data_5H48 # _entry.id 5H48 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5H48 pdb_00005h48 10.2210/pdb5h48/pdb WWPDB D_1300001845 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-06 2 'Structure model' 1 1 2017-09-20 3 'Structure model' 2 0 2020-07-29 4 'Structure model' 2 1 2023-11-08 5 'Structure model' 2 2 2024-10-30 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Refinement description' 9 4 'Structure model' 'Structure summary' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' atom_site 3 3 'Structure model' chem_comp 4 3 'Structure model' entity 5 3 'Structure model' pdbx_branch_scheme 6 3 'Structure model' pdbx_chem_comp_identifier 7 3 'Structure model' pdbx_entity_branch 8 3 'Structure model' pdbx_entity_branch_descriptor 9 3 'Structure model' pdbx_entity_branch_link 10 3 'Structure model' pdbx_entity_branch_list 11 3 'Structure model' pdbx_entity_nonpoly 12 3 'Structure model' pdbx_nonpoly_scheme 13 3 'Structure model' pdbx_struct_assembly_gen 14 3 'Structure model' struct_asym 15 3 'Structure model' struct_conn 16 3 'Structure model' struct_site 17 3 'Structure model' struct_site_gen 18 4 'Structure model' chem_comp 19 4 'Structure model' chem_comp_atom 20 4 'Structure model' chem_comp_bond 21 4 'Structure model' database_2 22 4 'Structure model' pdbx_initial_refinement_model 23 5 'Structure model' pdbx_entry_details 24 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_atom_site.auth_asym_id' 13 3 'Structure model' '_atom_site.auth_seq_id' 14 3 'Structure model' '_atom_site.label_asym_id' 15 3 'Structure model' '_chem_comp.name' 16 3 'Structure model' '_chem_comp.type' 17 3 'Structure model' '_entity.formula_weight' 18 3 'Structure model' '_entity.pdbx_description' 19 3 'Structure model' '_entity.pdbx_number_of_molecules' 20 3 'Structure model' '_entity.type' 21 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 22 3 'Structure model' '_struct_conn.pdbx_role' 23 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 24 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 25 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 26 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 4 'Structure model' '_chem_comp.pdbx_synonyms' 29 4 'Structure model' '_database_2.pdbx_DOI' 30 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5H48 _pdbx_database_status.recvd_initial_deposition_date 2016-10-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5H49 unspecified PDB . 5H4B unspecified PDB . 5H4C unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhong, C.' 1 ? 'Shen, J.' 2 ? 'Zhang, H.' 3 ? 'Ding, J.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2211-1247 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 20 _citation.language ? _citation.page_first 2328 _citation.page_last 2340 _citation.title 'Cbln1 and Cbln4 Are Structurally Similar but Differ in GluD2 Binding Interactions.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.celrep.2017.08.031 _citation.pdbx_database_id_PubMed 28877468 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhong, C.' 1 ? primary 'Shen, J.' 2 ? primary 'Zhang, H.' 3 ? primary 'Li, G.' 4 ? primary 'Shen, S.' 5 ? primary 'Wang, F.' 6 ? primary 'Hu, K.' 7 ? primary 'Cao, L.' 8 ? primary 'He, Y.' 9 ? primary 'Ding, J.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Cerebellin-1 20418.984 1 ? ? ? ? 2 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 3 water nat water 18.015 60 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Precerebellin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GTHHHHHHHHGSQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQV LVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYL KLERGNLMGGWKYSTFSGFLVFPL ; _entity_poly.pdbx_seq_one_letter_code_can ;GTHHHHHHHHGSQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQV LVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYL KLERGNLMGGWKYSTFSGFLVFPL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 SER n 1 13 GLN n 1 14 ASN n 1 15 GLU n 1 16 THR n 1 17 GLU n 1 18 PRO n 