data_5H0W # _entry.id 5H0W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5H0W pdb_00005h0w 10.2210/pdb5h0w/pdb WWPDB D_1300001810 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-06-14 2 'Structure model' 1 1 2017-07-26 3 'Structure model' 1 2 2024-03-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5H0W _pdbx_database_status.recvd_initial_deposition_date 2016-10-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5H0V PDB . unspecified 5H0X PDB . unspecified 5H0Y PDB . unspecified 5H0Z PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yokoyama, T.' 1 'Hanawa, Y.' 2 'Obita, T.' 3 'Mizuguchi, M.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'FEBS Lett.' _citation.journal_id_ASTM FEBLAL _citation.journal_id_CSD 0165 _citation.journal_id_ISSN 1873-3468 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 591 _citation.language ? _citation.page_first 1862 _citation.page_last 1871 _citation.title 'Stability and crystal structures of His88 mutant human transthyretins' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/1873-3468.12704 _citation.pdbx_database_id_PubMed 28563699 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yokoyama, T.' 1 ? primary 'Hanawa, Y.' 2 ? primary 'Obita, T.' 3 ? primary 'Mizuguchi, M.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Transthyretin 13985.629 1 ? H88F 'UNP residues 31-147' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 56 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ATTR,Prealbumin,TBPA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AHHHHHHMSPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKA LGISPFFEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE ; _entity_poly.pdbx_seq_one_letter_code_can ;AHHHHHHMSPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKA LGISPFFEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 MET n 1 9 SER n 1 10 PRO n 1 11 LEU n 1 12 MET n 1 13 VAL n 1 14 LYS n 1 15 VAL n 1 16 LEU n 1 17 ASP n 1 18 ALA n 1 19 VAL n 1 20 ARG n 1 21 GLY n 1 22 SER n 1 23 PRO n 1 24 ALA n 1 25 ILE n 1 26 ASN n 1 27 VAL n 1 28 ALA n 1 29 VAL n 1 30 HIS n 1 31 VAL n 1 32 PHE n 1 33 ARG n 1 34 LYS n 1 35 ALA n 1 36 ALA n 1 37 ASP n 1 38 ASP n 1 39 THR n 1 40 TRP n 1 41 GLU n 1 42 PRO n 1 43 PHE n 1 44 ALA n 1 45 SER n 1 46 GLY n 1 47 LYS n 1 48 THR n 1 49 SER n 1 50 GLU n 1 51 SER n 1 52 GLY n 1 53 GLU n 1 54 LEU n 1 55 HIS n 1 56 GLY n 1 57 LEU n 1 58 THR n 1 59 THR n 1 60 GLU n 1 61 GLU n 1 62 GLU n 1 63 PHE n 1 64 VAL n 1 65 GLU n 1 66 GLY n 1 67 ILE n 1 68 TYR n 1 69 LYS n 1 70 VAL n 1 71 GLU n 1 72 ILE n 1 73 ASP n 1 74 THR n 1 75 LYS n 1 76 SER n 1 77 TYR n 1 78 TRP n 1 79 LYS n 1 80 ALA n 1 81 LEU n 1 82 GLY n 1 83 ILE n 1 84 SER n 1 85 PRO n 1 86 PHE n 1 87 PHE n 1 88 GLU n 1 89 HIS n 1 90 ALA n 1 91 GLU n 1 92 VAL n 1 93 VAL n 1 94 PHE n 1 95 THR n 1 96 ALA n 1 97 ASN n 1 98 ASP n 1 99 SER n 1 100 GLY n 1 101 PRO n 1 102 ARG n 1 103 ARG n 1 104 TYR n 1 105 THR n 1 106 ILE n 1 107 ALA n 1 108 ALA n 1 109 LEU n 1 110 LEU