 114 178 178 SER SER A . n A 1 115 GLU 115 179 179 GLU GLU A . n A 1 116 ILE 116 180 180 ILE ILE A . n A 1 117 ASP 117 181 181 ASP ASP A . n A 1 118 VAL 118 182 182 VAL VAL A . n A 1 119 GLU 119 183 ? ? ? A . n A 1 120 SER 120 184 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 185 CA CA A . C 2 CA 1 202 186 CA CA A . D 3 HOH 1 301 29 HOH HOH A . D 3 HOH 2 302 41 HOH HOH A . D 3 HOH 3 303 4 HOH HOH A . D 3 HOH 4 304 33 HOH HOH A . D 3 HOH 5 305 10 HOH HOH A . D 3 HOH 6 306 28 HOH HOH A . D 3 HOH 7 307 24 HOH HOH A . D 3 HOH 8 308 6 HOH HOH A . D 3 HOH 9 309 40 HOH HOH A . D 3 HOH 10 310 17 HOH HOH A . D 3 HOH 11 311 20 HOH HOH A . D 3 HOH 12 312 21 HOH HOH A . D 3 HOH 13 313 25 HOH HOH A . D 3 HOH 14 314 13 HOH HOH A . D 3 HOH 15 315 5 HOH HOH A . D 3 HOH 16 316 3 HOH HOH A . D 3 HOH 17 317 8 HOH HOH A . D 3 HOH 18 318 18 HOH HOH A . D 3 HOH 19 319 27 HOH HOH A . D 3 HOH 20 320 15 HOH HOH A . D 3 HOH 21 321 37 HOH HOH A . D 3 HOH 22 322 38 HOH HOH A . D 3 HOH 23 323 35 HOH HOH A . D 3 HOH 24 324 36 HOH HOH A . D 3 HOH 25 325 1 HOH HOH A . D 3 HOH 26 326 26 HOH HOH A . D 3 HOH 27 327 12 HOH HOH A . D 3 HOH 28 328 7 HOH HOH A . D 3 HOH 29 329 11 HOH HOH A . D 3 HOH 30 330 16 HOH HOH A . D 3 HOH 31 331 31 HOH HOH A . D 3 HOH 32 332 2 HOH HOH A . D 3 HOH 33 333 32 HOH HOH A . D 3 HOH 34 334 9 HOH HOH A . D 3 HOH 35 335 34 HOH HOH A . D 3 HOH 36 336 22 HOH HOH A . D 3 HOH 37 337 19 HOH HOH A . D 3 HOH 38 338 39 HOH HOH A . D 3 HOH 39 339 30 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 41 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 45 ? A ASP 109 ? 1_555 78.3 ? 2 OD1 ? A ASP 41 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A PHE 47 ? A PHE 111 ? 1_555 77.5 ? 3 OD1 ? A ASP 45 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A PHE 47 ? A PHE 111 ? 1_555 84.3 ? 4 OD1 ? A ASP 41 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 52 ? A GLU 116 ? 1_555 116.0 ? 5 OD1 ? A ASP 45 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 52 ? A GLU 116 ? 1_555 153.8 ? 6 O ? A PHE 47 ? A PHE 111 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE1 ? A GLU 52 ? A GLU 116 ? 1_555 78.2 ? 7 OD1 ? A ASP 41 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 52 ? A GLU 116 ? 1_555 84.5 ? 8 OD1 ? A ASP 45 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 52 ? A GLU 116 ? 1_555 152.2 ? 9 O ? A PHE 47 ? A PHE 111 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 52 ? A GLU 116 ? 1_555 113.2 ? 10 OE1 ? A GLU 52 ? A GLU 116 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 52 ? A GLU 116 ? 1_555 54.0 ? 11 OD1 ? A ASP 41 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 303 ? 1_555 153.0 ? 12 OD1 ? A ASP 45 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 303 ? 1_555 76.0 ? 13 O ? A PHE 47 ? A PHE 111 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 303 ? 1_555 91.6 ? 14 OE1 ? A GLU 52 ? A GLU 116 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 303 ? 1_555 85.1 ? 15 OE2 ? A GLU 52 ? A GLU 116 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 303 ? 1_555 122.5 ? 16 OD1 ? A ASP 41 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 337 ? 1_555 103.6 ? 17 OD1 ? A ASP 45 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 337 ? 1_555 81.8 ? 18 O ? A PHE 47 ? A PHE 111 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 337 ? 1_555 165.5 ? 19 OE1 ? A GLU 52 ? A GLU 116 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 337 ? 1_555 113.2 ? 20 OE2 ? A GLU 52 ? A GLU 116 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 337 ? 1_555 81.2 ? 21 O ? D HOH . ? A HOH 303 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? D HOH . ? A HOH 337 ? 1_555 81.0 ? 22 OD1 ? A ASP 77 ? A ASP 141 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 79 ? A ASP 143 ? 1_555 90.0 ? 23 OD1 ? A ASP 77 ? A ASP 141 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 81 ? A ASP 145 ? 1_555 85.1 ? 24 OD1 ? A ASP 79 ? A ASP 143 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 81 ? A ASP 145 ? 1_555 78.7 ? 25 OD1 ? A ASP 77 ? A ASP 141 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A LYS 83 ? A LYS 147 ? 1_555 91.1 ? 