1 19 ILE n 1 20 VAL n 1 21 LEU n 1 22 GLU n 1 23 GLY n 1 24 LYS n 1 25 CYS n 1 26 LEU n 1 27 VAL n 1 28 VAL n 1 29 CYS n 1 30 ASP n 1 31 SER n 1 32 ASN n 1 33 PRO n 1 34 THR n 1 35 SER n 1 36 ASP n 1 37 PRO n 1 38 THR n 1 39 GLY n 1 40 THR n 1 41 ALA n 1 42 LEU n 1 43 GLY n 1 44 ILE n 1 45 SER n 1 46 VAL n 1 47 ARG n 1 48 SER n 1 49 GLY n 1 50 SER n 1 51 ALA n 1 52 LYS n 1 53 VAL n 1 54 ALA n 1 55 PHE n 1 56 SER n 1 57 ALA n 1 58 ILE n 1 59 ARG n 1 60 SER n 1 61 THR n 1 62 ASN n 1 63 HIS n 1 64 GLU n 1 65 PRO n 1 66 SER n 1 67 GLU n 1 68 MET n 1 69 SER n 1 70 ASN n 1 71 ARG n 1 72 THR n 1 73 MET n 1 74 ILE n 1 75 ILE n 1 76 TYR n 1 77 PHE n 1 78 ASP n 1 79 GLN n 1 80 VAL n 1 81 LEU n 1 82 VAL n 1 83 ASN n 1 84 ILE n 1 85 GLY n 1 86 ASN n 1 87 ASN n 1 88 PHE n 1 89 ASP n 1 90 SER n 1 91 GLU n 1 92 ARG n 1 93 SER n 1 94 THR n 1 95 PHE n 1 96 ILE n 1 97 ALA n 1 98 PRO n 1 99 ARG n 1 100 LYS n 1 101 GLY n 1 102 ILE n 1 103 TYR n 1 104 SER n 1 105 PHE n 1 106 ASN n 1 107 PHE n 1 108 HIS n 1 109 VAL n 1 110 VAL n 1 111 LYS n 1 112 VAL n 1 113 TYR n 1 114 ASN n 1 115 ARG n 1 116 GLN n 1 117 THR n 1 118 ILE n 1 119 GLN n 1 120 VAL n 1 121 SER n 1 122 LEU n 1 123 MET n 1 124 LEU n 1 125 ASN n 1 126 GLY n 1 127 TRP n 1 128 PRO n 1 129 VAL n 1 130 ILE n 1 131 SER n 1 132 ALA n 1 133 PHE n 1 134 ALA n 1 135 GLY n 1 136 ASP n 1 137 GLN n 1 138 ASP n 1 139 VAL n 1 140 THR n 1 141 ARG n 1 142 GLU n 1 143 ALA n 1 144 ALA n 1 145 SER n 1 146 ASN n 1 147 GLY n 1 148 VAL n 1 149 LEU n 1 150 ILE n 1 151 GLN n 1 152 MET n 1 153 GLU n 1 154 LYS n 1 155 GLY n 1 156 ASP n 1 157 ARG n 1 158 ALA n 1 159 TYR n 1 160 LEU n 1 161 LYS n 1 162 LEU n 1 163 GLU n 1 164 ARG n 1 165 GLY n 1 166 ASN n 1 167 LEU n 1 168 MET n 1 169 GLY n 1 170 GLY n 1 171 TRP n 1 172 LYS n 1 173 TYR n 1 174 SER n 1 175 THR n 1 176 PHE n 1 177 SER n 1 178 GLY n 1 179 PHE n 1 180 LEU n 1 181 VAL n 1 182 PHE n 1 183 PRO n 1 184 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 184 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Cbln1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9606 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 NAG _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NAG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 10 ? ? ? A . n A 1 2 THR 2 11 ? ? ? A . n A 1 3 HIS 3 12 ? ? ? A . n A 1 4 HIS 4 13 ? ? ? A . n A 1 5 HIS 5 14 ? ? ? A . n A 1 6 HIS 6 15 ? ? ? A . n A 1 7 HIS 7 16 ? ? ? A . n A 1 8 HIS 8 17 ? ? ? A . n A 1 9 HIS 9 18 ? ? ? A . n A 1 10 HIS 10 19 ? ? ? A . n A 1 11 GLY 11 20 ? ? ? A . n A 1 12 SER 12 21 ? ? ? A . n A 1 13 GLN 13 22 ? ? ? A . n A 1 14 ASN 14 23 ? ? ? A . n A 1 15 GLU 15 24 ? ? ? A . n A 1 16 THR 16 25 ? ? ? A . n A 1 17 GLU 17 26 ? ? ? A . n A 1 18 PRO 18 27 ? ? ? A . n A 1 19 ILE 19 28 ? ? ? A . n A 1 20 VAL 20 29 ? ? ? A . n A 1 21 LEU 21 30 ? ? ? A . n A 1 22 GLU 22 31 ? ? ? A . n A 1 23 GLY 23 32 ? ? ? A . n A 1 24 LYS 24 33 ? ? ? A . n A 1 25 CYS 25 34 ? ? ? A . n A 1 26 LEU 26 35 ? ? ? A . n A 1 27 VAL 27 36 ? ? ? A . n A 1 28 VAL 28 37 ? ? ? A . n A 1 29 CYS 29 38 ? ? ? A . n A 1 30 ASP 30 39 ? ? ? A . n A 1 31 SER 31 40 ? ? ? A . n A 1 32 ASN 32 41 ? ? ? A . n A 1 33 PRO 33 42 ? ? ? A . n A 1 34 THR 34 43 ? ? ? A . n A 1 35 SER 35 44 ? ? ? A . n A 1 36 ASP 36 45 ? ? ? A . n A 1 37 PRO 37 46 ? ? ? A . n A 1 38 THR 38 47 ? ? ? A . n A 1 39 GLY 39 48 ? ? ? A . n A 1 40 THR 40 49 ? ? ? A . n A 1 41 ALA 41 50 ? ? ? A . n A 1 42 LEU 42 51 ? ? ? A . n A 1 43 GLY 43 52 ? ? ? A . n A 1 44 ILE 44 53 ? ? ? A . n A 1 45 SER 45 54 ? ? ? A . n A 1 46 VAL 46 55 ? ? ? A . n A 1 47 ARG 47 56 ? ? ? A . n A 1 48 SER 48 57 ? ? ? A . n A 1 49 GLY 49 58 58 GLY GLY A . n A 1 50 SER 50 59 59 SER SER A . n A 1 51 ALA 51 60 60 ALA ALA A . n A 1 52 LYS 52 61 61 LYS LYS A . n A 1 53 VAL 53 62 62 VAL VAL A . n A 1 54 ALA 54 63 63 ALA ALA A . n A 1 55 PHE 55 64 64 PHE PHE A . n A 1 56 SER 56 65 65 SER SER A . n A 1 57 ALA 57 66 66 ALA ALA A . n A 1 58 ILE 58 67 67 ILE ILE A . n A 1 59 ARG 59 68 68 ARG ARG A . n A 1 60 SER 60 69 69 SER SER A . n