n 1 111 SER n 1 112 PRO n 1 113 TYR n 1 114 SER n 1 115 TYR n 1 116 SER n 1 117 THR n 1 118 THR n 1 119 ALA n 1 120 VAL n 1 121 VAL n 1 122 THR n 1 123 ASN n 1 124 PRO n 1 125 LYS n 1 126 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 126 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TTR, PALB' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 ? ? ? A . n A 1 2 HIS 2 3 ? ? ? A . n A 1 3 HIS 3 4 ? ? ? A . n A 1 4 HIS 4 5 ? ? ? A . n A 1 5 HIS 5 6 ? ? ? A . n A 1 6 HIS 6 7 ? ? ? A . n A 1 7 HIS 7 8 ? ? ? A . n A 1 8 MET 8 9 ? ? ? A . n A 1 9 SER 9 10 10 SER SER A . n A 1 10 PRO 10 11 11 PRO PRO A . n A 1 11 LEU 11 12 12 LEU LEU A . n A 1 12 MET 12 13 13 MET MET A . n A 1 13 VAL 13 14 14 VAL VAL A . n A 1 14 LYS 14 15 15 LYS LYS A . n A 1 15 VAL 15 16 16 VAL VAL A . n A 1 16 LEU 16 17 17 LEU LEU A . n A 1 17 ASP 17 18 18 ASP ASP A . n A 1 18 ALA 18 19 19 ALA ALA A . n A 1 19 VAL 19 20 20 VAL VAL A . n A 1 20 ARG 20 21 21 ARG ARG A . n A 1 21 GLY 21 22 22 GLY GLY A . n A 1 22 SER 22 23 23 SER SER A . n A 1 23 PRO 23 24 24 PRO PRO A . n A 1 24 ALA 24 25 25 ALA ALA A . n A 1 25 ILE 25 26 26 ILE ILE A . n A 1 26 ASN 26 27 27 ASN ASN A . n A 1 27 VAL 27 28 28 VAL VAL A . n A 1 28 ALA 28 29 29 ALA ALA A . n A 1 29 VAL 29 30 30 VAL VAL A . n A 1 30 HIS 30 31 31 HIS HIS A . n A 1 31 VAL 31 32 32 VAL VAL A . n A 1 32 PHE 32 33 33 PHE PHE A . n A 1 33 ARG 33 34 34 ARG ARG A . n A 1 34 LYS 34 35 35 LYS LYS A . n A 1 35 ALA 35 36 36 ALA ALA A . n A 1 36 ALA 36 37 37 ALA ALA A . n A 1 37 ASP 37 38 38 ASP ASP A . n A 1 38 ASP 38 39 39 ASP ASP A . n A 1 39 THR 39 40 40 THR THR A . n A 1 40 TRP 40 41 41 TRP TRP A . n A 1 41 GLU 41 42 42 GLU GLU A . n A 1 42 PRO 42 43 43 PRO PRO A . n A 1 43 PHE 43 44 44 PHE PHE A . n A 1 44 ALA 44 45 45 ALA ALA A . n A 1 45 SER 45 46 46 SER SER A . n A 1 46 GLY 46 47 47 GLY GLY A . n A 1 47 LYS 47 48 48 LYS LYS A . n A 1 48 THR 48 49 49 THR THR A . n A 1 49 SER 49 50 50 SER SER A . n A 1 50 GLU 50 51 51 GLU GLU A . n A 1 51 SER 51 52 52 SER SER A . n A 1 52 GLY 52 53 53 GLY GLY A . n A 1 53 GLU 53 54 54 GLU GLU A . n A 1 54 LEU 54 55 55 LEU LEU A . n A 1 55 HIS 55 56 56 HIS HIS A . n A 1 56 GLY 56 57 57 GLY GLY A . n A 1 57 LEU 57 58 58 LEU LEU A . n A 1 58 THR 58 59 59 THR THR A . n A 1 59 THR 59 60 60 THR THR A . n A 1 60 GLU 60 61 61 GLU GLU A . n A 1 61 GLU 61 62 62 GLU GLU A . n A 1 62 GLU 62 63 63 GLU GLU A . n A 1 63 PHE 63 64 64 PHE PHE A . n A 1 64 VAL 64 65 65 VAL VAL A . n A 1 65 GLU 65 66 66 GLU GLU A . n A 1 66 GLY 66 67 67 GLY GLY A . n A 1 67 ILE 67 68 68 ILE ILE A . n A 1 68 TYR 68 69 69 TYR TYR A . n A 1 69 LYS 69 70 70 LYS LYS A . n A 1 70 VAL 70 71 71 VAL VAL A . n A 1 71 GLU 71 72 72 GLU GLU A . n A 1 72 ILE 72 73 73 ILE ILE A . n A 1 73 ASP 73 74 74 ASP ASP A . n A 1 74 THR 74 75 75 THR THR A . n A 1 75 LYS 75 76 76 LYS LYS A . n A 1 76 SER 76 77 77 SER SER A . n A 1 77 TYR 77 78 78 TYR TYR A . n A 1 78 TRP 78 79 79 TRP TRP A . n A 1 79 LYS 79 80 80 LYS LYS A . n A 1 80 ALA 80 81 81 