26 OD1 ? A ASP 79 ? A ASP 143 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A LYS 83 ? A LYS 147 ? 1_555 158.0 ? 27 OD1 ? A ASP 81 ? A ASP 145 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A LYS 83 ? A LYS 147 ? 1_555 79.5 ? 28 OD1 ? A ASP 77 ? A ASP 141 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 88 ? A GLU 152 ? 1_555 108.8 ? 29 OD1 ? A ASP 79 ? A ASP 143 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 88 ? A GLU 152 ? 1_555 122.1 ? 30 OD1 ? A ASP 81 ? A ASP 145 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 88 ? A GLU 152 ? 1_555 153.7 ? 31 O ? A LYS 83 ? A LYS 147 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE1 ? A GLU 88 ? A GLU 152 ? 1_555 78.1 ? 32 OD1 ? A ASP 77 ? A ASP 141 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 88 ? A GLU 152 ? 1_555 88.0 ? 33 OD1 ? A ASP 79 ? A ASP 143 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 88 ? A GLU 152 ? 1_555 75.5 ? 34 OD1 ? A ASP 81 ? A ASP 145 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 88 ? A GLU 152 ? 1_555 153.3 ? 35 O ? A LYS 83 ? A LYS 147 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 88 ? A GLU 152 ? 1_555 126.5 ? 36 OE1 ? A GLU 88 ? A GLU 152 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OE2 ? A GLU 88 ? A GLU 152 ? 1_555 52.2 ? 37 OD1 ? A ASP 77 ? A ASP 141 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? D HOH . ? A HOH 320 ? 1_555 162.7 ? 38 OD1 ? A ASP 79 ? A ASP 143 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? D HOH . ? A HOH 320 ? 1_555 80.3 ? 39 OD1 ? A ASP 81 ? A ASP 145 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? D HOH . ? A HOH 320 ? 1_555 79.0 ? 40 O ? A LYS 83 ? A LYS 147 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? D HOH . ? A HOH 320 ? 1_555 92.6 ? 41 OE1 ? A GLU 88 ? A GLU 152 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? D HOH . ? A HOH 320 ? 1_555 88.5 ? 42 OE2 ? A GLU 88 ? A GLU 152 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? D HOH . ? A HOH 320 ? 1_555 103.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-13 2 'Structure model' 1 1 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -20.8945 -7.4711 3.9960 0.2760 0.2599 0.3005 -0.0697 -0.0176 -0.0268 5.2708 8.1594 2.8670 2.1146 -3.7530 -2.7179 -0.0457 0.1562 -0.4393 -0.1797 -0.0377 0.2613 0.3855 -0.5071 0.0343 'X-RAY DIFFRACTION' 2 ? refined -12.5147 3.7644 -3.6215 0.3691 0.2136 0.2019 -0.0430 0.0087 0.0419 9.2786 2.9290 6.1348 0.0674 -2.4193 0.7773 0.0199 0.7517 0.3366 -0.5273 0.1420 -0.1590 -0.4211 -0.1047 -0.1009 'X-RAY DIFFRACTION' 3 ? refined -12.9423 -4.9203 5.8227 0.2204 0.2052 0.2916 -0.0594 -0.0351 0.0829 6.6146 7.9886 8.2246 1.7291 2.4816 2.6800 0.1489 -0.2017 -0.7146 0.3712 -0.0435 -0.7761 0.1351 0.2737 -0.1857 'X-RAY DIFFRACTION' 4 ? refined -14.1458 5.4822 9.6663 0.2803 0.2181 0.1804 -0.0171 0.0719 -0.0324 7.9056 8.9856 4.9507 -2.2345 3.1104 -2.0890 0.2125 -0.8886 0.0815 0.2912 -0.0657 0.0372 -0.2758 -0.1318 -0.1489 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 82 through 113 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 114 through 149 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 150 through 161 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 162 through 182 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8_1069 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8_1069 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id PHE _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 86 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -103.99 _pdbx_validate_torsion.psi 69.11 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 65 ? A GLY 1 2 1 Y 1 A ALA 66 ? A ALA 2 3 1 Y 1 A MET 67 ? A MET 3 4 1 Y 1 A GLY 68 ? A GLY 4 5 1 Y 1 A SER 69 ? A SER 5 6 1 Y 1 A GLY 70 ? A GLY 6 7 1 Y 1 A GLU 71 ? A GLU 7 8 1 Y 1 A PRO 72 ? A PRO 8 9 1 Y 1 A GLN 73 ? A GLN 9 10 1 Y 1 A SER 74 ? A SER 10 11 1 Y 1 A PRO 75 ? A PRO 11 12 1 Y 1 A SER 76 ? A SER 12 13 1 Y 1 A ARG 77 ? A ARG 13 14 1 Y 1 A ARG 78 ? A ARG 14 15 1 Y 1 A VAL 79 ? A VAL 15 16 1 Y 1 A PHE 80 ? A PHE 16 17 1 Y 1 A GLU 183 ? A GLU 119 18 1 Y 1 A SER 184 ? A SER 120 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5I2L _pdbx_initial_refinement_model.details ? #