A 1 61 THR 61 70 70 THR THR A . n A 1 62 ASN 62 71 71 ASN ASN A . n A 1 63 HIS 63 72 72 HIS HIS A . n A 1 64 GLU 64 73 73 GLU GLU A . n A 1 65 PRO 65 74 74 PRO PRO A . n A 1 66 SER 66 75 75 SER SER A . n A 1 67 GLU 67 76 76 GLU GLU A . n A 1 68 MET 68 77 77 MET MET A . n A 1 69 SER 69 78 78 SER SER A . n A 1 70 ASN 70 79 79 ASN ASN A . n A 1 71 ARG 71 80 80 ARG ARG A . n A 1 72 THR 72 81 81 THR THR A . n A 1 73 MET 73 82 82 MET MET A . n A 1 74 ILE 74 83 83 ILE ILE A . n A 1 75 ILE 75 84 84 ILE ILE A . n A 1 76 TYR 76 85 85 TYR TYR A . n A 1 77 PHE 77 86 86 PHE PHE A . n A 1 78 ASP 78 87 87 ASP ASP A . n A 1 79 GLN 79 88 88 GLN GLN A . n A 1 80 VAL 80 89 89 VAL VAL A . n A 1 81 LEU 81 90 90 LEU LEU A . n A 1 82 VAL 82 91 91 VAL VAL A . n A 1 83 ASN 83 92 92 ASN ASN A . n A 1 84 ILE 84 93 93 ILE ILE A . n A 1 85 GLY 85 94 94 GLY GLY A . n A 1 86 ASN 86 95 95 ASN ASN A . n A 1 87 ASN 87 96 96 ASN ASN A . n A 1 88 PHE 88 97 97 PHE PHE A . n A 1 89 ASP 89 98 98 ASP ASP A . n A 1 90 SER 90 99 99 SER SER A . n A 1 91 GLU 91 100 100 GLU GLU A . n A 1 92 ARG 92 101 101 ARG ARG A . n A 1 93 SER 93 102 102 SER SER A . n A 1 94 THR 94 103 103 THR THR A . n A 1 95 PHE 95 104 104 PHE PHE A . n A 1 96 ILE 96 105 105 ILE ILE A . n A 1 97 ALA 97 106 106 ALA ALA A . n A 1 98 PRO 98 107 107 PRO PRO A . n A 1 99 ARG 99 108 108 ARG ARG A . n A 1 100 LYS 100 109 109 LYS LYS A . n A 1 101 GLY 101 110 110 GLY GLY A . n A 1 102 ILE 102 111 111 ILE ILE A . n A 1 103 TYR 103 112 112 TYR TYR A . n A 1 104 SER 104 113 113 SER SER A . n A 1 105 PHE 105 114 114 PHE PHE A . n A 1 106 ASN 106 115 115 ASN ASN A . n A 1 107 PHE 107 116 116 PHE PHE A . n A 1 108 HIS 108 117 117 HIS HIS A . n A 1 109 VAL 109 118 118 VAL VAL A . n A 1 110 VAL 110 119 119 VAL VAL A . n A 1 111 LYS 111 120 120 LYS LYS A . n A 1 112 VAL 112 121 121 VAL VAL A . n A 1 113 TYR 113 122 122 TYR TYR A . n A 1 114 ASN 114 123 123 ASN ASN A . n A 1 115 ARG 115 124 124 ARG ARG A . n A 1 116 GLN 116 125 125 GLN GLN A . n A 1 117 THR 117 126 126 THR THR A . n A 1 118 ILE 118 127 127 ILE ILE A . n A 1 119 GLN 119 128 128 GLN GLN A . n A 1 120 VAL 120 129 129 VAL VAL A . n A 1 121 SER 121 130 130 SER SER A . n A 1 122 LEU 122 131 131 LEU LEU A . n A 1 123 MET 123 132 132 MET MET A . n A 1 124 LEU 124 133 133 LEU LEU A . n A 1 125 ASN 125 134 134 ASN ASN A . n A 1 126 GLY 126 135 135 GLY GLY A . n A 1 127 TRP 127 136 136 TRP TRP A . n A 1 128 PRO 128 137 137 PRO PRO A . n A 1 129 VAL 129 138 138 VAL VAL A . n A 1 130 ILE 130 139 139 ILE ILE A . n A 1 131 SER 131 140 140 SER SER A . n A 1 132 ALA 132 141 141 ALA ALA A . n A 1 133 PHE 133 142 142 PHE PHE A . n A 1 134 ALA 134 143 143 ALA ALA A . n A 1 135 GLY 135 144 144 GLY GLY A . n A 1 136 ASP 136 145 145 ASP ASP A . n A 1 137 GLN 137 146 146 GLN GLN A . n A 1 138 ASP 138 147 147 ASP ASP A . n A 1 139 VAL 139 148 148 VAL VAL A . n A 1 140 THR 140 149 149 THR THR A . n A 1 141 ARG 141 150 150 ARG ARG A . n A 1 142 GLU 142 151 151 GLU GLU A . n A 1 143 ALA 143 152 152 ALA ALA A . n A 1 144 ALA 144 153 153 ALA ALA A . n A 1 145 SER 145 154 154 SER SER A . n A 1 146 ASN 146 155 155 ASN ASN A . n A 1 147 GLY 147 156 156 GLY GLY A . n A 1 148 VAL 148 157 157 VAL VAL A . n A 1 149 LEU 149 158 158 LEU LEU A . n A 1 150 ILE 150 159 159 ILE ILE A . n A 1 151 GLN 151 160 160 GLN GLN A . n A 1 152 MET 152 161 161 MET MET A . n A 1 153 GLU 153 162 162 GLU GLU A . n A 1 154 LYS 154 163 163 LYS LYS A . n A 1 155 GLY 155 164 164 GLY GLY A . n A 1 156 ASP 156 165 165 ASP ASP A . n A 1 157 ARG 157 166 166 ARG ARG A . n A 1 158 ALA 158 167 167 ALA ALA A . n A 1 159 TYR 159 168 168 TYR TYR A . n A 1 160 LEU 160 169 169 LEU LEU A . n A 1 161 LYS 161 170 170 LYS LYS A . n A 1 162 LEU 162 171 171 LEU LEU A . n A 1 163 GLU 163 172 172 GLU GLU A . n A 1 164 ARG 164 173 173 ARG ARG A . n A 1 165 GLY 165 174 174 GLY GLY A . n A 1 166 ASN 166 175 175 ASN ASN A . n A 1 167 LEU 167 176 176 LEU LEU A . n A 1 168 MET 168 177 177 MET MET A . n A 1 169 GLY 169 178 178 GLY GLY A . n A 1 170 GLY 