ALA ALA A . n A 1 81 LEU 81 82 82 LEU LEU A . n A 1 82 GLY 82 83 83 GLY GLY A . n A 1 83 ILE 83 84 84 ILE ILE A . n A 1 84 SER 84 85 85 SER SER A . n A 1 85 PRO 85 86 86 PRO PRO A . n A 1 86 PHE 86 87 87 PHE PHE A . n A 1 87 PHE 87 88 88 PHE PHE A . n A 1 88 GLU 88 89 89 GLU GLU A . n A 1 89 HIS 89 90 90 HIS HIS A . n A 1 90 ALA 90 91 91 ALA ALA A . n A 1 91 GLU 91 92 92 GLU GLU A . n A 1 92 VAL 92 93 93 VAL VAL A . n A 1 93 VAL 93 94 94 VAL VAL A . n A 1 94 PHE 94 95 95 PHE PHE A . n A 1 95 THR 95 96 96 THR THR A . n A 1 96 ALA 96 97 97 ALA ALA A . n A 1 97 ASN 97 98 98 ASN ASN A . n A 1 98 ASP 98 99 ? ? ? A . n A 1 99 SER 99 100 ? ? ? A . n A 1 100 GLY 100 101 ? ? ? A . n A 1 101 PRO 101 102 102 PRO PRO A . n A 1 102 ARG 102 103 103 ARG ARG A . n A 1 103 ARG 103 104 104 ARG ARG A . n A 1 104 TYR 104 105 105 TYR TYR A . n A 1 105 THR 105 106 106 THR THR A . n A 1 106 ILE 106 107 107 ILE ILE A . n A 1 107 ALA 107 108 108 ALA ALA A . n A 1 108 ALA 108 109 109 ALA ALA A . n A 1 109 LEU 109 110 110 LEU LEU A . n A 1 110 LEU 110 111 111 LEU LEU A . n A 1 111 SER 111 112 112 SER SER A . n A 1 112 PRO 112 113 113 PRO PRO A . n A 1 113 TYR 113 114 114 TYR TYR A . n A 1 114 SER 114 115 115 SER SER A . n A 1 115 TYR 115 116 116 TYR TYR A . n A 1 116 SER 116 117 117 SER SER A . n A 1 117 THR 117 118 118 THR THR A . n A 1 118 THR 118 119 119 THR THR A . n A 1 119 ALA 119 120 120 ALA ALA A . n A 1 120 VAL 120 121 121 VAL VAL A . n A 1 121 VAL 121 122 122 VAL VAL A . n A 1 122 THR 122 123 123 THR THR A . n A 1 123 ASN 123 124 124 ASN ASN A . n A 1 124 PRO 124 125 ? ? ? A . n A 1 125 LYS 125 126 ? ? ? A . n A 1 126 GLU 126 127 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 130 SO4 SO4 A . C 3 HOH 1 301 5 HOH HOH A . C 3 HOH 2 302 54 HOH HOH A . C 3 HOH 3 303 36 HOH HOH A . C 3 HOH 4 304 32 HOH HOH A . C 3 HOH 5 305 9 HOH HOH A . C 3 HOH 6 306 21 HOH HOH A . C 3 HOH 7 307 33 HOH HOH A . C 3 HOH 8 308 43 HOH HOH A . C 3 HOH 9 309 19 HOH HOH A . C 3 HOH 10 310 34 HOH HOH A . C 3 HOH 11 311 1 HOH HOH A . C 3 HOH 12 312 2 HOH HOH A . C 3 HOH 13 313 18 HOH HOH A . C 3 HOH 14 314 11 HOH HOH A . C 3 HOH 15 315 38 HOH HOH A . C 3 HOH 16 316 6 HOH HOH A . C 3 HOH 17 317 8 HOH HOH A . C 3 HOH 18 318 4 HOH HOH A . C 3 HOH 19 319 28 HOH HOH A . C 3 HOH 20 320 45 HOH HOH A . C 3 HOH 21 321 3 HOH HOH A . C 3 HOH 22 322 25 HOH HOH A . C 3 HOH 23 323 40 HOH HOH A . C 3 HOH 24 324 46 HOH HOH A . C 3 HOH 25 325 13 HOH HOH A . C 3 HOH 26 326 16 HOH HOH A . C 3 HOH 27 327 17 HOH HOH A . C 3 HOH 28 328 44 HOH HOH A . C 3 HOH 29 329 14 HOH HOH A . C 3 HOH 30 330 52 HOH HOH A . C 3 HOH 31 331 60 HOH HOH A . C 3 HOH 32 332 22 HOH HOH A . C 3 HOH 33 333 57 HOH HOH A . C 3 HOH 34 334 15 HOH HOH A . C 3 HOH 35 335 49 HOH HOH A . C 3 HOH 36 336 26 HOH HOH A . C 3 HOH 37 337 50 HOH HOH A . C 3 HOH 38 338 48 HOH HOH A . C 3 HOH 39 339 58 HOH HOH A . C 3 HOH 40 340 23 HOH HOH A . C 3 HOH 41 341 30 HOH HOH A . C 3 HOH 42 342 10 HOH HOH A . C 3 HOH 43 343 27 HOH HOH A . C 