170 179 179 GLY GLY A . n A 1 171 TRP 171 180 180 TRP TRP A . n A 1 172 LYS 172 181 181 LYS LYS A . n A 1 173 TYR 173 182 182 TYR TYR A . n A 1 174 SER 174 183 183 SER SER A . n A 1 175 THR 175 184 184 THR THR A . n A 1 176 PHE 176 185 185 PHE PHE A . n A 1 177 SER 177 186 186 SER SER A . n A 1 178 GLY 178 187 187 GLY GLY A . n A 1 179 PHE 179 188 188 PHE PHE A . n A 1 180 LEU 180 189 189 LEU LEU A . n A 1 181 VAL 181 190 190 VAL VAL A . n A 1 182 PHE 182 191 191 PHE PHE A . n A 1 183 PRO 183 192 192 PRO PRO A . n A 1 184 LEU 184 193 193 LEU LEU A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 A NAG 199 n B 2 NAG 2 B NAG 2 A NAG 200 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 301 31 HOH HOH A . C 3 HOH 2 302 50 HOH HOH A . C 3 HOH 3 303 33 HOH HOH A . C 3 HOH 4 304 22 HOH HOH A . C 3 HOH 5 305 1 HOH HOH A . C 3 HOH 6 306 34 HOH HOH A . C 3 HOH 7 307 10 HOH HOH A . C 3 HOH 8 308 5 HOH HOH A . C 3 HOH 9 309 30 HOH HOH A . C 3 HOH 10 310 60 HOH HOH A . C 3 HOH 11 311 14 HOH HOH A . C 3 HOH 12 312 44 HOH HOH A . C 3 HOH 13 313 20 HOH HOH A . C 3 HOH 14 314 54 HOH HOH A . C 3 HOH 15 315 13 HOH HOH A . C 3 HOH 16 316 9 HOH HOH A . C 3 HOH 17 317 45 HOH HOH A . C 3 HOH 18 318 37 HOH HOH A . C 3 HOH 19 319 3 HOH HOH A . C 3 HOH 20 320 16 HOH HOH A . C 3 HOH 21 321 12 HOH HOH A . C 3 HOH 22 322 23 HOH HOH A . C 3 HOH 23 323 2 HOH HOH A . C 3 HOH 24 324 8 HOH HOH A . C 3 HOH 25 325 18 HOH HOH A . C 3 HOH 26 326 17 HOH HOH A . C 3 HOH 27 327 6 HOH HOH A . C 3 HOH 28 328 4 HOH HOH A . C 3 HOH 29 329 24 HOH HOH A . C 3 HOH 30 330 41 HOH HOH A . C 3 HOH 31 331 48 HOH HOH A . C 3 HOH 32 332 47 HOH HOH A . C 3 HOH 33 333 21 HOH HOH A . C 3 HOH 34 334 15 HOH HOH A . C 3 HOH 35 335 36 HOH HOH A . C 3 HOH 36 336 11 HOH HOH A . C 3 HOH 37 337 51 HOH HOH A . C 3 HOH 38 338 56 HOH HOH A . C 3 HOH 39 339 7 HOH HOH A . C 3 HOH 40 340 28 HOH HOH A . C 3 HOH 41 341 19 HOH HOH A . C 3 HOH 42 342 57 HOH HOH A . C 3 HOH 43 343 26 HOH HOH A . C 3 HOH 44 344 59 HOH HOH A . C 3 HOH 45 345 39 HOH HOH A . C 3 HOH 46 346 52 HOH HOH A . C 3 HOH 47 347 46 HOH HOH A . C 3 HOH 48 348 58 HOH HOH A . C 3 HOH 49 349 55 HOH HOH A . C 3 HOH 50 350 53 HOH HOH A . C 3 HOH 51 351 49 HOH HOH A . C 3 HOH 52 352 29 HOH HOH A . C 3 HOH 53 353 32 HOH HOH A . C 3 HOH 54 354 27 HOH HOH A . C 3 HOH 55 355 25 HOH HOH A . C 3 HOH 56 356 40 HOH HOH A . C 3 HOH 57 357 43 HOH HOH A . C 3 HOH 58 358 38 HOH HOH A . C 3 HOH 59 359 35 HOH HOH A . C 3 HOH 60 360 42 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0155 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5H48 _cell.details ? _cell.formula_units_Z ? _cell.length_a 82.981 _cell.length_a_esd ? _cell.length_b 82.981 _cell.length_b_esd ? _cell.length_c 50.543 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5H48 _symmetry.cell_setting ? _symmetry.Int_Tables_number 168 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 6' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5H48 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Sodium tartrate dibasic dihydrate, 20% PEG3350, pH 7.3' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-325' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-10-31 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9199 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9199 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5H48 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.20 _reflns.d_resolution_low 71.86 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9670 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.41 _refine.aniso_B[1][2] 0.20 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.41 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -1.32 _refine.B_iso_max ? _refine.B_iso_mean 35.338 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.963 _refine.correlation_coeff_Fo_to_Fc_free 0.937 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5H48 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.20 _refine.ls_d_res_low 71.86 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9140 _refine.ls_number_reflns_R_free 435 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.78 _refine.ls_percent_reflns_R_free 4.5 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.16476 _refine.ls_R_factor_R_free 0.20297 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.16307 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4NN0 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.192 _refine.pdbx_overall_ESU_R_Free 0.166 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.473 _refine.overall_SU_ML 0.112 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1078 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 60 _refine_hist.number_atoms_total 1166 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 71.86 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.019 1144 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1071 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.567 1.958 1549 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.791 3.000 2453 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.382 5.000 137 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.730 23.333 54 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.133 15.000 186 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.701 15.000 8 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.093 0.200 170 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1302 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 290 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 3.028 3.138 548 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.018 3.136 547 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.068 4.681 685 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.068 4.682 686 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.408 3.846 596 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.404 3.852 597 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 6.618 5.607 865 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 8.443 62.982 4687 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 8.427 62.942 4671 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.201 _refine_ls_shell.d_res_low 2.258 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 41 _refine_ls_shell.number_reflns_R_work 637 _refine_ls_shell.percent_reflns_obs 90.64 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.250 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.214 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5H48 _struct.title 'Crystal structure of Cbln1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5H48 _struct_keywords.text 'C1q domain, C1q/TNF superfamily, receptor specificity, synaptogenesis, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CBLN1_RAT _struct_ref.pdbx_db_accession P63182 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSER STFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWK YSTFSGFLVFPL ; _struct_ref.pdbx_align_begin 22 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5H48 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 13 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 184 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P63182 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 193 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 22 _struct_ref_seq.pdbx_auth_seq_align_end 193 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5H48 GLY A 1 ? UNP P63182 ? ? 'expression tag' 10 1 1 5H48 THR A 2 ? UNP P63182 ? ? 'expression tag' 11 2 1 5H48 HIS A 3 ? UNP P63182 ? ? 'expression tag' 12 3 1 5H48 HIS A 4 ? UNP P63182 ? ? 'expression tag' 13 4 1 5H48 HIS A 5 ? UNP P63182 ? ? 'expression tag' 14 5 1 5H48 HIS A 6 ? UNP P63182 ? ? 'expression tag' 15 6 1 5H48 HIS A 7 ? UNP P63182 ? ? 'expression tag' 16 7 1 5H48 HIS A 8 ? UNP P63182 ? ? 'expression tag' 17 8 1 5H48 HIS A 9 ? UNP P63182 ? ? 'expression tag' 18 9 1 5H48 HIS A 10 ? UNP P63182 ? ? 'expression tag' 19 10 1 5H48 GLY A 11 ? UNP P63182 ? ? 'expression tag' 20 11 1 5H48 SER A 12 ? UNP P63182 ? ? 