3 HOH 44 344 41 HOH HOH A . C 3 HOH 45 345 55 HOH HOH A . C 3 HOH 46 346 24 HOH HOH A . C 3 HOH 47 347 51 HOH HOH A . C 3 HOH 48 348 47 HOH HOH A . C 3 HOH 49 349 59 HOH HOH A . C 3 HOH 50 350 42 HOH HOH A . C 3 HOH 51 351 53 HOH HOH A . C 3 HOH 52 352 20 HOH HOH A . C 3 HOH 53 353 39 HOH HOH A . C 3 HOH 54 354 29 HOH HOH A . C 3 HOH 55 355 12 HOH HOH A . C 3 HOH 56 356 56 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 116 ? CG ? A TYR 115 CG 2 1 Y 1 A TYR 116 ? CD1 ? A TYR 115 CD1 3 1 Y 1 A TYR 116 ? CD2 ? A TYR 115 CD2 4 1 Y 1 A TYR 116 ? CE1 ? A TYR 115 CE1 5 1 Y 1 A TYR 116 ? CE2 ? A TYR 115 CE2 6 1 Y 1 A TYR 116 ? CZ ? A TYR 115 CZ 7 1 Y 1 A TYR 116 ? OH ? A TYR 115 OH # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8_1069 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5H0W _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.480 _cell.length_a_esd ? _cell.length_b 62.820 _cell.length_b_esd ? _cell.length_c 85.570 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5H0W _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5H0W _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.99 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.0 M ammonium sulfate, 25% glycerol, 0.1 M MES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-06-06 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL38B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL38B1 _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5H0W _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.9 _reflns.d_resolution_low 50.6 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9071 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5H0W _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.904 _refine.ls_d_res_low 42.785 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9066 _refine.ls_number_reflns_R_free 434 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.91 _refine.ls_percent_reflns_R_free 4.82 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1973 _refine.ls_R_factor_R_free 0.2361 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1951 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.29 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.50 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.27 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 865 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 926 _refine_hist.d_res_high 1.904 _refine_hist.d_res_low 42.785 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 890 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.119 ? 1212 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.077 ? 309 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.084 ? 140 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 151 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9040 2.0233 . . 145 2643 100.00 . . . 0.3074 . 0.2497 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0233 2.1795 . . 117 2709 100.00 . . . 0.2647 . 0.2073 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1795 2.3988 . . 141 2684 100.00 . . . 0.2522 . 0.2017 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3988 2.7459 . . 131 2681 100.00 . . . 0.3079 . 0.2205 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7459 3.4593 . . 125 2688 100.00 . . . 0.2281 . 0.1909 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4593 42.7958 . . 155 2677 100.00 . . . 0.1998 . 0.1746 . . . . . . . . . . # _struct.entry_id 5H0W _struct.title 'Crystal structure of H88F mutated human transthyretin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5H0W _struct_keywords.text 'transthhyretin, amyloidosis, transporter, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TTHY_HUMAN _struct_ref.pdbx_db_accession P02766 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEH AEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE ; _struct_ref.pdbx_align_begin 31 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5H0W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 10 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 126 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02766 _struct_ref_seq.db_align_beg 31 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 11 _struct_ref_seq.pdbx_auth_seq_align_end 127 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5H0W ALA A 1 ? UNP P02766 ? ? 'expression tag' 2 1 1 5H0W HIS A 2 ? UNP P02766 ? ? 'expression tag' 3 2 1 5H0W HIS A 3 ? UNP P02766 ? ? 'expression tag' 4 3 1 5H0W HIS A 4 ? UNP P02766 ? ? 'expression tag' 5 4 1 5H0W HIS A 5 ? UNP P02766 ? ? 'expression tag' 6 5 1 5H0W HIS A 6 ? UNP P02766 ? ? 'expression tag' 7 6 1 5H0W HIS A 7 ? UNP P02766 ? ? 'expression tag' 8 7 1 5H0W MET A 8 ? UNP P02766 ? ? 'expression tag' 9 8 1 5H0W SER A 9 ? UNP P02766 ? ? 'expression tag' 10 9 1 5H0W PHE A 87 ? UNP P02766 HIS 108 'engineered mutation' 88 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7130 ? 1 MORE -81 ? 1 'SSA (A^2)' 19170 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_575 -x,-y+2,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 125.6400000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_558 -x,y,-z+3 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 256.7100000000 4 'crystal symmetry operation' 4_578 x,-y+2,-z+3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 125.6400000000 0.0000000000 0.0000000000 -1.0000000000 256.7100000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 74 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 81 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 75 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 82 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 22 ? PRO A 23 ? SER A 23 PRO A 24 AA1 2 LEU A 11 ? ASP A 17 ? LEU A 12 ASP A 18 AA1 3 GLU A 53 ? LEU A 54 ? GLU A 54 LEU A 55 AA2 1 SER A 22 ? PRO A 23 ? SER A 23 PRO A 24 AA2 2 LEU A 11 ? ASP A 17 ? LEU A 12 ASP A 18 AA2 3 ARG A 103 ? SER A 111 ? ARG A 104 SER A 112 AA2 4 SER A 114 ? THR A 122 ? SER A 115 THR A 123 AA3 1 TRP A 40 ? LYS A 47 ? TRP A 41 LYS A 48 AA3 2 ALA A 28 ? LYS A 34 ? ALA A 29 LYS A 35 AA3 3 GLY A 66 ? ASP A 73 ? GLY A 67 ASP A 74 AA3 4 HIS A 89 ? ALA A 96 ? HIS A 90 ALA A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O SER A 22 ? O SER A 23 N ASP A 17 ? N ASP A 18 AA1 2 3 N VAL A 13 ? N VAL A 14 O LEU A 54 ? O LEU A 55 AA2 1 2 O SER A 22 ? O SER A 23 N ASP A 17 ? N ASP A 18 AA2 2 3 N LEU A 16 ? N LEU A 17 O LEU A 110 ? O LEU A 111 AA2 3 4 N ALA A 107 ? N ALA A 108 O THR A 118 ? O THR A 119 AA3 1 2 O ALA A 44 ? O ALA A 45 N VAL A 31 ? N VAL A 32 AA3 2 3 N HIS A 30 ? N HIS A 31 O GLU A 71 ? O GLU A 72 AA3 3 4 N TYR A 68 ? N TYR A 69 O PHE A 94 ? O PHE A 95 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue SO4 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 LYS A 75 ? LYS A 76 . ? 2_675 ? 2 AC1 5 LYS A 79 ? LYS A 80 . ? 1_555 ? 3 AC1 5 LYS A 79 ? LYS A 80 . ? 2_675 ? 4 AC1 5 HOH C . ? HOH A 304 . ? 1_555 ? 5 AC1 5 HOH C . ? HOH A 305 . ? 2_675 ? # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 327 ? C HOH . 2 1 A HOH 354 ? C HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 2 ? A ALA 1 2 1 Y 1 A HIS 3 ? A HIS 2 3 1 Y 1 A HIS 4 ? A HIS 3 4 1 Y 1 A HIS 5 ? A HIS 4 5 1 Y 1 A HIS 6 ? A HIS 5 6 1 Y 1 A HIS 7 ? A HIS 6 7 1 Y 1 A HIS 8 ? A HIS 7 8 1 Y 1 A MET 9 ? A MET 8 9 1 Y 1 A ASP 99 ? A ASP 98 10 1 Y 1 A SER 100 ? A SER 99 11 1 Y 1 A GLY 101 ? A GLY 100 12 1 Y 1 A PRO 125 ? A PRO 124 13 1 Y 1 A LYS 126 ? A LYS 125 14 1 Y 1 A GLU 127 ? A GLU 126 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 HIS N N N N 103 HIS CA C N S 104 HIS C C N N 105 HIS O O N N 106 HIS CB C N N 107 HIS CG C Y N 108 HIS ND1 N Y N 109 HIS CD2 C Y N 110 HIS CE1 C Y N 111 HIS NE2 N Y N 112 HIS OXT O N N 113 HIS H H N N 114 HIS H2 H N N 115 HIS HA H N N 116 HIS HB2 H N N 117 HIS HB3 H N N 118 HIS HD1 H N N 119 HIS HD2 H N N 120 HIS HE1 H N N 121 HIS HE2 H N N 122 HIS HXT H N N 123 HOH O O N N 124 HOH H1 H N N 125 HOH H2 H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 MET N N N N 196 MET CA C N S 197 MET C C N N 198 MET O O N N 199 MET CB C N N 200 MET CG C N N 201 MET SD S N N 202 MET CE C N N 203 MET OXT O N N 204 MET H H N N 205 MET H2 H N N 206 MET HA H N N 207 MET HB2 H N N 208 MET HB3 H N N 209 MET HG2 H N N 210 MET HG3 H N N 211 MET HE1 H N N 212 MET HE2 H N N 213 MET HE3 H N N 214 MET HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 SO4 S S N N 270 SO4 O1 O N N 271 SO4 O2 O N N 272 SO4 O3 O N N 273 SO4 O4 O N N 274 THR N N N N 275 THR CA C N S 276 THR C C N N 277 THR O O N N 278 THR CB C N R 279 THR OG1 O N N 280 THR CG2 C N N 281 THR OXT O N N 282 THR H H N N 283 THR H2 H N N 284 THR HA H N N 285 THR HB H N N 286 THR HG1 H N N 287 THR HG21 H N N 288 THR HG22 H N N 289 THR HG23 H N N 290 THR HXT H N N 291 TRP N N N N 292 TRP CA C N S 293 TRP C C N N 294 TRP O O N N 295 TRP CB C N N 296 TRP CG C Y N 297 TRP CD1 C Y N 298 TRP CD2 C Y N 299 TRP NE1 N Y N 300 TRP CE2 C Y N 301 TRP CE3 C Y N 302 TRP CZ2 C Y N 303 TRP CZ3 C Y N 