'expression tag' 21 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6330 ? 1 MORE -25 ? 1 'SSA (A^2)' 16990 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -y,x-y-1,z -0.5000000000 -0.8660254038 0.0000000000 41.4795000000 0.8660254038 -0.5000000000 0.0000000000 -71.8446014726 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -x+y+1,-x,z -0.5000000000 0.8660254038 0.0000000000 82.9590000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 66 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id MET _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 73 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 75 _struct_conf.end_auth_comp_id MET _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 82 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A ASN 70 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 79 B NAG 1 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation covale2 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.443 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id NAG _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id ASN _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 70 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id NAG _pdbx_modification_feature.auth_asym_id B _pdbx_modification_feature.auth_seq_id 1 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id ASN _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 79 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C1 _pdbx_modification_feature.modified_residue_id_linking_atom ND2 _pdbx_modification_feature.modified_residue_id ASN _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id NAG _pdbx_modification_feature.type N-Glycosylation _pdbx_modification_feature.category Carbohydrate # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 79 ? ILE A 84 ? GLN A 88 ILE A 93 AA1 2 ALA A 54 ? ILE A 58 ? ALA A 63 ILE A 67 AA1 3 THR A 175 ? PRO A 183 ? THR A 184 PRO A 192 AA1 4 GLY A 101 ? LYS A 111 ? GLY A 110 LYS A 120 AA1 5 GLU A 142 ? MET A 152 ? GLU A 151 MET A 161 AA2 1 PHE A 88 ? ASP A 89 ? PHE A 97 ASP A 98 AA2 2 THR A 94 ? ILE A 96 ? THR A 103 ILE A 105 AA2 3 ARG A 157 ? ARG A 164 ? ARG A 166 ARG A 173 AA2 4 ILE A 118 ? LEU A 124 ? ILE A 127 LEU A 133 AA2 5 TRP A 127 ? ALA A 134 ? TRP A 136 ALA A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLN A 79 ? O GLN A 88 N ILE A 58 ? N ILE A 67 AA1 2 3 N PHE A 55 ? N PHE A 64 O GLY A 178 ? O GLY A 187 AA1 3 4 O THR A 175 ? O THR A 184 N HIS A 108 ? N HIS A 117 AA1 4 5 N LYS A 111 ? N LYS A 120 O GLU A 142 ? O GLU A 151 AA2 1 2 N ASP A 89 ? N ASP A 98 O THR A 94 ? O THR A 103 AA2 2 3 N PHE A 95 ? N PHE A 104 O ALA A 158 ? O ALA A 167 AA2 3 4 O TYR A 159 ? O TYR A 168 N MET A 123 ? N MET A 132 AA2 4 5 N LEU A 122 ? N LEU A 131 O VAL A 129 ? O VAL A 138 # _pdbx_entry_details.entry_id 5H48 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 82 ? ? 59.24 19.72 2 1 ASN A 92 ? ? -158.20 59.90 3 1 ASN A 123 ? ? -157.81 23.72 4 1 TYR A 182 ? ? 84.13 -1.88 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 10 ? A GLY 1 2 1 Y 1 A THR 11 ? A THR 2 3 1 Y 1 A HIS 12 ? A HIS 3 4 1 Y 1 A HIS 13 ? A HIS 4 5 1 Y 1 A HIS 14 ? A HIS 5 6 1 Y 1 A HIS 15 ? A HIS 6 7 1 Y 1 A HIS 16 ? A HIS 7 8 1 Y 1 A HIS 17 ? A HIS 8 9 1 Y 1 A HIS 18 ? A HIS 9 10 1 Y 1 A HIS 19 ? A HIS 10 11 1 Y 1 A GLY 20 ? A GLY 11 12 1 Y 1 A SER 21 ? A SER 12 13 1 Y 1 A GLN 22 ? A GLN 13 14 1 Y 1 A ASN 23 ? A ASN 14 15 1 Y 1 A GLU 24 ? A GLU 15 16 1 Y 1 A THR 25 ? A THR 16 17 1 Y 1 A GLU 26 ? A GLU 17 18 1 Y 1 A PRO 27 ? A PRO 18 19 1 Y 1 A ILE 28 ? A ILE 19 20 1 Y 1 A VAL 29 ? A VAL 20 21 1 Y 1 A LEU 30 ? A LEU 21 22 1 Y 1 A GLU 31 ? A GLU 22 23 1 Y 1 A GLY 32 ? A GLY 23 24 1 Y 1 A LYS 33 ? A LYS 24 25 1 Y 1 A CYS 34 ? A CYS 25 26 1 Y 1 A LEU 35 ? A LEU 26 27 1 Y 1 A VAL 36 ? A VAL 27 28 1 Y 1 A VAL 37 ? A VAL 28 29 1 Y 1 A CYS 38 ? A CYS 29 30 1 Y 1 A ASP 39 ? A ASP 30 31 1 Y 1 A SER 40 ? A SER 31 32 1 Y 1 A ASN 41 ? A ASN 32 33 1 Y 1 A PRO 42 ? A PRO 33 34 1 Y 1 A THR 43 ? A THR 34 35 1 Y 1 A SER 44 ? A SER 35 36 1 Y 1 A ASP 45 ? A ASP 36 37 1 Y 1 A PRO 46 ? A PRO 37 38 1 Y 1 A THR 47 ? A THR 38 39 1 Y 1 A GLY 48 ? A GLY 39 40 1 Y 1 A THR 49 ? A THR 40 41 1 Y 1 A ALA 50 ? A ALA 41 42 1 Y 1 A LEU 51 ? A LEU 42 43 1 Y 1 A GLY 52 ? A GLY 43 44 1 Y 1 A ILE 53 ? A ILE 44 45 1 Y 1 A SER 54 ? A SER 45 46 1 Y 1 A VAL 55 ? A VAL 46 47 1 Y 1 A ARG 56 ? A ARG 47 48 1 Y 1 A SER 57 ? A SER 48 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NAG C1 C N R 250 NAG C2 C N R 251 NAG C3 C N R 252 NAG C4 C N S 253 NAG C5 C N R 254 NAG C6 C N N 255 NAG C7 C N N 256 NAG C8 C N N 257 NAG N2 N N N 258 NAG O1 O N N 259 NAG O3 O N N 260 NAG O4 O N N 261 NAG O5 O N N 262 NAG O6 O N N 263 NAG O7 O N N 264 NAG H1 H N N 265 NAG H2 H N N 266 NAG H3 H N N 267 NAG H4 H N N 268 NAG H5 H N N 269 NAG H61 H N N 270 NAG H62 H N N 271 NAG H81 H N N 272 NAG H82 H N N 273 NAG H83 H N N 274 NAG HN2 H N N 275 NAG HO1 H N N 276 NAG HO3 H N N 277 NAG HO4 H N N 278 NAG HO6 H N N 279 PHE N N N N 280 PHE CA C N S 281 PHE C C N N 282 PHE O O N N 283 PHE CB C N N 284 PHE CG C Y N 285 PHE CD1 C Y N 286 PHE CD2 C Y N 287 PHE CE1 C Y N 288 PHE CE2 C Y N 289 PHE CZ C Y N 290 PHE OXT O N N 291 PHE H H N N 292 PHE H2 H N N 293 PHE HA H N N 294 PHE HB2 H N N 295 PHE HB3 H N N 296 PHE HD1 H N N 297 PHE HD2 H N N 298 PHE HE1 H N N 299 PHE HE2 H N N 300 PHE HZ H N N 301 PHE HXT H N N 302 PRO N N N N 303 PRO CA C N S 304 PRO C C N N 305 PRO O O N N 306 PRO CB C N N 307 PRO CG C N N 308 PRO CD C N N 309 PRO OXT O N N 310 PRO H H N N 311 PRO HA H N N 312 PRO HB2 H N N 313 PRO HB3 H N N 314 PRO HG2 H N N 315 PRO HG3 H N N 316 PRO HD2 H N N 317 PRO HD3 H N N 318 PRO HXT H N N 319 SER N N N N 320 SER CA C N S 321 SER C C N N 322 SER O O N N 323 SER CB C N N 324 SER OG O N N 325 SER OXT O N N 326 SER H H N N 327 SER H2 H N N 328 SER HA H N N 329 SER HB2 H N N 330 SER HB3 H N N 331 SER HG H N N 332 SER HXT H N N 333 THR N N N N 334 THR CA C N S 335 THR C C N N 336 THR O O N N 337 THR CB C N R 338 THR OG1 O N N 339 THR CG2 C N N 340 THR OXT O N N 341 THR H H N N 342 THR H2 H N N 343 THR HA H N N 344 THR HB H N N 345 THR HG1 H N N 346 THR HG21 H N N 347 THR HG22 H N N 348 THR HG23 H N N 349 THR HXT H N N 350 TRP N N N N 351 TRP CA C N S 352 TRP C C N N 353 TRP O O N N 354 TRP CB C N N 355 TRP CG C Y N 356 TRP CD1 C Y N 357 TRP CD2 C Y N 358 TRP NE1 N Y N 359 TRP CE2 C Y N 360 TRP CE3 C Y N 361 TRP CZ2 C Y N 362 TRP CZ3 C Y N 363 TRP CH2 C Y N 364 TRP OXT O N N 365 TRP H H N N 366 TRP H2 H N N 367 TRP HA H N N 368 TRP HB2 H N N 369 TRP HB3 H N N 370 TRP HD1 H N N 371 TRP HE1 H N N 372 TRP HE3 H N N 373 TRP HZ2 H N N 374 TRP HZ3 H N N 375 TRP HH2 H N N 376 TRP HXT H N N 377 TYR N N N N 378 TYR CA C N S 379 TYR C C N N 380 TYR O O N N 381 TYR CB C N N 382 TYR CG C Y N 383 TYR CD1 C Y N 384 TYR CD2 C Y N 385 TYR CE1 C Y N 386 TYR CE2 C Y N 387 TYR CZ C Y N 388 TYR OH O N N 389 TYR OXT O N N 390 TYR H H N N 391 TYR H2 H N N 392 TYR HA H N N 393 TYR HB2 H N N 394 TYR HB3 H N N 395 TYR HD1 H N N 396 TYR HD2 H N N 397 TYR HE1 H N N 398 TYR HE2 H N N 399 TYR HH H N N 400 TYR HXT H N N 401 VAL N N N N 402 VAL CA C N S 403 VAL C C N N 404 VAL O O N N 405 VAL CB C N N 406 VAL CG1 C N N 407 VAL CG2 C N N 408 VAL OXT O N N 409 VAL H H N N 410 VAL H2 H N N 411 VAL HA H N N 412 VAL HB H N N 413 VAL HG11 H N N 414 VAL HG12 H N N 415 VAL HG13 H N N 416 VAL HG21 H N N 417 VAL HG22 H N N 418 VAL HG23 H N N 419 VAL HXT H N N 420 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 NAG C1 C2 sing N N 237 NAG C1 O1 sing N N 238 NAG C1 O5 sing N N 239 NAG C1 H1 sing N N 240 NAG C2 C3 sing N N 241 NAG C2 N2 sing N N 242 NAG C2 H2 sing N N 243 NAG C3 C4 sing N N 244 NAG C3 O3 sing N N 245 NAG C3 H3 sing N N 246 NAG C4 C5 sing N N 247 NAG C4 O4 sing N N 248 NAG C4 H4 sing N N 249 NAG C5 C6 sing N N 250 NAG C5 O5 sing N N 251 NAG C5 H5 sing N N 252 NAG C6 O6 sing N N 253 NAG C6 H61 sing N N 254 NAG C6 H62 sing N N 255 NAG C7 C8 sing N N 256 NAG C7 N2 sing N N 257 NAG C7 O7 doub N N 258 NAG C8 H81 sing N N 259 NAG C8 H82 sing N N 260 NAG C8 H83 sing N N 261 NAG N2 HN2 sing N N 262 NAG O1 HO1 sing N N 263 NAG O3 HO3 sing N N 264 NAG O4 HO4 sing N N 265 NAG O6 HO6 sing N N 266 PHE N CA sing N N 267 PHE N H sing N N 268 PHE N H2 sing N N 269 PHE CA C sing N N 270 PHE CA CB sing N N 271 PHE CA HA sing N N 272 PHE C O doub N N 273 PHE C OXT sing N N 274 PHE CB CG sing N N 275 PHE CB HB2 sing N N 276 PHE CB HB3 sing N N 277 PHE CG CD1 doub Y N 278 PHE CG CD2 sing Y N 279 PHE CD1 CE1 sing Y N 280 PHE CD1 HD1 sing N N 281 PHE CD2 CE2 doub Y N 282 PHE CD2 HD2 sing N N 283 PHE CE1 CZ doub Y N 284 PHE CE1 HE1 sing N N 285 PHE CE2 CZ sing Y N 286 PHE CE2 HE2 sing N N 287 PHE CZ HZ sing N N 288 PHE OXT HXT sing N N 289 PRO N CA sing N N 290 PRO N CD sing N N 291 PRO N H sing N N 292 PRO CA C sing N N 293 PRO CA CB sing N N 294 PRO CA HA sing N N 295 PRO C O doub N N 296 PRO C OXT sing N N 297 PRO CB CG sing N N 298 PRO CB HB2 sing N N 299 PRO CB HB3 sing N N 300 PRO CG CD sing N N 301 PRO CG HG2 sing N N 302 PRO CG HG3 sing N N 303 PRO CD HD2 sing N N 304 PRO CD HD3 sing N N 305 PRO OXT HXT sing N N 306 SER N CA sing N N 307 SER N H sing N N 308 SER N H2 sing N N 309 SER CA C sing N N 310 SER CA CB sing N N 311 SER CA HA sing N N 312 SER C O doub N N 313 SER C OXT sing N N 314 SER CB OG sing N N 315 SER CB HB2 sing N N 316 SER CB HB3 sing N N 317 SER OG HG sing N N 318 SER OXT HXT sing N N 319 THR N CA sing N N 320 THR N H sing N N 321 THR N H2 sing N N 322 THR CA C sing N N 323 THR CA CB sing N N 324 THR CA HA sing N N 325 THR C O doub N N 326 THR C OXT sing N N 327 THR CB OG1 sing N N 328 THR CB CG2 sing N N 329 THR CB HB sing N N 330 THR OG1 HG1 sing N N 331 THR CG2 HG21 sing N N 332 THR CG2 HG22 sing N N 333 THR CG2 HG23 sing N N 334 THR OXT HXT sing N N 335 TRP N CA sing N N 336 TRP N H sing N N 337 TRP N H2 sing N N 338 TRP CA C sing N N 339 TRP CA CB sing N N 340 TRP CA HA sing N N 341 TRP C O doub N N 342 TRP C OXT sing N N 343 TRP CB CG sing N N 344 TRP CB HB2 sing N N 345 TRP CB HB3 sing N N 346 TRP CG CD1 doub Y N 347 TRP CG CD2 sing Y N 348 TRP CD1 NE1 sing Y N 349 TRP CD1 HD1 sing N N 350 TRP CD2 CE2 doub Y N 351 TRP CD2 CE3 sing Y N 352 TRP NE1 CE2 sing Y N 353 TRP NE1 HE1 sing N N 354 TRP CE2 CZ2 sing Y N 355 TRP CE3 CZ3 doub Y N 356 TRP CE3 HE3 sing N N 357 TRP CZ2 CH2 doub Y N 358 TRP CZ2 HZ2 sing N N 359 TRP CZ3 CH2 sing Y N 360 TRP CZ3 HZ3 sing N N 361 TRP CH2 HH2 sing N N 362 TRP OXT HXT sing N N 363 TYR N CA sing N N 364 TYR N H sing N N 365 TYR N H2 sing N N 366 TYR CA C sing N N 367 TYR CA CB sing N N 368 TYR CA HA sing N N 369 TYR C O doub N N 370 TYR C OXT sing N N 371 TYR CB CG sing N N 372 TYR CB HB2 sing N N 373 TYR CB HB3 sing N N 374 TYR CG CD1 doub Y N 375 TYR CG CD2 sing Y N 376 TYR CD1 CE1 sing Y N 377 TYR CD1 HD1 sing N N 378 TYR CD2 CE2 doub Y N 379 TYR CD2 HD2 sing N N 380 TYR CE1 CZ doub Y N 381 TYR CE1 HE1 sing N N 382 TYR CE2 CZ sing Y N 383 TYR CE2 HE2 sing N N 384 TYR CZ OH sing N N 385 TYR OH HH sing N N 386 TYR OXT HXT sing N N 387 VAL N CA sing N N 388 VAL N H sing N N 389 VAL N H2 sing N N 390 VAL CA C sing N N 391 VAL CA CB sing N N 392 VAL CA HA sing N N 393 VAL C O doub N N 394 VAL C OXT sing N N 395 VAL CB CG1 sing N N 396 VAL CB CG2 sing N N 397 VAL CB HB sing N N 398 VAL CG1 HG11 sing N N 399 VAL CG1 HG12 sing N N 400 VAL CG1 HG13 sing N N 401 VAL CG2 HG21 sing N N 402 VAL CG2 HG22 sing N N 403 VAL CG2 HG23 sing N N 404 VAL OXT HXT sing N N 405 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'the National Natural Science Foundation of China' China 31370726 1 'the Ministry of Science and Technology of China' China 2013CB910404 2 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4NN0 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5H48 _atom_sites.fract_transf_matrix[1][1] 0.012051 _atom_sites.fract_transf_matrix[1][2] 0.006958 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013915 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019785 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_