304 TRP CH2 C Y N 305 TRP OXT O N N 306 TRP H H N N 307 TRP H2 H N N 308 TRP HA H N N 309 TRP HB2 H N N 310 TRP HB3 H N N 311 TRP HD1 H N N 312 TRP HE1 H N N 313 TRP HE3 H N N 314 TRP HZ2 H N N 315 TRP HZ3 H N N 316 TRP HH2 H N N 317 TRP HXT H N N 318 TYR N N N N 319 TYR CA C N S 320 TYR C C N N 321 TYR O O N N 322 TYR CB C N N 323 TYR CG C Y N 324 TYR CD1 C Y N 325 TYR CD2 C Y N 326 TYR CE1 C Y N 327 TYR CE2 C Y N 328 TYR CZ C Y N 329 TYR OH O N N 330 TYR OXT O N N 331 TYR H H N N 332 TYR H2 H N N 333 TYR HA H N N 334 TYR HB2 H N N 335 TYR HB3 H N N 336 TYR HD1 H N N 337 TYR HD2 H N N 338 TYR HE1 H N N 339 TYR HE2 H N N 340 TYR HH H N N 341 TYR HXT H N N 342 VAL N N N N 343 VAL CA C N S 344 VAL C C N N 345 VAL O O N N 346 VAL CB C N N 347 VAL CG1 C N N 348 VAL CG2 C N N 349 VAL OXT O N N 350 VAL H H N N 351 VAL H2 H N N 352 VAL HA H N N 353 VAL HB H N N 354 VAL HG11 H N N 355 VAL HG12 H N N 356 VAL HG13 H N N 357 VAL HG21 H N N 358 VAL HG22 H N N 359 VAL HG23 H N N 360 VAL HXT H N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 HIS N CA sing N N 97 HIS N H sing N N 98 HIS N H2 sing N N 99 HIS CA C sing N N 100 HIS CA CB sing N N 101 HIS CA HA sing N N 102 HIS C O doub N N 103 HIS C OXT sing N N 104 HIS CB CG sing N N 105 HIS CB HB2 sing N N 106 HIS CB HB3 sing N N 107 HIS CG ND1 sing Y N 108 HIS CG CD2 doub Y N 109 HIS ND1 CE1 doub Y N 110 HIS ND1 HD1 sing N N 111 HIS CD2 NE2 sing Y N 112 HIS CD2 HD2 sing N N 113 HIS CE1 NE2 sing Y N 114 HIS CE1 HE1 sing N N 115 HIS NE2 HE2 sing N N 116 HIS OXT HXT sing N N 117 HOH O H1 sing N N 118 HOH O H2 sing N N 119 ILE N CA sing N N 120 ILE N H sing N N 121 ILE N H2 sing N N 122 ILE CA C sing N N 123 ILE CA CB sing N N 124 ILE CA HA sing N N 125 ILE C O doub N N 126 ILE C OXT sing N N 127 ILE CB CG1 sing N N 128 ILE CB CG2 sing N N 129 ILE CB HB sing N N 130 ILE CG1 CD1 sing N N 131 ILE CG1 HG12 sing N N 132 ILE CG1 HG13 sing N N 133 ILE CG2 HG21 sing N N 134 ILE CG2 HG22 sing N N 135 ILE CG2 HG23 sing N N 136 ILE CD1 HD11 sing N N 137 ILE CD1 HD12 sing N N 138 ILE CD1 HD13 sing N N 139 ILE OXT HXT sing N N 140 LEU N CA sing N N 141 LEU N H sing N N 142 LEU N H2 sing N N 143 LEU CA C sing N N 144 LEU CA CB sing N N 145 LEU CA HA sing N N 146 LEU C O doub N N 147 LEU C OXT sing N N 148 LEU CB CG sing N N 149 LEU CB HB2 sing N N 150 LEU CB HB3 sing N N 151 LEU CG CD1 sing N N 152 LEU CG CD2 sing N N 153 LEU CG HG sing N N 154 LEU CD1 HD11 sing N N 155 LEU CD1 HD12 sing N N 156 LEU CD1 HD13 sing N N 157 LEU CD2 HD21 sing N N 158 LEU CD2 HD22 sing N N 159 LEU CD2 HD23 sing N N 160 LEU OXT HXT sing N N 161 LYS N CA sing N N 162 LYS N H sing N N 163 LYS N H2 sing N N 164 LYS CA C sing N N 165 LYS CA CB sing N N 166 LYS CA HA sing N N 167 LYS C O doub N N 168 LYS C OXT sing N N 169 LYS CB CG sing N N 170 LYS CB HB2 sing N N 171 LYS CB HB3 sing N N 172 LYS CG CD sing N N 173 LYS CG HG2 sing N N 174 LYS CG HG3 sing N N 175 LYS CD CE sing N N 176 LYS CD HD2 sing N N 177 LYS CD HD3 sing N N 178 LYS CE NZ sing N N 179 LYS CE HE2 sing N N 180 LYS CE HE3 sing N N 181 LYS NZ HZ1 sing N N 182 LYS NZ HZ2 sing N N 183 LYS NZ HZ3 sing N N 184 LYS OXT HXT sing N N 185 MET N CA sing N N 186 MET N H sing N N 187 MET N H2 sing N N 188 MET CA C sing N N 189 MET CA CB sing N N 190 MET CA HA sing N N 191 MET C O doub N N 192 MET C OXT sing N N 193 MET CB CG sing N N 194 MET CB HB2 sing N N 195 MET CB HB3 sing N N 196 MET CG SD sing N N 197 MET CG HG2 sing N N 198 MET CG HG3 sing N N 199 MET SD CE sing N N 200 MET CE HE1 sing N N 201 MET CE HE2 sing N N 202 MET CE HE3 sing N N 203 MET OXT HXT sing N N 204 PHE N CA sing N N 205 PHE N H sing N N 206 PHE N H2 sing N N 207 PHE CA C sing N N 208 PHE CA CB sing N N 209 PHE CA HA sing N N 210 PHE C O doub N N 211 PHE C OXT sing N N 212 PHE CB CG sing N N 213 PHE CB HB2 sing N N 214 PHE CB HB3 sing N N 215 PHE CG CD1 doub Y N 216 PHE CG CD2 sing Y N 217 PHE CD1 CE1 sing Y N 218 PHE CD1 HD1 sing N N 219 PHE CD2 CE2 doub Y N 220 PHE CD2 HD2 sing N N 221 PHE CE1 CZ doub Y N 222 PHE CE1 HE1 sing N N 223 PHE CE2 CZ sing Y N 224 PHE CE2 HE2 sing N N 225 PHE CZ HZ sing N N 226 PHE OXT HXT sing N N 227 PRO N CA sing N N 228 PRO N CD sing N N 229 PRO N H sing N N 230 PRO CA C sing N N 231 PRO CA CB sing N N 232 PRO CA HA sing N N 233 PRO C O doub N N 234 PRO C OXT sing N N 235 PRO CB CG sing N N 236 PRO CB HB2 sing N N 237 PRO CB HB3 sing N N 238 PRO CG CD sing N N 239 PRO CG HG2 sing N N 240 PRO CG HG3 sing N N 241 PRO CD HD2 sing N N 242 PRO CD HD3 sing N N 243 PRO OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 SO4 S O1 doub N N 258 SO4 S O2 doub N N 259 SO4 S O3 sing N N 260 SO4 S O4 sing N N 261 THR N CA sing N N 262 THR N H sing N N 263 THR N H2 sing N N 264 THR CA C sing N N 265 THR CA CB sing N N 266 THR CA HA sing N N 267 THR C O doub N N 268 THR C OXT sing N N 269 THR CB OG1 sing N N 270 THR CB CG2 sing N N 271 THR CB HB sing N N 272 THR OG1 HG1 sing N N 273 THR CG2 HG21 sing N N 274 THR CG2 HG22 sing N N 275 THR CG2 HG23 sing N N 276 THR OXT HXT sing N N 277 TRP N CA sing N N 278 TRP N H sing N N 279 TRP N H2 sing N N 280 TRP CA C sing N N 281 TRP CA CB sing N N 282 TRP CA HA sing N N 283 TRP C O doub N N 284 TRP C OXT sing N N 285 TRP CB CG sing N N 286 TRP CB HB2 sing N N 287 TRP CB HB3 sing N N 288 TRP CG CD1 doub Y N 289 TRP CG CD2 sing Y N 290 TRP CD1 NE1 sing Y N 291 TRP CD1 HD1 sing N N 292 TRP CD2 CE2 doub Y N 293 TRP CD2 CE3 sing Y N 294 TRP NE1 CE2 sing Y N 295 TRP NE1 HE1 sing N N 296 TRP CE2 CZ2 sing Y N 297 TRP CE3 CZ3 doub Y N 298 TRP CE3 HE3 sing N N 299 TRP CZ2 CH2 doub Y N 300 TRP CZ2 HZ2 sing N N 301 TRP CZ3 CH2 sing Y N 302 TRP CZ3 HZ3 sing N N 303 TRP CH2 HH2 sing N N 304 TRP OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _atom_sites.entry_id 5H0W _atom_sites.fract_transf_matrix[1][1] 0.024108 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015918 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011686 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ #