data_5H4D
#
_entry.id 5H4D
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.368
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 5H4D pdb_00005h4d 10.2210/pdb5h4d/pdb
WWPDB D_1300001420 ? ?
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.entry_id 5H4D
_pdbx_database_status.recvd_initial_deposition_date 2016-10-31
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site PDBJ
_pdbx_database_status.process_site PDBJ
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible Y
_pdbx_database_status.status_code_nmr_data ?
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
_audit_author.identifier_ORCID
'Zhang, S.' 1 ?
'Fu, L.' 2 ?
'Liu, J.' 3 ?
'Liu, B.' 4 ?
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country ?
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev 'To Be Published'
_citation.journal_id_ASTM ?
_citation.journal_id_CSD 0353
_citation.journal_id_ISSN ?
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume ?
_citation.language ?
_citation.page_first ?
_citation.page_last ?
_citation.title 'Crystal structure of hSIRT3 in complex with a specific agonist Amiodarone hydrochloride'
_citation.year ?
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI ?
_citation.pdbx_database_id_PubMed ?
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Zhang, S.' 1 ?
primary 'Fu, L.' 2 ?
primary 'Liu, J.' 3 ?
primary 'Liu, B.' 4 ?
#
_cell.angle_alpha 90.000
_cell.angle_alpha_esd ?
_cell.angle_beta 90.000
_cell.angle_beta_esd ?
_cell.angle_gamma 120.000
_cell.angle_gamma_esd ?
_cell.entry_id 5H4D
_cell.details ?
_cell.formula_units_Z ?
_cell.length_a 114.560
_cell.length_a_esd ?
_cell.length_b 114.560
_cell.length_b_esd ?
_cell.length_c 123.404
_cell.length_c_esd ?
_cell.volume ?
_cell.volume_esd ?
_cell.Z_PDB 18
_cell.reciprocal_angle_alpha ?
_cell.reciprocal_angle_beta ?
_cell.reciprocal_angle_gamma ?
_cell.reciprocal_angle_alpha_esd ?
_cell.reciprocal_angle_beta_esd ?
_cell.reciprocal_angle_gamma_esd ?
_cell.reciprocal_length_a ?
_cell.reciprocal_length_b ?
_cell.reciprocal_length_c ?
_cell.reciprocal_length_a_esd ?
_cell.reciprocal_length_b_esd ?
_cell.reciprocal_length_c_esd ?
_cell.pdbx_unique_axis ?
#
_symmetry.entry_id 5H4D
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 146
_symmetry.space_group_name_Hall ?
_symmetry.space_group_name_H-M 'H 3'
_symmetry.pdbx_full_space_group_name_H-M ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man 'NAD-dependent protein deacetylase sirtuin-3, mitochondrial' 30195.838 2 3.5.1.- ?
'UNP residues 121-391' ?
2 polymer man ARG-HIS-LYS 612.744 2 ? ? ? ?
3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ?
4 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ?
5 non-polymer syn '(2-butyl-1-benzofuran-3-yl){4-[2-(diethylamino)ethoxy]-3,5-diiodophenyl}methanone' 645.312 2 ? ? ? ?
6 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425 2 ? ? ? ?
7 non-polymer syn 7-AMINO-4-METHYL-CHROMEN-2-ONE 175.184 2 ? ? ? ?
8 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 2 ? ? ? ?
#
_entity_name_com.entity_id 1
_entity_name_com.name 'hSIRT3,Regulatory protein SIR2 homolog 3,SIR2-like protein 3'
#
loop_
_entity_poly.entity_id
_entity_poly.type
_entity_poly.nstd_linkage
_entity_poly.nstd_monomer
_entity_poly.pdbx_seq_one_letter_code
_entity_poly.pdbx_seq_one_letter_code_can
_entity_poly.pdbx_strand_id
_entity_poly.pdbx_target_identifier
1 'polypeptide(L)' no no
;GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELY
PGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRC
PVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDV
AQLGDVVHGVESLVELLGWTEEMRDLVQRET
;
;GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELY
PGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRC
PVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDV
AQLGDVVHGVESLVELLGWTEEMRDLVQRET
;
A,H ?
2 'polypeptide(L)' no yes 'RHK(ALY)' RHKK D,C ?
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 GLY n
1 2 LYS n
1 3 LEU n
1 4 SER n
1 5 LEU n
1 6 GLN n
1 7 ASP n
1 8 VAL n
1 9 ALA n
1 10 GLU n
1 11 LEU n
1 12 ILE n
1 13 ARG n
1 14 ALA n
1 15 ARG n
1 16 ALA n
1 17 CYS n
1 18 GLN n
1 19 ARG n
1 20 VAL n
1 21 VAL n
1 22 VAL n
1 23 MET n
1 24 VAL n
1 25 GLY n
1 26 ALA n
1 27 GLY n
1 28 ILE n
1 29 SER n
1 30 THR n
1 31 PRO n
1 32 SER n
1 33 GLY n
1 34 ILE n
1 35 PRO n
1 36 ASP n
1 37 PHE n
1 38 ARG n
1 39 SER n
1 40 PRO n
1 41 GLY n
1 42 SER n
1 43 GLY n
1 44 LEU n
1 45 TYR n
1 46 SER n
1 47 ASN n
1 48 LEU n
1 49 GLN n
1 50 GLN n
1 51 TYR n
1 52 ASP n
1 53 LEU n
1 54 PRO n
1 55 TYR n
1 56 PRO n
1 57 GLU n
1 58 ALA n
1 59 ILE n
1 60 PHE n
1 61 GLU n
1 62 LEU n
1 63 PRO n
1 64 PHE n
1 65 PHE n
1 66 PHE n
1 67 HIS n
1 68 ASN n
1 69 PRO n
1 70 LYS n
1 71 PRO n
1 72 PHE n
1 73 PHE n
1 74 THR n
1 75 LEU n
1 76 ALA n
1 77 LYS n
1 78 GLU n
1 79 LEU n
1 80 TYR n
1 81 PRO n
1 82 GLY n
1 83 ASN n
1 84 TYR n
1 85 LYS n
1 86 PRO n
1 87 ASN n
1 88 VAL n
1 89 THR n
1 90 HIS n
1 91 TYR n
1 92 PHE n
1 93 LEU n
1 94 ARG n
1 95 LEU n
1 96 LEU n
1 97 HIS n
1 98 ASP n
1 99 LYS n
1 100 GLY n
1 101 LEU n
1 102 LEU n
1 103 LEU n
1 104 ARG n
1 105 LEU n
1 106 TYR n
1 107 THR n
1 108 GLN n
1 109 ASN n
1 110 ILE n
1 111 ASP n
1 112 GLY n
1 113 LEU n
1 114 GLU n
1 115 ARG n
1 116 VAL n
1 117 SER n
1 118 GLY n
1 119 ILE n
1 120 PRO n
1 121 ALA n
1 122 SER n
1 123 LYS n
1 124 LEU n
1 125 VAL n
1 126 GLU n
1 127 ALA n
1 128 HIS n
1 129 GLY n
1 130 THR n
1 131 PHE n
1 132 ALA n
1 133 SER n
1 134 ALA n
1 135 THR n
1 136 CYS n
1 137 THR n
1 138 VAL n
1 139 CYS n
1 140 GLN n
1 141 ARG n
1 142 PRO n
1 143 PHE n
1 144 PRO n
1 145 GLY n
1 146 GLU n
1 147 ASP n
1 148 ILE n
1 149 ARG n
1 150 ALA n
1 151 ASP n
1 152 VAL n
1 153 MET n
1 154 ALA n
1 155 ASP n
1 156 ARG n
1 157 VAL n
1 158 PRO n
1 159 ARG n
1 160 CYS n
1 161 PRO n
1 162 VAL n
1 163 CYS n
1 164 THR n
1 165 GLY n
1 166 VAL n
1 167 VAL n
1 168 LYS n
1 169 PRO n
1 170 ASP n
1 171 ILE n
1 172 VAL n
1 173 PHE n
1 174 PHE n
1 175 GLY n
1 176 GLU n
1 177 PRO n
1 178 LEU n
1 179 PRO n
1 180 GLN n
1 181 ARG n
1 182 PHE n
1 183 LEU n
1 184 LEU n
1 185 HIS n
1 186 VAL n
1 187 VAL n
1 188 ASP n
1 189 PHE n
1 190 PRO n
1 191 MET n
1 192 ALA n
1 193 ASP n
1 194 LEU n
1 195 LEU n
1 196 LEU n
1 197 ILE n
1 198 LEU n
1 199 GLY n
1 200 THR n
1 201 SER n
1 202 LEU n
1 203 GLU n
1 204 VAL n
1 205 GLU n
1 206 PRO n
1 207 PHE n
1 208 ALA n
1 209 SER n
1 210 LEU n
1 211 THR n
1 212 GLU n
1 213 ALA n
1 214 VAL n
1 215 ARG n
1 216 SER n
1 217 SER n
1 218 VAL n
1 219 PRO n
1 220 ARG n
1 221 LEU n
1 222 LEU n
1 223 ILE n
1 224 ASN n
1 225 ARG n
1 226 ASP n
1 227 LEU n
1 228 VAL n
1 229 GLY n
1 230 PRO n
1 231 LEU n
1 232 ALA n
1 233 TRP n
1 234 HIS n
1 235 PRO n
1 236 ARG n
1 237 SER n
1 238 ARG n
1 239 ASP n
1 240 VAL n
1 241 ALA n
1 242 GLN n
1 243 LEU n
1 244 GLY n
1 245 ASP n
1 246 VAL n
1 247 VAL n
1 248 HIS n
1 249 GLY n
1 250 VAL n
1 251 GLU n
1 252 SER n
1 253 LEU n
1 254 VAL n
1 255 GLU n
1 256 LEU n
1 257 LEU n
1 258 GLY n
1 259 TRP n
1 260 THR n
1 261 GLU n
1 262 GLU n
1 263 MET n
1 264 ARG n
1 265 ASP n
1 266 LEU n
1 267 VAL n
1 268 GLN n
1 269 ARG n
1 270 GLU n
1 271 THR n
2 1 ARG n
2 2 HIS n
2 3 LYS n
2 4 ALY n
#
loop_
_entity_src_gen.entity_id
_entity_src_gen.pdbx_src_id
_entity_src_gen.pdbx_alt_source_flag
_entity_src_gen.pdbx_seq_type
_entity_src_gen.pdbx_beg_seq_num
_entity_src_gen.pdbx_end_seq_num
_entity_src_gen.gene_src_common_name
_entity_src_gen.gene_src_genus
_entity_src_gen.pdbx_gene_src_gene
_entity_src_gen.gene_src_species
_entity_src_gen.gene_src_strain
_entity_src_gen.gene_src_tissue
_entity_src_gen.gene_src_tissue_fraction
_entity_src_gen.gene_src_details
_entity_src_gen.pdbx_gene_src_fragment
_entity_src_gen.pdbx_gene_src_scientific_name
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id
_entity_src_gen.pdbx_gene_src_variant
_entity_src_gen.pdbx_gene_src_cell_line
_entity_src_gen.pdbx_gene_src_atcc
_entity_src_gen.pdbx_gene_src_organ
_entity_src_gen.pdbx_gene_src_organelle
_entity_src_gen.pdbx_gene_src_cell
_entity_src_gen.pdbx_gene_src_cellular_location
_entity_src_gen.host_org_common_name
_entity_src_gen.pdbx_host_org_scientific_name
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id
_entity_src_gen.host_org_genus
_entity_src_gen.pdbx_host_org_gene
_entity_src_gen.pdbx_host_org_organ
_entity_src_gen.host_org_species
_entity_src_gen.pdbx_host_org_tissue
_entity_src_gen.pdbx_host_org_tissue_fraction
_entity_src_gen.pdbx_host_org_strain
_entity_src_gen.pdbx_host_org_variant
_entity_src_gen.pdbx_host_org_cell_line
_entity_src_gen.pdbx_host_org_atcc
_entity_src_gen.pdbx_host_org_culture_collection
_entity_src_gen.pdbx_host_org_cell
_entity_src_gen.pdbx_host_org_organelle
_entity_src_gen.pdbx_host_org_cellular_location
_entity_src_gen.pdbx_host_org_vector_type
_entity_src_gen.pdbx_host_org_vector
_entity_src_gen.host_org_details
_entity_src_gen.expression_system_id
_entity_src_gen.plasmid_name
_entity_src_gen.plasmid_details
_entity_src_gen.pdbx_description
1 1 sample 'Biological sequence' 1 271 human ? 'SIRT3, SIR2L3' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli'
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?
2 1 sample 'Biological sequence' 1 4 ? ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli'
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?
#
loop_
_struct_ref.id
_struct_ref.db_name
_struct_ref.db_code
_struct_ref.pdbx_db_accession
_struct_ref.pdbx_db_isoform
_struct_ref.entity_id
_struct_ref.pdbx_seq_one_letter_code
_struct_ref.pdbx_align_begin
1 UNP SIR3_HUMAN Q9NTG7 ? 1
;GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELY
PGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRC
PVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDV
AQLGDVVHGVESLVELLGWTEEMRDLVQRET
;
121
2 PDB 5H4D 5H4D ? 2 ? 1
#
loop_
_struct_ref_seq.align_id
_struct_ref_seq.ref_id
_struct_ref_seq.pdbx_PDB_id_code
_struct_ref_seq.pdbx_strand_id
_struct_ref_seq.seq_align_beg
_struct_ref_seq.pdbx_seq_align_beg_ins_code
_struct_ref_seq.seq_align_end
_struct_ref_seq.pdbx_seq_align_end_ins_code
_struct_ref_seq.pdbx_db_accession
_struct_ref_seq.db_align_beg
_struct_ref_seq.pdbx_db_align_beg_ins_code
_struct_ref_seq.db_align_end
_struct_ref_seq.pdbx_db_align_end_ins_code
_struct_ref_seq.pdbx_auth_seq_align_beg
_struct_ref_seq.pdbx_auth_seq_align_end
1 1 5H4D A 1 ? 271 ? Q9NTG7 121 ? 391 ? 121 391
2 2 5H4D D 1 ? 4 ? 5H4D 1 ? 4 ? 1 4
3 1 5H4D H 1 ? 271 ? Q9NTG7 121 ? 391 ? 121 391
4 2 5H4D C 1 ? 4 ? 5H4D 1 ? 4 ? 1 4
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'
89.093
ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3'
188.224
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'
175.209
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'
132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'
133.103
BBI non-polymer . '(2-butyl-1-benzofuran-3-yl){4-[2-(diethylamino)ethoxy]-3,5-diiodophenyl}methanone' ? 'C25 H29 I2 N O3'
645.312
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'
121.158
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'
146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'
147.129
GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2'
75.067
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'
156.162
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'
131.173
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'
131.173
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'
147.195
MCM non-polymer . 7-AMINO-4-METHYL-CHROMEN-2-ONE
7-AMINO-4-METHYLCOUMARIN 'C10 H9 N O2' 175.184
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'
149.211
MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305
NAD non-polymer . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ?
'C21 H27 N7 O14 P2' 663.425
PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3'
106.120
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'
165.189
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'
115.130
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'
105.093
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'
119.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'
204.225
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'
181.189
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'
117.146
ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 5H4D
_exptl.crystals_number 1
_exptl.details ?
_exptl.method 'X-RAY DIFFRACTION'
_exptl.method_details ?
#
_exptl_crystal.colour ?
_exptl_crystal.density_diffrn ?
_exptl_crystal.density_Matthews 2.51
_exptl_crystal.density_method ?
_exptl_crystal.density_percent_sol 51.05
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.id 1
_exptl_crystal.preparation ?
_exptl_crystal.size_max ?
_exptl_crystal.size_mid ?
_exptl_crystal.size_min ?
_exptl_crystal.size_rad ?
_exptl_crystal.colour_lustre ?
_exptl_crystal.colour_modifier ?
_exptl_crystal.colour_primary ?
_exptl_crystal.density_meas ?
_exptl_crystal.density_meas_esd ?
_exptl_crystal.density_meas_gt ?
_exptl_crystal.density_meas_lt ?
_exptl_crystal.density_meas_temp ?
_exptl_crystal.density_meas_temp_esd ?
_exptl_crystal.density_meas_temp_gt ?
_exptl_crystal.density_meas_temp_lt ?
_exptl_crystal.pdbx_crystal_image_url ?
_exptl_crystal.pdbx_crystal_image_format ?
_exptl_crystal.pdbx_mosaicity ?
_exptl_crystal.pdbx_mosaicity_esd ?
#
_exptl_crystal_grow.apparatus ?
_exptl_crystal_grow.atmosphere ?
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.details ?
_exptl_crystal_grow.method EVAPORATION
_exptl_crystal_grow.method_ref ?
_exptl_crystal_grow.pH ?
_exptl_crystal_grow.pressure ?
_exptl_crystal_grow.pressure_esd ?
_exptl_crystal_grow.seeding ?
_exptl_crystal_grow.seeding_ref ?
_exptl_crystal_grow.temp 293
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.temp_esd ?
_exptl_crystal_grow.time ?
_exptl_crystal_grow.pdbx_details '0.1M HEPES sodium pH 7.5, 10%(v/v) 2-Propanol, 20%(w/v) Polyethylene glycol 4,000'
_exptl_crystal_grow.pdbx_pH_range ?
#
_diffrn.ambient_environment ?
_diffrn.ambient_temp 197
_diffrn.ambient_temp_details ?
_diffrn.ambient_temp_esd ?
_diffrn.crystal_id 1
_diffrn.crystal_support ?
_diffrn.crystal_treatment ?
_diffrn.details ?
_diffrn.id 1
_diffrn.ambient_pressure ?
_diffrn.ambient_pressure_esd ?
_diffrn.ambient_pressure_gt ?
_diffrn.ambient_pressure_lt ?
_diffrn.ambient_temp_gt ?
_diffrn.ambient_temp_lt ?
#
_diffrn_detector.details ?
_diffrn_detector.detector PIXEL
_diffrn_detector.diffrn_id 1
_diffrn_detector.type 'DECTRIS PILATUS3 6M'
_diffrn_detector.area_resol_mean ?
_diffrn_detector.dtime ?
_diffrn_detector.pdbx_frames_total ?
_diffrn_detector.pdbx_collection_time_total ?
_diffrn_detector.pdbx_collection_date 2006-06-28
#
_diffrn_radiation.collimation ?
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.filter_edge ?
_diffrn_radiation.inhomogeneity ?
_diffrn_radiation.monochromator ?
_diffrn_radiation.polarisn_norm ?
_diffrn_radiation.polarisn_ratio ?
_diffrn_radiation.probe ?
_diffrn_radiation.type ?
_diffrn_radiation.xray_symbol ?
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_wavelength_list ?
_diffrn_radiation.pdbx_wavelength ?
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.pdbx_analyzer ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 0.98
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.current ?
_diffrn_source.details ?
_diffrn_source.diffrn_id 1
_diffrn_source.power ?
_diffrn_source.size ?
_diffrn_source.source SYNCHROTRON
_diffrn_source.target ?
_diffrn_source.type 'SSRF BEAMLINE BL19U1'
_diffrn_source.voltage ?
_diffrn_source.take-off_angle ?
_diffrn_source.pdbx_wavelength_list 0.98
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_synchrotron_beamline BL19U1
_diffrn_source.pdbx_synchrotron_site SSRF
#
_reflns.B_iso_Wilson_estimate ?
_reflns.entry_id 5H4D
_reflns.data_reduction_details ?
_reflns.data_reduction_method ?
_reflns.d_resolution_high 3.200
_reflns.d_resolution_low 77.32
_reflns.details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.number_all ?
_reflns.number_obs 5871
_reflns.observed_criterion ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.observed_criterion_I_max ?
_reflns.observed_criterion_I_min ?
_reflns.observed_criterion_sigma_F ?
_reflns.observed_criterion_sigma_I ?
_reflns.percent_possible_obs 59.500
_reflns.R_free_details ?
_reflns.Rmerge_F_all ?
_reflns.Rmerge_F_obs ?
_reflns.Friedel_coverage ?
_reflns.number_gt ?
_reflns.threshold_expression ?
_reflns.pdbx_redundancy 1.200
_reflns.pdbx_Rmerge_I_obs 0.174
_reflns.pdbx_Rmerge_I_all ?
_reflns.pdbx_Rsym_value ?
_reflns.pdbx_netI_over_av_sigmaI 2.750
_reflns.pdbx_netI_over_sigmaI 2.400
_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
_reflns.pdbx_res_netI_over_sigmaI_2 ?
_reflns.pdbx_chi_squared ?
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_d_res_high_opt ?
_reflns.pdbx_d_res_low_opt ?
_reflns.pdbx_d_res_opt_method ?
_reflns.phase_calculation_details ?
_reflns.pdbx_Rrim_I_all ?
_reflns.pdbx_Rpim_I_all ?
_reflns.pdbx_d_opt ?
_reflns.pdbx_number_measured_all ?
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
_reflns.pdbx_CC_half ?
_reflns.pdbx_R_split ?
#
loop_
_reflns_shell.d_res_high
_reflns_shell.d_res_low
_reflns_shell.meanI_over_sigI_all
_reflns_shell.meanI_over_sigI_obs
_reflns_shell.number_measured_all
_reflns_shell.number_measured_obs
_reflns_shell.number_possible
_reflns_shell.number_unique_all
_reflns_shell.number_unique_obs
_reflns_shell.percent_possible_all
_reflns_shell.percent_possible_obs
_reflns_shell.Rmerge_F_all
_reflns_shell.Rmerge_F_obs
_reflns_shell.Rmerge_I_all
_reflns_shell.Rmerge_I_obs
_reflns_shell.meanI_over_sigI_gt
_reflns_shell.meanI_over_uI_all
_reflns_shell.meanI_over_uI_gt
_reflns_shell.number_measured_gt
_reflns_shell.number_unique_gt
_reflns_shell.percent_possible_gt
_reflns_shell.Rmerge_F_gt
_reflns_shell.Rmerge_I_gt
_reflns_shell.pdbx_redundancy
_reflns_shell.pdbx_Rsym_value
_reflns_shell.pdbx_chi_squared
_reflns_shell.pdbx_netI_over_sigmaI_all
_reflns_shell.pdbx_netI_over_sigmaI_obs
_reflns_shell.pdbx_Rrim_I_all
_reflns_shell.pdbx_Rpim_I_all
_reflns_shell.pdbx_rejects
_reflns_shell.pdbx_ordinal
_reflns_shell.pdbx_diffrn_id
_reflns_shell.pdbx_CC_half
_reflns_shell.pdbx_R_split
3.200 3.260 ? ? ? ? ? ? ? 65.700 ? ? ? ? 0.743 ? ? ? ? ? ? ? ? 1.100 ? ? ? ? ? ? ? 1 1 0.323 ?
3.260 3.310 ? ? ? ? ? ? ? 65.300 ? ? ? ? 0.652 ? ? ? ? ? ? ? ? 1.200 ? ? ? ? ? ? ? 2 1 0.525 ?
3.310 3.380 ? ? ? ? ? ? ? 66.300 ? ? ? ? 0.384 ? ? ? ? ? ? ? ? 1.100 ? ? ? ? ? ? ? 3 1 0.640 ?
3.380 3.450 ? ? ? ? ? ? ? 62.600 ? ? ? ? 0.637 ? ? ? ? ? ? ? ? 1.200 ? ? ? ? ? ? ? 4 1 0.522 ?
3.450 3.520 ? ? ? ? ? ? ? 64.000 ? ? ? ? 0.429 ? ? ? ? ? ? ? ? 1.100 ? ? ? ? ? ? ? 5 1 0.516 ?
3.520 3.600 ? ? ? ? ? ? ? 62.000 ? ? ? ? 0.342 ? ? ? ? ? ? ? ? 1.200 ? ? ? ? ? ? ? 6 1 0.675 ?
3.600 3.690 ? ? ? ? ? ? ? 61.000 ? ? ? ? 0.345 ? ? ? ? ? ? ? ? 1.200 ? ? ? ? ? ? ? 7 1 0.550 ?
3.690 3.790 ? ? ? ? ? ? ? 57.300 ? ? ? ? 0.205 ? ? ? ? ? ? ? ? 1.200 ? ? ? ? ? ? ? 8 1 0.867 ?
3.790 3.910 ? ? ? ? ? ? ? 62.400 ? ? ? ? 0.251 ? ? ? ? ? ? ? ? 1.100 ? ? ? ? ? ? ? 9 1 0.862 ?
3.910 4.030 ? ? ? ? ? ? ? 55.100 ? ? ? ? 0.288 ? ? ? ? ? ? ? ? 1.100 ? ? ? ? ? ? ? 10 1 0.750 ?
4.030 4.180 ? ? ? ? ? ? ? 56.800 ? ? ? ? 0.220 ? ? ? ? ? ? ? ? 1.200 ? ? ? ? ? ? ? 11 1 0.887 ?
4.180 4.340 ? ? ? ? ? ? ? 58.600 ? ? ? ? 0.188 ? ? ? ? ? ? ? ? 1.200 ? ? ? ? ? ? ? 12 1 0.894 ?
4.340 4.540 ? ? ? ? ? ? ? 61.400 ? ? ? ? 0.148 ? ? ? ? ? ? ? ? 1.300 ? ? ? ? ? ? ? 13 1 0.915 ?
4.540 4.780 ? ? ? ? ? ? ? 60.100 ? ? ? ? 0.161 ? ? ? ? ? ? ? ? 1.300 ? ? ? ? ? ? ? 14 1 0.914 ?
4.780 5.080 ? ? ? ? ? ? ? 58.600 ? ? ? ? 0.138 ? ? ? ? ? ? ? ? 1.300 ? ? ? ? ? ? ? 15 1 0.954 ?
5.080 5.470 ? ? ? ? ? ? ? 59.400 ? ? ? ? 0.171 ? ? ? ? ? ? ? ? 1.300 ? ? ? ? ? ? ? 16 1 0.904 ?
5.470 6.020 ? ? ? ? ? ? ? 56.300 ? ? ? ? 0.157 ? ? ? ? ? ? ? ? 1.300 ? ? ? ? ? ? ? 17 1 0.881 ?
6.020 6.890 ? ? ? ? ? ? ? 53.400 ? ? ? ? 0.160 ? ? ? ? ? ? ? ? 1.300 ? ? ? ? ? ? ? 18 1 0.904 ?
6.890 8.670 ? ? ? ? ? ? ? 53.200 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? 1.300 ? ? ? ? ? ? ? 19 1 0.979 ?
8.670 50.000 ? ? ? ? ? ? ? 50.100 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 1.600 ? ? ? ? ? ? ? 20 1 0.959 ?
#
_refine.aniso_B[1][1] 0.8900
_refine.aniso_B[1][2] 0.4400
_refine.aniso_B[1][3] -0.0000
_refine.aniso_B[2][2] 0.8900
_refine.aniso_B[2][3] -0.0000
_refine.aniso_B[3][3] -2.8800
_refine.B_iso_max 212.550
_refine.B_iso_mean 35.9790
_refine.B_iso_min 2.000
_refine.correlation_coeff_Fo_to_Fc 0.9040
_refine.correlation_coeff_Fo_to_Fc_free 0.6130
_refine.details
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY'
_refine.diff_density_max ?
_refine.diff_density_max_esd ?
_refine.diff_density_min ?
_refine.diff_density_min_esd ?
_refine.diff_density_rms ?
_refine.diff_density_rms_esd ?
_refine.entry_id 5H4D
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_abs_structure_details ?
_refine.ls_abs_structure_Flack ?
_refine.ls_abs_structure_Flack_esd ?
_refine.ls_abs_structure_Rogers ?
_refine.ls_abs_structure_Rogers_esd ?
_refine.ls_d_res_high 3.2100
_refine.ls_d_res_low 77.3200
_refine.ls_extinction_coef ?
_refine.ls_extinction_coef_esd ?
_refine.ls_extinction_expression ?
_refine.ls_extinction_method ?
_refine.ls_goodness_of_fit_all ?
_refine.ls_goodness_of_fit_all_esd ?
_refine.ls_goodness_of_fit_obs ?
_refine.ls_goodness_of_fit_obs_esd ?
_refine.ls_hydrogen_treatment ?
_refine.ls_matrix_type ?
_refine.ls_number_constraints ?
_refine.ls_number_parameters ?
_refine.ls_number_reflns_all ?
_refine.ls_number_reflns_obs 5583
_refine.ls_number_reflns_R_free 285
_refine.ls_number_reflns_R_work ?
_refine.ls_number_restraints ?
_refine.ls_percent_reflns_obs 59.2100
_refine.ls_percent_reflns_R_free 4.9000
_refine.ls_R_factor_all ?
_refine.ls_R_factor_obs 0.2202
_refine.ls_R_factor_R_free 0.3716
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_R_factor_R_work 0.2129
_refine.ls_R_Fsqd_factor_obs ?
_refine.ls_R_I_factor_obs ?
_refine.ls_redundancy_reflns_all ?
_refine.ls_redundancy_reflns_obs ?
_refine.ls_restrained_S_all ?
_refine.ls_restrained_S_obs ?
_refine.ls_shift_over_esd_max ?
_refine.ls_shift_over_esd_mean ?
_refine.ls_structure_factor_coef ?
_refine.ls_weighting_details ?
_refine.ls_weighting_scheme ?
_refine.ls_wR_factor_all ?
_refine.ls_wR_factor_obs ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.solvent_model_details ?
_refine.solvent_model_param_bsol ?
_refine.solvent_model_param_ksol ?
_refine.ls_R_factor_gt ?
_refine.ls_goodness_of_fit_gt ?
_refine.ls_goodness_of_fit_ref ?
_refine.ls_shift_over_su_max ?
_refine.ls_shift_over_su_max_lt ?
_refine.ls_shift_over_su_mean ?
_refine.ls_shift_over_su_mean_lt ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F 0.000
_refine.pdbx_ls_sigma_Fsqd ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.pdbx_isotropic_thermal_model ?
_refine.pdbx_ls_cross_valid_method THROUGHOUT
_refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT'
_refine.pdbx_starting_model ?
_refine.pdbx_stereochemistry_target_values ?
_refine.pdbx_R_Free_selection_details RANDOM
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_overall_ESU_R ?
_refine.pdbx_overall_ESU_R_Free 1.2990
_refine.pdbx_solvent_vdw_probe_radii 1.2000
_refine.pdbx_solvent_ion_probe_radii 0.8000
_refine.pdbx_solvent_shrinkage_radii 0.8000
_refine.pdbx_real_space_R ?
_refine.pdbx_density_correlation ?
_refine.pdbx_pd_number_of_powder_patterns ?
_refine.pdbx_pd_number_of_points ?
_refine.pdbx_pd_meas_number_of_points ?
_refine.pdbx_pd_proc_ls_prof_R_factor ?
_refine.pdbx_pd_proc_ls_prof_wR_factor ?
_refine.pdbx_pd_Marquardt_correlation_coeff ?
_refine.pdbx_pd_Fsqrd_R_factor ?
_refine.pdbx_pd_ls_matrix_band_width ?
_refine.pdbx_overall_phase_error ?
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ?
_refine.pdbx_overall_SU_R_free_Blow_DPI ?
_refine.pdbx_overall_SU_R_Blow_DPI ?
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_diffrn_id 1
_refine.overall_SU_B 47.8080
_refine.overall_SU_ML 0.8130
_refine.overall_SU_R_Cruickshank_DPI ?
_refine.overall_SU_R_free ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_average_fsc_overall ?
_refine.pdbx_average_fsc_work ?
_refine.pdbx_average_fsc_free ?
#
_refine_hist.cycle_id final
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.d_res_high 3.2100
_refine_hist.d_res_low 77.3200
_refine_hist.pdbx_number_atoms_ligand 161
_refine_hist.number_atoms_solvent 0
_refine_hist.number_atoms_total 4526
_refine_hist.pdbx_number_residues_total 551
_refine_hist.pdbx_B_iso_mean_ligand 97.23
_refine_hist.pdbx_number_atoms_protein 4365
_refine_hist.pdbx_number_atoms_nucleic_acid 0
#
loop_
_refine_ls_restr.pdbx_refine_id
_refine_ls_restr.criterion
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.number
_refine_ls_restr.rejects
_refine_ls_restr.type
_refine_ls_restr.weight
_refine_ls_restr.pdbx_restraint_function
'X-RAY DIFFRACTION' ? 0.007 0.019 4645 ? r_bond_refined_d ? ?
'X-RAY DIFFRACTION' ? 0.003 0.020 4452 ? r_bond_other_d ? ?
'X-RAY DIFFRACTION' ? 1.309 2.032 6329 ? r_angle_refined_deg ? ?
'X-RAY DIFFRACTION' ? 0.905 3.008 10234 ? r_angle_other_deg ? ?
'X-RAY DIFFRACTION' ? 6.855 5.000 544 ? r_dihedral_angle_1_deg ? ?
'X-RAY DIFFRACTION' ? 35.576 22.667 195 ? r_dihedral_angle_2_deg ? ?
'X-RAY DIFFRACTION' ? 16.744 15.000 715 ? r_dihedral_angle_3_deg ? ?
'X-RAY DIFFRACTION' ? 14.629 15.000 40 ? r_dihedral_angle_4_deg ? ?
'X-RAY DIFFRACTION' ? 0.060 0.200 698 ? r_chiral_restr ? ?
'X-RAY DIFFRACTION' ? 0.005 0.021 5089 ? r_gen_planes_refined ? ?
'X-RAY DIFFRACTION' ? 0.001 0.020 1059 ? r_gen_planes_other ? ?
'X-RAY DIFFRACTION' ? 1.461 3.464 2196 ? r_mcbond_it ? ?
'X-RAY DIFFRACTION' ? 1.460 3.464 2196 ? r_mcbond_other ? ?
'X-RAY DIFFRACTION' ? 2.607 5.195 2732 ? r_mcangle_it ? ?
#
_refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_ls_shell.d_res_high 3.2060
_refine_ls_shell.d_res_low 3.2900
_refine_ls_shell.number_reflns_all 451
_refine_ls_shell.number_reflns_obs ?
_refine_ls_shell.number_reflns_R_free 22
_refine_ls_shell.number_reflns_R_work 429
_refine_ls_shell.percent_reflns_obs 61.4400
_refine_ls_shell.percent_reflns_R_free ?
_refine_ls_shell.R_factor_all ?
_refine_ls_shell.R_factor_obs ?
_refine_ls_shell.R_factor_R_free 0.4940
_refine_ls_shell.R_factor_R_free_error ?
_refine_ls_shell.R_factor_R_work 0.2860
_refine_ls_shell.redundancy_reflns_all ?
_refine_ls_shell.redundancy_reflns_obs ?
_refine_ls_shell.wR_factor_all ?
_refine_ls_shell.wR_factor_obs ?
_refine_ls_shell.wR_factor_R_free ?
_refine_ls_shell.wR_factor_R_work ?
_refine_ls_shell.pdbx_total_number_of_bins_used 20
_refine_ls_shell.pdbx_phase_error ?
_refine_ls_shell.pdbx_fsc_work ?
_refine_ls_shell.pdbx_fsc_free ?
#
_struct.entry_id 5H4D
_struct.title 'Crystal structure of hSIRT3 in complex with a specific agonist Amiodarone hydrochloride'
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 5H4D
_struct_keywords.text 'SIRT3 Amiodarone agonist, HYDROLASE'
_struct_keywords.pdbx_keywords HYDROLASE
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 1 ?
D N N 2 ?
E N N 3 ?
F N N 4 ?
G N N 5 ?
H N N 6 ?
I N N 7 ?
J N N 8 ?
K N N 3 ?
L N N 8 ?
M N N 4 ?
N N N 5 ?
O N N 6 ?
P N N 7 ?
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 LEU A 5 ? ALA A 14 ? LEU A 125 ALA A 134 1 ? 10
HELX_P HELX_P2 AA2 ALA A 26 ? GLY A 33 ? ALA A 146 GLY A 153 5 ? 8
HELX_P HELX_P3 AA3 LEU A 44 ? GLN A 50 ? LEU A 164 GLN A 170 1 ? 7
HELX_P HELX_P4 AA4 TYR A 55 ? PHE A 60 ? TYR A 175 PHE A 180 5 ? 6
HELX_P HELX_P5 AA5 GLU A 61 ? ASN A 68 ? GLU A 181 ASN A 188 1 ? 8
HELX_P HELX_P6 AA6 PRO A 69 ? TYR A 80 ? PRO A 189 TYR A 200 1 ? 12
HELX_P HELX_P7 AA7 ASN A 87 ? LYS A 99 ? ASN A 207 LYS A 219 1 ? 13
HELX_P HELX_P8 AA8 GLY A 112 ? SER A 117 ? GLY A 232 SER A 237 1 ? 6
HELX_P HELX_P9 AA9 GLU A 146 ? MET A 153 ? GLU A 266 MET A 273 1 ? 8
HELX_P HELX_P10 AB1 PRO A 179 ? LEU A 183 ? PRO A 299 LEU A 303 5 ? 5
HELX_P HELX_P11 AB2 LEU A 184 ? PHE A 189 ? LEU A 304 PHE A 309 1 ? 6
HELX_P HELX_P12 AB3 ALA A 208 ? GLU A 212 ? ALA A 328 GLU A 332 5 ? 5
HELX_P HELX_P13 AB4 VAL A 228 ? ALA A 232 ? VAL A 348 ALA A 352 5 ? 5
HELX_P HELX_P14 AB5 ASP A 245 ? GLY A 258 ? ASP A 365 GLY A 378 1 ? 14
HELX_P HELX_P15 AB6 TRP A 259 ? THR A 271 ? TRP A 379 THR A 391 1 ? 13
HELX_P HELX_P16 AB7 LEU C 5 ? ALA C 14 ? LEU H 125 ALA H 134 1 ? 10
HELX_P HELX_P17 AB8 SER C 42 ? TYR C 51 ? SER H 162 TYR H 171 1 ? 10
HELX_P HELX_P18 AB9 TYR C 55 ? PHE C 60 ? TYR H 175 PHE H 180 5 ? 6
HELX_P HELX_P19 AC1 GLU C 61 ? PHE C 66 ? GLU H 181 PHE H 186 1 ? 6
HELX_P HELX_P20 AC2 PRO C 69 ? TYR C 80 ? PRO H 189 TYR H 200 1 ? 12
HELX_P HELX_P21 AC3 ASN C 87 ? LYS C 99 ? ASN H 207 LYS H 219 1 ? 13
HELX_P HELX_P22 AC4 GLY C 112 ? SER C 117 ? GLY H 232 SER H 237 1 ? 6
HELX_P HELX_P23 AC5 PRO C 120 ? SER C 122 ? PRO H 240 SER H 242 5 ? 3
HELX_P HELX_P24 AC6 ILE C 148 ? ALA C 154 ? ILE H 268 ALA H 274 1 ? 7
HELX_P HELX_P25 AC7 PRO C 179 ? LEU C 183 ? PRO H 299 LEU H 303 5 ? 5
HELX_P HELX_P26 AC8 LEU C 184 ? PHE C 189 ? LEU H 304 PHE H 309 1 ? 6
HELX_P HELX_P27 AC9 SER C 209 ? VAL C 214 ? SER H 329 VAL H 334 1 ? 6
HELX_P HELX_P28 AD1 GLY C 229 ? HIS C 234 ? GLY H 349 HIS H 354 1 ? 6
HELX_P HELX_P29 AD2 VAL C 246 ? GLY C 258 ? VAL H 366 GLY H 378 1 ? 13
HELX_P HELX_P30 AD3 TRP C 259 ? GLU C 270 ? TRP H 379 GLU H 390 1 ? 12
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_conn.id
_struct_conn.conn_type_id
_struct_conn.pdbx_leaving_atom_flag
_struct_conn.pdbx_PDB_id
_struct_conn.ptnr1_label_asym_id
_struct_conn.ptnr1_label_comp_id
_struct_conn.ptnr1_label_seq_id
_struct_conn.ptnr1_label_atom_id
_struct_conn.pdbx_ptnr1_label_alt_id
_struct_conn.pdbx_ptnr1_PDB_ins_code
_struct_conn.pdbx_ptnr1_standard_comp_id
_struct_conn.ptnr1_symmetry
_struct_conn.ptnr2_label_asym_id
_struct_conn.ptnr2_label_comp_id
_struct_conn.ptnr2_label_seq_id
_struct_conn.ptnr2_label_atom_id
_struct_conn.pdbx_ptnr2_label_alt_id
_struct_conn.pdbx_ptnr2_PDB_ins_code
_struct_conn.ptnr1_auth_asym_id
_struct_conn.ptnr1_auth_comp_id
_struct_conn.ptnr1_auth_seq_id
_struct_conn.ptnr2_auth_asym_id
_struct_conn.ptnr2_auth_comp_id
_struct_conn.ptnr2_auth_seq_id
_struct_conn.ptnr2_symmetry
_struct_conn.pdbx_ptnr3_label_atom_id
_struct_conn.pdbx_ptnr3_label_seq_id
_struct_conn.pdbx_ptnr3_label_comp_id
_struct_conn.pdbx_ptnr3_label_asym_id
_struct_conn.pdbx_ptnr3_label_alt_id
_struct_conn.pdbx_ptnr3_PDB_ins_code
_struct_conn.details
_struct_conn.pdbx_dist_value
_struct_conn.pdbx_value_order
_struct_conn.pdbx_role
covale1 covale both ? B LYS 3 C ? ? ? 1_555 B ALY 4 N ? ? D LYS 3 D ALY 4 1_555 ? ? ? ? ? ? ? 1.267 ? ?
covale2 covale one ? B ALY 4 C ? ? ? 1_555 I MCM . N ? ? D ALY 4 D MCM 101 1_555 ? ? ? ? ? ? ? 1.339 ? ?
covale3 covale both ? D LYS 3 C ? ? ? 1_555 D ALY 4 N ? ? C LYS 3 C ALY 4 1_555 ? ? ? ? ? ? ? 1.264 ? ?
covale4 covale one ? D ALY 4 C ? ? ? 1_555 P MCM . N ? ? C ALY 4 C MCM 101 1_555 ? ? ? ? ? ? ? 1.351 ? ?
metalc1 metalc ? ? A CYS 136 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 256 A ZN 401 1_555 ? ? ? ? ? ? ? 2.265 ? ?
metalc2 metalc ? ? A CYS 160 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 280 A ZN 401 1_555 ? ? ? ? ? ? ? 2.323 ? ?
metalc3 metalc ? ? A CYS 163 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 283 A ZN 401 1_555 ? ? ? ? ? ? ? 2.060 ? ?
metalc4 metalc ? ? C CYS 136 SG ? ? ? 1_555 K ZN . ZN ? ? H CYS 256 H ZN 402 1_555 ? ? ? ? ? ? ? 2.195 ? ?
metalc5 metalc ? ? C CYS 139 SG ? ? ? 1_555 K ZN . ZN ? ? H CYS 259 H ZN 402 1_555 ? ? ? ? ? ? ? 2.131 ? ?
metalc6 metalc ? ? C CYS 160 SG ? ? ? 1_555 K ZN . ZN ? ? H CYS 280 H ZN 402 1_555 ? ? ? ? ? ? ? 2.715 ? ?
metalc7 metalc ? ? C CYS 163 SG ? ? ? 1_555 K ZN . ZN ? ? H CYS 283 H ZN 402 1_555 ? ? ? ? ? ? ? 2.978 ? ?
#
loop_
_struct_conn_type.id
_struct_conn_type.criteria
_struct_conn_type.reference
covale ? ?
metalc ? ?
#
loop_
_struct_mon_prot_cis.pdbx_id
_struct_mon_prot_cis.label_comp_id
_struct_mon_prot_cis.label_seq_id
_struct_mon_prot_cis.label_asym_id
_struct_mon_prot_cis.label_alt_id
_struct_mon_prot_cis.pdbx_PDB_ins_code
_struct_mon_prot_cis.auth_comp_id
_struct_mon_prot_cis.auth_seq_id
_struct_mon_prot_cis.auth_asym_id
_struct_mon_prot_cis.pdbx_label_comp_id_2
_struct_mon_prot_cis.pdbx_label_seq_id_2
_struct_mon_prot_cis.pdbx_label_asym_id_2
_struct_mon_prot_cis.pdbx_PDB_ins_code_2
_struct_mon_prot_cis.pdbx_auth_comp_id_2
_struct_mon_prot_cis.pdbx_auth_seq_id_2
_struct_mon_prot_cis.pdbx_auth_asym_id_2
_struct_mon_prot_cis.pdbx_PDB_model_num
_struct_mon_prot_cis.pdbx_omega_angle
1 GLU 205 A . ? GLU 325 A PRO 206 A ? PRO 326 A 1 6.71
2 GLU 205 C . ? GLU 325 H PRO 206 C ? PRO 326 H 1 -0.65
#
loop_
_struct_sheet.id
_struct_sheet.type
_struct_sheet.number_strands
_struct_sheet.details
AA1 ? 6 ?
AA2 ? 3 ?
AA3 ? 2 ?
AA4 ? 6 ?
AA5 ? 3 ?
#
loop_
_struct_sheet_order.sheet_id
_struct_sheet_order.range_id_1
_struct_sheet_order.range_id_2
_struct_sheet_order.offset
_struct_sheet_order.sense
AA1 1 2 ? parallel
AA1 2 3 ? parallel
AA1 3 4 ? parallel
AA1 4 5 ? parallel
AA1 5 6 ? parallel
AA2 1 2 ? anti-parallel
AA2 2 3 ? anti-parallel
AA3 1 2 ? anti-parallel
AA4 1 2 ? parallel
AA4 2 3 ? parallel
AA4 3 4 ? parallel
AA4 4 5 ? parallel
AA4 5 6 ? parallel
AA5 1 2 ? anti-parallel
AA5 2 3 ? anti-parallel
#
loop_
_struct_sheet_range.sheet_id
_struct_sheet_range.id
_struct_sheet_range.beg_label_comp_id
_struct_sheet_range.beg_label_asym_id
_struct_sheet_range.beg_label_seq_id
_struct_sheet_range.pdbx_beg_PDB_ins_code
_struct_sheet_range.end_label_comp_id
_struct_sheet_range.end_label_asym_id
_struct_sheet_range.end_label_seq_id
_struct_sheet_range.pdbx_end_PDB_ins_code
_struct_sheet_range.beg_auth_comp_id
_struct_sheet_range.beg_auth_asym_id
_struct_sheet_range.beg_auth_seq_id
_struct_sheet_range.end_auth_comp_id
_struct_sheet_range.end_auth_asym_id
_struct_sheet_range.end_auth_seq_id
AA1 1 LEU A 124 ? GLU A 126 ? LEU A 244 GLU A 246
AA1 2 LEU A 102 ? THR A 107 ? LEU A 222 THR A 227
AA1 3 VAL A 20 ? VAL A 24 ? VAL A 140 VAL A 144
AA1 4 LEU A 195 ? LEU A 198 ? LEU A 315 LEU A 318
AA1 5 ARG A 220 ? ASN A 224 ? ARG A 340 ASN A 344
AA1 6 ASP A 239 ? LEU A 243 ? ASP A 359 LEU A 363
AA2 1 PRO A 142 ? PRO A 144 ? PRO A 262 PRO A 264
AA2 2 GLY A 129 ? CYS A 136 ? GLY A 249 CYS A 256
AA2 3 VAL A 167 ? ILE A 171 ? VAL A 287 ILE A 291
AA3 1 LYS B 3 ? ALY B 4 ? LYS D 3 ALY D 4
AA3 2 GLU C 176 ? PRO C 177 ? GLU H 296 PRO H 297
AA4 1 LEU C 124 ? GLU C 126 ? LEU H 244 GLU H 246
AA4 2 LEU C 102 ? THR C 107 ? LEU H 222 THR H 227
AA4 3 VAL C 20 ? VAL C 24 ? VAL H 140 VAL H 144
AA4 4 LEU C 194 ? LEU C 198 ? LEU H 314 LEU H 318
AA4 5 ARG C 220 ? ASN C 224 ? ARG H 340 ASN H 344
AA4 6 VAL C 240 ? LEU C 243 ? VAL H 360 LEU H 363
AA5 1 PRO C 142 ? PRO C 144 ? PRO H 262 PRO H 264
AA5 2 GLY C 129 ? CYS C 136 ? GLY H 249 CYS H 256
AA5 3 VAL C 167 ? ILE C 171 ? VAL H 287 ILE H 291
#
loop_
_pdbx_struct_sheet_hbond.sheet_id
_pdbx_struct_sheet_hbond.range_id_1
_pdbx_struct_sheet_hbond.range_id_2
_pdbx_struct_sheet_hbond.range_1_label_atom_id
_pdbx_struct_sheet_hbond.range_1_label_comp_id
_pdbx_struct_sheet_hbond.range_1_label_asym_id
_pdbx_struct_sheet_hbond.range_1_label_seq_id
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code
_pdbx_struct_sheet_hbond.range_1_auth_atom_id
_pdbx_struct_sheet_hbond.range_1_auth_comp_id
_pdbx_struct_sheet_hbond.range_1_auth_asym_id
_pdbx_struct_sheet_hbond.range_1_auth_seq_id
_pdbx_struct_sheet_hbond.range_2_label_atom_id
_pdbx_struct_sheet_hbond.range_2_label_comp_id
_pdbx_struct_sheet_hbond.range_2_label_asym_id
_pdbx_struct_sheet_hbond.range_2_label_seq_id
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code
_pdbx_struct_sheet_hbond.range_2_auth_atom_id
_pdbx_struct_sheet_hbond.range_2_auth_comp_id
_pdbx_struct_sheet_hbond.range_2_auth_asym_id
_pdbx_struct_sheet_hbond.range_2_auth_seq_id
AA1 1 2 O VAL A 125 ? O VAL A 245 N LEU A 105 ? N LEU A 225
AA1 2 3 O ARG A 104 ? O ARG A 224 N VAL A 22 ? N VAL A 142
AA1 3 4 N MET A 23 ? N MET A 143 O LEU A 196 ? O LEU A 316
AA1 4 5 N LEU A 195 ? N LEU A 315 O LEU A 221 ? O LEU A 341
AA1 5 6 N ARG A 220 ? N ARG A 340 O VAL A 240 ? O VAL A 360
AA2 1 2 O PHE A 143 ? O PHE A 263 N ALA A 134 ? N ALA A 254
AA2 2 3 N SER A 133 ? N SER A 253 O ASP A 170 ? O ASP A 290
AA3 1 2 N ALY B 4 ? N ALY D 4 O GLU C 176 ? O GLU H 296
AA4 1 2 O VAL C 125 ? O VAL H 245 N THR C 107 ? N THR H 227
AA4 2 3 O LEU C 103 ? O LEU H 223 N VAL C 20 ? N VAL H 140
AA4 3 4 N MET C 23 ? N MET H 143 O LEU C 196 ? O LEU H 316
AA4 4 5 N ILE C 197 ? N ILE H 317 O LEU C 221 ? O LEU H 341
AA4 5 6 N LEU C 222 ? N LEU H 342 O GLN C 242 ? O GLN H 362
AA5 1 2 O PHE C 143 ? O PHE H 263 N ALA C 134 ? N ALA H 254
AA5 2 3 N SER C 133 ? N SER H 253 O ASP C 170 ? O ASP H 290
#
loop_
_struct_site.id
_struct_site.pdbx_evidence_code
_struct_site.pdbx_auth_asym_id
_struct_site.pdbx_auth_comp_id
_struct_site.pdbx_auth_seq_id
_struct_site.pdbx_auth_ins_code
_struct_site.pdbx_num_residues
_struct_site.details
AC1 Software A ZN 401 ? 4 'binding site for residue ZN A 401'
AC2 Software A BBI 403 ? 9 'binding site for residue BBI A 403'
AC3 Software A NAD 404 ? 17 'binding site for residue NAD A 404'
AC5 Software H PEG 401 ? 7 'binding site for residue PEG H 401'
AC6 Software H ZN 402 ? 4 'binding site for residue ZN H 402'
AC7 Software H BBI 405 ? 8 'binding site for residue BBI H 405'
AC8 Software H NAD 406 ? 18 'binding site for residue NAD H 406'
#
loop_
_struct_site_gen.id
_struct_site_gen.site_id
_struct_site_gen.pdbx_num_res
_struct_site_gen.label_comp_id
_struct_site_gen.label_asym_id
_struct_site_gen.label_seq_id
_struct_site_gen.pdbx_auth_ins_code
_struct_site_gen.auth_comp_id
_struct_site_gen.auth_asym_id
_struct_site_gen.auth_seq_id
_struct_site_gen.label_atom_id
_struct_site_gen.label_alt_id
_struct_site_gen.symmetry
_struct_site_gen.details
1 AC1 4 CYS A 136 ? CYS A 256 . ? 1_555 ?
2 AC1 4 CYS A 139 ? CYS A 259 . ? 1_555 ?
3 AC1 4 CYS A 160 ? CYS A 280 . ? 1_555 ?
4 AC1 4 CYS A 163 ? CYS A 283 . ? 1_555 ?
5 AC2 9 PHE A 37 ? PHE A 157 . ? 1_555 ?
6 AC2 9 ARG A 38 ? ARG A 158 . ? 1_555 ?
7 AC2 9 GLU A 57 ? GLU A 177 . ? 1_555 ?
8 AC2 9 PHE A 174 ? PHE A 294 . ? 1_555 ?
9 AC2 9 VAL A 204 ? VAL A 324 . ? 1_555 ?
10 AC2 9 ARG B 1 ? ARG D 1 . ? 9_554 ?
11 AC2 9 HIS B 2 ? HIS D 2 . ? 9_554 ?
12 AC2 9 PRO C 206 ? PRO H 326 . ? 9_554 ?
13 AC2 9 SER C 209 ? SER H 329 . ? 9_554 ?
14 AC3 17 GLY A 25 ? GLY A 145 . ? 1_555 ?
15 AC3 17 ALA A 26 ? ALA A 146 . ? 1_555 ?
16 AC3 17 GLY A 27 ? GLY A 147 . ? 1_555 ?
17 AC3 17 SER A 29 ? SER A 149 . ? 1_555 ?
18 AC3 17 THR A 30 ? THR A 150 . ? 1_555 ?
19 AC3 17 PHE A 37 ? PHE A 157 . ? 1_555 ?
20 AC3 17 ARG A 38 ? ARG A 158 . ? 1_555 ?
21 AC3 17 GLN A 108 ? GLN A 228 . ? 1_555 ?
22 AC3 17 ASN A 109 ? ASN A 229 . ? 1_555 ?
23 AC3 17 ILE A 110 ? ILE A 230 . ? 1_555 ?
24 AC3 17 ASP A 111 ? ASP A 231 . ? 1_555 ?
25 AC3 17 HIS A 128 ? HIS A 248 . ? 1_555 ?
26 AC3 17 GLY A 199 ? GLY A 319 . ? 1_555 ?
27 AC3 17 THR A 200 ? THR A 320 . ? 1_555 ?
28 AC3 17 SER A 201 ? SER A 321 . ? 1_555 ?
29 AC3 17 ASP A 245 ? ASP A 365 . ? 1_555 ?
30 AC3 17 VAL A 246 ? VAL A 366 . ? 1_555 ?
31 AC5 7 ARG C 104 ? ARG H 224 . ? 1_555 ?
32 AC5 7 ALA C 121 ? ALA H 241 . ? 1_555 ?
33 AC5 7 SER C 122 ? SER H 242 . ? 1_555 ?
34 AC5 7 LYS C 123 ? LYS H 243 . ? 1_555 ?
35 AC5 7 LEU C 124 ? LEU H 244 . ? 1_555 ?
36 AC5 7 VAL C 125 ? VAL H 245 . ? 1_555 ?
37 AC5 7 ARG C 181 ? ARG H 301 . ? 1_555 ?
38 AC6 4 CYS C 136 ? CYS H 256 . ? 1_555 ?
39 AC6 4 CYS C 139 ? CYS H 259 . ? 1_555 ?
40 AC6 4 CYS C 160 ? CYS H 280 . ? 1_555 ?
41 AC6 4 CYS C 163 ? CYS H 283 . ? 1_555 ?
42 AC7 8 PRO A 206 ? PRO A 326 . ? 5_555 ?
43 AC7 8 SER A 209 ? SER A 329 . ? 5_555 ?
44 AC7 8 ARG D 1 ? ARG C 1 . ? 5_555 ?
45 AC7 8 ARG C 38 ? ARG H 158 . ? 1_555 ?
46 AC7 8 GLU C 57 ? GLU H 177 . ? 1_555 ?
47 AC7 8 PHE C 174 ? PHE H 294 . ? 1_555 ?
48 AC7 8 VAL C 204 ? VAL H 324 . ? 1_555 ?
49 AC7 8 NAD O . ? NAD H 406 . ? 1_555 ?
50 AC8 18 GLY C 25 ? GLY H 145 . ? 1_555 ?
51 AC8 18 ALA C 26 ? ALA H 146 . ? 1_555 ?
52 AC8 18 GLY C 27 ? GLY H 147 . ? 1_555 ?
53 AC8 18 SER C 29 ? SER H 149 . ? 1_555 ?
54 AC8 18 THR C 30 ? THR H 150 . ? 1_555 ?
55 AC8 18 PRO C 31 ? PRO H 151 . ? 1_555 ?
56 AC8 18 ARG C 38 ? ARG H 158 . ? 1_555 ?
57 AC8 18 GLN C 108 ? GLN H 228 . ? 1_555 ?
58 AC8 18 ASN C 109 ? ASN H 229 . ? 1_555 ?
59 AC8 18 ILE C 110 ? ILE H 230 . ? 1_555 ?
60 AC8 18 ASP C 111 ? ASP H 231 . ? 1_555 ?
61 AC8 18 HIS C 128 ? HIS H 248 . ? 1_555 ?
62 AC8 18 THR C 200 ? THR H 320 . ? 1_555 ?
63 AC8 18 SER C 201 ? SER H 321 . ? 1_555 ?
64 AC8 18 ASN C 224 ? ASN H 344 . ? 1_555 ?
65 AC8 18 ASP C 245 ? ASP H 365 . ? 1_555 ?
66 AC8 18 VAL C 246 ? VAL H 366 . ? 1_555 ?
67 AC8 18 BBI N . ? BBI H 405 . ? 1_555 ?
#
_atom_sites.entry_id 5H4D
_atom_sites.fract_transf_matrix[1][1] 0.008729
_atom_sites.fract_transf_matrix[1][2] 0.005040
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] -0.000000
_atom_sites.fract_transf_matrix[2][2] 0.010079
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] -0.000000
_atom_sites.fract_transf_matrix[3][3] 0.008103
_atom_sites.fract_transf_vector[1] 0.000000
_atom_sites.fract_transf_vector[2] 0.000000
_atom_sites.fract_transf_vector[3] 0.000000
#
loop_
_atom_type.symbol
C
I
MG
N
O
P
S
ZN
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 GLY 1 121 121 GLY GLY A . n
A 1 2 LYS 2 122 122 LYS LYS A . n
A 1 3 LEU 3 123 123 LEU LEU A . n
A 1 4 SER 4 124 124 SER SER A . n
A 1 5 LEU 5 125 125 LEU LEU A . n
A 1 6 GLN 6 126 126 GLN GLN A . n
A 1 7 ASP 7 127 127 ASP ASP A . n
A 1 8 VAL 8 128 128 VAL VAL A . n
A 1 9 ALA 9 129 129 ALA ALA A . n
A 1 10 GLU 10 130 130 GLU GLU A . n
A 1 11 LEU 11 131 131 LEU LEU A . n
A 1 12 ILE 12 132 132 ILE ILE A . n
A 1 13 ARG 13 133 133 ARG ARG A . n
A 1 14 ALA 14 134 134 ALA ALA A . n
A 1 15 ARG 15 135 135 ARG ARG A . n
A 1 16 ALA 16 136 136 ALA ALA A . n
A 1 17 CYS 17 137 137 CYS CYS A . n
A 1 18 GLN 18 138 138 GLN GLN A . n
A 1 19 ARG 19 139 139 ARG ARG A . n
A 1 20 VAL 20 140 140 VAL VAL A . n
A 1 21 VAL 21 141 141 VAL VAL A . n
A 1 22 VAL 22 142 142 VAL VAL A . n
A 1 23 MET 23 143 143 MET MET A . n
A 1 24 VAL 24 144 144 VAL VAL A . n
A 1 25 GLY 25 145 145 GLY GLY A . n
A 1 26 ALA 26 146 146 ALA ALA A . n
A 1 27 GLY 27 147 147 GLY GLY A . n
A 1 28 ILE 28 148 148 ILE ILE A . n
A 1 29 SER 29 149 149 SER SER A . n
A 1 30 THR 30 150 150 THR THR A . n
A 1 31 PRO 31 151 151 PRO PRO A . n
A 1 32 SER 32 152 152 SER SER A . n
A 1 33 GLY 33 153 153 GLY GLY A . n
A 1 34 ILE 34 154 154 ILE ILE A . n
A 1 35 PRO 35 155 155 PRO PRO A . n
A 1 36 ASP 36 156 156 ASP ASP A . n
A 1 37 PHE 37 157 157 PHE PHE A . n
A 1 38 ARG 38 158 158 ARG ARG A . n
A 1 39 SER 39 159 159 SER SER A . n
A 1 40 PRO 40 160 160 PRO PRO A . n
A 1 41 GLY 41 161 161 GLY GLY A . n
A 1 42 SER 42 162 162 SER SER A . n
A 1 43 GLY 43 163 163 GLY GLY A . n
A 1 44 LEU 44 164 164 LEU LEU A . n
A 1 45 TYR 45 165 165 TYR TYR A . n
A 1 46 SER 46 166 166 SER SER A . n
A 1 47 ASN 47 167 167 ASN ASN A . n
A 1 48 LEU 48 168 168 LEU LEU A . n
A 1 49 GLN 49 169 169 GLN GLN A . n
A 1 50 GLN 50 170 170 GLN GLN A . n
A 1 51 TYR 51 171 171 TYR TYR A . n
A 1 52 ASP 52 172 172 ASP ASP A . n
A 1 53 LEU 53 173 173 LEU LEU A . n
A 1 54 PRO 54 174 174 PRO PRO A . n
A 1 55 TYR 55 175 175 TYR TYR A . n
A 1 56 PRO 56 176 176 PRO PRO A . n
A 1 57 GLU 57 177 177 GLU GLU A . n
A 1 58 ALA 58 178 178 ALA ALA A . n
A 1 59 ILE 59 179 179 ILE ILE A . n
A 1 60 PHE 60 180 180 PHE PHE A . n
A 1 61 GLU 61 181 181 GLU GLU A . n
A 1 62 LEU 62 182 182 LEU LEU A . n
A 1 63 PRO 63 183 183 PRO PRO A . n
A 1 64 PHE 64 184 184 PHE PHE A . n
A 1 65 PHE 65 185 185 PHE PHE A . n
A 1 66 PHE 66 186 186 PHE PHE A . n
A 1 67 HIS 67 187 187 HIS HIS A . n
A 1 68 ASN 68 188 188 ASN ASN A . n
A 1 69 PRO 69 189 189 PRO PRO A . n
A 1 70 LYS 70 190 190 LYS LYS A . n
A 1 71 PRO 71 191 191 PRO PRO A . n
A 1 72 PHE 72 192 192 PHE PHE A . n
A 1 73 PHE 73 193 193 PHE PHE A . n
A 1 74 THR 74 194 194 THR THR A . n
A 1 75 LEU 75 195 195 LEU LEU A . n
A 1 76 ALA 76 196 196 ALA ALA A . n
A 1 77 LYS 77 197 197 LYS LYS A . n
A 1 78 GLU 78 198 198 GLU GLU A . n
A 1 79 LEU 79 199 199 LEU LEU A . n
A 1 80 TYR 80 200 200 TYR TYR A . n
A 1 81 PRO 81 201 201 PRO PRO A . n
A 1 82 GLY 82 202 202 GLY GLY A . n
A 1 83 ASN 83 203 203 ASN ASN A . n
A 1 84 TYR 84 204 204 TYR TYR A . n
A 1 85 LYS 85 205 205 LYS LYS A . n
A 1 86 PRO 86 206 206 PRO PRO A . n
A 1 87 ASN 87 207 207 ASN ASN A . n
A 1 88 VAL 88 208 208 VAL VAL A . n
A 1 89 THR 89 209 209 THR THR A . n
A 1 90 HIS 90 210 210 HIS HIS A . n
A 1 91 TYR 91 211 211 TYR TYR A . n
A 1 92 PHE 92 212 212 PHE PHE A . n
A 1 93 LEU 93 213 213 LEU LEU A . n
A 1 94 ARG 94 214 214 ARG ARG A . n
A 1 95 LEU 95 215 215 LEU LEU A . n
A 1 96 LEU 96 216 216 LEU LEU A . n
A 1 97 HIS 97 217 217 HIS HIS A . n
A 1 98 ASP 98 218 218 ASP ASP A . n
A 1 99 LYS 99 219 219 LYS LYS A . n
A 1 100 GLY 100 220 220 GLY GLY A . n
A 1 101 LEU 101 221 221 LEU LEU A . n
A 1 102 LEU 102 222 222 LEU LEU A . n
A 1 103 LEU 103 223 223 LEU LEU A . n
A 1 104 ARG 104 224 224 ARG ARG A . n
A 1 105 LEU 105 225 225 LEU LEU A . n
A 1 106 TYR 106 226 226 TYR TYR A . n
A 1 107 THR 107 227 227 THR THR A . n
A 1 108 GLN 108 228 228 GLN GLN A . n
A 1 109 ASN 109 229 229 ASN ASN A . n
A 1 110 ILE 110 230 230 ILE ILE A . n
A 1 111 ASP 111 231 231 ASP ASP A . n
A 1 112 GLY 112 232 232 GLY GLY A . n
A 1 113 LEU 113 233 233 LEU LEU A . n
A 1 114 GLU 114 234 234 GLU GLU A . n
A 1 115 ARG 115 235 235 ARG ARG A . n
A 1 116 VAL 116 236 236 VAL VAL A . n
A 1 117 SER 117 237 237 SER SER A . n
A 1 118 GLY 118 238 238 GLY GLY A . n
A 1 119 ILE 119 239 239 ILE ILE A . n
A 1 120 PRO 120 240 240 PRO PRO A . n
A 1 121 ALA 121 241 241 ALA ALA A . n
A 1 122 SER 122 242 242 SER SER A . n
A 1 123 LYS 123 243 243 LYS LYS A . n
A 1 124 LEU 124 244 244 LEU LEU A . n
A 1 125 VAL 125 245 245 VAL VAL A . n
A 1 126 GLU 126 246 246 GLU GLU A . n
A 1 127 ALA 127 247 247 ALA ALA A . n
A 1 128 HIS 128 248 248 HIS HIS A . n
A 1 129 GLY 129 249 249 GLY GLY A . n
A 1 130 THR 130 250 250 THR THR A . n
A 1 131 PHE 131 251 251 PHE PHE A . n
A 1 132 ALA 132 252 252 ALA ALA A . n
A 1 133 SER 133 253 253 SER SER A . n
A 1 134 ALA 134 254 254 ALA ALA A . n
A 1 135 THR 135 255 255 THR THR A . n
A 1 136 CYS 136 256 256 CYS CYS A . n
A 1 137 THR 137 257 257 THR THR A . n
A 1 138 VAL 138 258 258 VAL VAL A . n
A 1 139 CYS 139 259 259 CYS CYS A . n
A 1 140 GLN 140 260 260 GLN GLN A . n
A 1 141 ARG 141 261 261 ARG ARG A . n
A 1 142 PRO 142 262 262 PRO PRO A . n
A 1 143 PHE 143 263 263 PHE PHE A . n
A 1 144 PRO 144 264 264 PRO PRO A . n
A 1 145 GLY 145 265 265 GLY GLY A . n
A 1 146 GLU 146 266 266 GLU GLU A . n
A 1 147 ASP 147 267 267 ASP ASP A . n
A 1 148 ILE 148 268 268 ILE ILE A . n
A 1 149 ARG 149 269 269 ARG ARG A . n
A 1 150 ALA 150 270 270 ALA ALA A . n
A 1 151 ASP 151 271 271 ASP ASP A . n
A 1 152 VAL 152 272 272 VAL VAL A . n
A 1 153 MET 153 273 273 MET MET A . n
A 1 154 ALA 154 274 274 ALA ALA A . n
A 1 155 ASP 155 275 275 ASP ASP A . n
A 1 156 ARG 156 276 276 ARG ARG A . n
A 1 157 VAL 157 277 277 VAL VAL A . n
A 1 158 PRO 158 278 278 PRO PRO A . n
A 1 159 ARG 159 279 279 ARG ARG A . n
A 1 160 CYS 160 280 280 CYS CYS A . n
A 1 161 PRO 161 281 281 PRO PRO A . n
A 1 162 VAL 162 282 282 VAL VAL A . n
A 1 163 CYS 163 283 283 CYS CYS A . n
A 1 164 THR 164 284 284 THR THR A . n
A 1 165 GLY 165 285 285 GLY GLY A . n
A 1 166 VAL 166 286 286 VAL VAL A . n
A 1 167 VAL 167 287 287 VAL VAL A . n
A 1 168 LYS 168 288 288 LYS LYS A . n
A 1 169 PRO 169 289 289 PRO PRO A . n
A 1 170 ASP 170 290 290 ASP ASP A . n
A 1 171 ILE 171 291 291 ILE ILE A . n
A 1 172 VAL 172 292 292 VAL VAL A . n
A 1 173 PHE 173 293 293 PHE PHE A . n
A 1 174 PHE 174 294 294 PHE PHE A . n
A 1 175 GLY 175 295 295 GLY GLY A . n
A 1 176 GLU 176 296 296 GLU GLU A . n
A 1 177 PRO 177 297 297 PRO PRO A . n
A 1 178 LEU 178 298 298 LEU LEU A . n
A 1 179 PRO 179 299 299 PRO PRO A . n
A 1 180 GLN 180 300 300 GLN GLN A . n
A 1 181 ARG 181 301 301 ARG ARG A . n
A 1 182 PHE 182 302 302 PHE PHE A . n
A 1 183 LEU 183 303 303 LEU LEU A . n
A 1 184 LEU 184 304 304 LEU LEU A . n
A 1 185 HIS 185 305 305 HIS HIS A . n
A 1 186 VAL 186 306 306 VAL VAL A . n
A 1 187 VAL 187 307 307 VAL VAL A . n
A 1 188 ASP 188 308 308 ASP ASP A . n
A 1 189 PHE 189 309 309 PHE PHE A . n
A 1 190 PRO 190 310 310 PRO PRO A . n
A 1 191 MET 191 311 311 MET MET A . n
A 1 192 ALA 192 312 312 ALA ALA A . n
A 1 193 ASP 193 313 313 ASP ASP A . n
A 1 194 LEU 194 314 314 LEU LEU A . n
A 1 195 LEU 195 315 315 LEU LEU A . n
A 1 196 LEU 196 316 316 LEU LEU A . n
A 1 197 ILE 197 317 317 ILE ILE A . n
A 1 198 LEU 198 318 318 LEU LEU A . n
A 1 199 GLY 199 319 319 GLY GLY A . n
A 1 200 THR 200 320 320 THR THR A . n
A 1 201 SER 201 321 321 SER SER A . n
A 1 202 LEU 202 322 322 LEU LEU A . n
A 1 203 GLU 203 323 323 GLU GLU A . n
A 1 204 VAL 204 324 324 VAL VAL A . n
A 1 205 GLU 205 325 325 GLU GLU A . n
A 1 206 PRO 206 326 326 PRO PRO A . n
A 1 207 PHE 207 327 327 PHE PHE A . n
A 1 208 ALA 208 328 328 ALA ALA A . n
A 1 209 SER 209 329 329 SER SER A . n
A 1 210 LEU 210 330 330 LEU LEU A . n
A 1 211 THR 211 331 331 THR THR A . n
A 1 212 GLU 212 332 332 GLU GLU A . n
A 1 213 ALA 213 333 333 ALA ALA A . n
A 1 214 VAL 214 334 334 VAL VAL A . n
A 1 215 ARG 215 335 335 ARG ARG A . n
A 1 216 SER 216 336 336 SER SER A . n
A 1 217 SER 217 337 337 SER SER A . n
A 1 218 VAL 218 338 338 VAL VAL A . n
A 1 219 PRO 219 339 339 PRO PRO A . n
A 1 220 ARG 220 340 340 ARG ARG A . n
A 1 221 LEU 221 341 341 LEU LEU A . n
A 1 222 LEU 222 342 342 LEU LEU A . n
A 1 223 ILE 223 343 343 ILE ILE A . n
A 1 224 ASN 224 344 344 ASN ASN A . n
A 1 225 ARG 225 345 345 ARG ARG A . n
A 1 226 ASP 226 346 346 ASP ASP A . n
A 1 227 LEU 227 347 347 LEU LEU A . n
A 1 228 VAL 228 348 348 VAL VAL A . n
A 1 229 GLY 229 349 349 GLY GLY A . n
A 1 230 PRO 230 350 350 PRO PRO A . n
A 1 231 LEU 231 351 351 LEU LEU A . n
A 1 232 ALA 232 352 352 ALA ALA A . n
A 1 233 TRP 233 353 353 TRP TRP A . n
A 1 234 HIS 234 354 354 HIS HIS A . n
A 1 235 PRO 235 355 355 PRO PRO A . n
A 1 236 ARG 236 356 356 ARG ARG A . n
A 1 237 SER 237 357 357 SER SER A . n
A 1 238 ARG 238 358 358 ARG ARG A . n
A 1 239 ASP 239 359 359 ASP ASP A . n
A 1 240 VAL 240 360 360 VAL VAL A . n
A 1 241 ALA 241 361 361 ALA ALA A . n
A 1 242 GLN 242 362 362 GLN GLN A . n
A 1 243 LEU 243 363 363 LEU LEU A . n
A 1 244 GLY 244 364 364 GLY GLY A . n
A 1 245 ASP 245 365 365 ASP ASP A . n
A 1 246 VAL 246 366 366 VAL VAL A . n
A 1 247 VAL 247 367 367 VAL VAL A . n
A 1 248 HIS 248 368 368 HIS HIS A . n
A 1 249 GLY 249 369 369 GLY GLY A . n
A 1 250 VAL 250 370 370 VAL VAL A . n
A 1 251 GLU 251 371 371 GLU GLU A . n
A 1 252 SER 252 372 372 SER SER A . n
A 1 253 LEU 253 373 373 LEU LEU A . n
A 1 254 VAL 254 374 374 VAL VAL A . n
A 1 255 GLU 255 375 375 GLU GLU A . n
A 1 256 LEU 256 376 376 LEU LEU A . n
A 1 257 LEU 257 377 377 LEU LEU A . n
A 1 258 GLY 258 378 378 GLY GLY A . n
A 1 259 TRP 259 379 379 TRP TRP A . n
A 1 260 THR 260 380 380 THR THR A . n
A 1 261 GLU 261 381 381 GLU GLU A . n
A 1 262 GLU 262 382 382 GLU GLU A . n
A 1 263 MET 263 383 383 MET MET A . n
A 1 264 ARG 264 384 384 ARG ARG A . n
A 1 265 ASP 265 385 385 ASP ASP A . n
A 1 266 LEU 266 386 386 LEU LEU A . n
A 1 267 VAL 267 387 387 VAL VAL A . n
A 1 268 GLN 268 388 388 GLN GLN A . n
A 1 269 ARG 269 389 389 ARG ARG A . n
A 1 270 GLU 270 390 390 GLU GLU A . n
A 1 271 THR 271 391 391 THR THR A . n
B 2 1 ARG 1 1 1 ARG ARG D . n
B 2 2 HIS 2 2 2 HIS HIS D . n
B 2 3 LYS 3 3 3 LYS LYS D . n
B 2 4 ALY 4 4 4 ALY FDL D . n
C 1 1 GLY 1 121 121 GLY GLY H . n
C 1 2 LYS 2 122 122 LYS LYS H . n
C 1 3 LEU 3 123 123 LEU LEU H . n
C 1 4 SER 4 124 124 SER SER H . n
C 1 5 LEU 5 125 125 LEU LEU H . n
C 1 6 GLN 6 126 126 GLN GLN H . n
C 1 7 ASP 7 127 127 ASP ASP H . n
C 1 8 VAL 8 128 128 VAL VAL H . n
C 1 9 ALA 9 129 129 ALA ALA H . n
C 1 10 GLU 10 130 130 GLU GLU H . n
C 1 11 LEU 11 131 131 LEU LEU H . n
C 1 12 ILE 12 132 132 ILE ILE H . n
C 1 13 ARG 13 133 133 ARG ARG H . n
C 1 14 ALA 14 134 134 ALA ALA H . n
C 1 15 ARG 15 135 135 ARG ARG H . n
C 1 16 ALA 16 136 136 ALA ALA H . n
C 1 17 CYS 17 137 137 CYS CYS H . n
C 1 18 GLN 18 138 138 GLN GLN H . n
C 1 19 ARG 19 139 139 ARG ARG H . n
C 1 20 VAL 20 140 140 VAL VAL H . n
C 1 21 VAL 21 141 141 VAL VAL H . n
C 1 22 VAL 22 142 142 VAL VAL H . n
C 1 23 MET 23 143 143 MET MET H . n
C 1 24 VAL 24 144 144 VAL VAL H . n
C 1 25 GLY 25 145 145 GLY GLY H . n
C 1 26 ALA 26 146 146 ALA ALA H . n
C 1 27 GLY 27 147 147 GLY GLY H . n
C 1 28 ILE 28 148 148 ILE ILE H . n
C 1 29 SER 29 149 149 SER SER H . n
C 1 30 THR 30 150 150 THR THR H . n
C 1 31 PRO 31 151 151 PRO PRO H . n
C 1 32 SER 32 152 152 SER SER H . n
C 1 33 GLY 33 153 153 GLY GLY H . n
C 1 34 ILE 34 154 154 ILE ILE H . n
C 1 35 PRO 35 155 155 PRO PRO H . n
C 1 36 ASP 36 156 156 ASP ASP H . n
C 1 37 PHE 37 157 157 PHE PHE H . n
C 1 38 ARG 38 158 158 ARG ARG H . n
C 1 39 SER 39 159 159 SER SER H . n
C 1 40 PRO 40 160 160 PRO PRO H . n
C 1 41 GLY 41 161 161 GLY GLY H . n
C 1 42 SER 42 162 162 SER SER H . n
C 1 43 GLY 43 163 163 GLY GLY H . n
C 1 44 LEU 44 164 164 LEU LEU H . n
C 1 45 TYR 45 165 165 TYR TYR H . n
C 1 46 SER 46 166 166 SER SER H . n
C 1 47 ASN 47 167 167 ASN ASN H . n
C 1 48 LEU 48 168 168 LEU LEU H . n
C 1 49 GLN 49 169 169 GLN GLN H . n
C 1 50 GLN 50 170 170 GLN GLN H . n
C 1 51 TYR 51 171 171 TYR TYR H . n
C 1 52 ASP 52 172 172 ASP ASP H . n
C 1 53 LEU 53 173 173 LEU LEU H . n
C 1 54 PRO 54 174 174 PRO PRO H . n
C 1 55 TYR 55 175 175 TYR TYR H . n
C 1 56 PRO 56 176 176 PRO PRO H . n
C 1 57 GLU 57 177 177 GLU GLU H . n
C 1 58 ALA 58 178 178 ALA ALA H . n
C 1 59 ILE 59 179 179 ILE ILE H . n
C 1 60 PHE 60 180 180 PHE PHE H . n
C 1 61 GLU 61 181 181 GLU GLU H . n
C 1 62 LEU 62 182 182 LEU LEU H . n
C 1 63 PRO 63 183 183 PRO PRO H . n
C 1 64 PHE 64 184 184 PHE PHE H . n
C 1 65 PHE 65 185 185 PHE PHE H . n
C 1 66 PHE 66 186 186 PHE PHE H . n
C 1 67 HIS 67 187 187 HIS HIS H . n
C 1 68 ASN 68 188 188 ASN ASN H . n
C 1 69 PRO 69 189 189 PRO PRO H . n
C 1 70 LYS 70 190 190 LYS LYS H . n
C 1 71 PRO 71 191 191 PRO PRO H . n
C 1 72 PHE 72 192 192 PHE PHE H . n
C 1 73 PHE 73 193 193 PHE PHE H . n
C 1 74 THR 74 194 194 THR THR H . n
C 1 75 LEU 75 195 195 LEU LEU H . n
C 1 76 ALA 76 196 196 ALA ALA H . n
C 1 77 LYS 77 197 197 LYS LYS H . n
C 1 78 GLU 78 198 198 GLU GLU H . n
C 1 79 LEU 79 199 199 LEU LEU H . n
C 1 80 TYR 80 200 200 TYR TYR H . n
C 1 81 PRO 81 201 201 PRO PRO H . n
C 1 82 GLY 82 202 202 GLY GLY H . n
C 1 83 ASN 83 203 203 ASN ASN H . n
C 1 84 TYR 84 204 204 TYR TYR H . n
C 1 85 LYS 85 205 205 LYS LYS H . n
C 1 86 PRO 86 206 206 PRO PRO H . n
C 1 87 ASN 87 207 207 ASN ASN H . n
C 1 88 VAL 88 208 208 VAL VAL H . n
C 1 89 THR 89 209 209 THR THR H . n
C 1 90 HIS 90 210 210 HIS HIS H . n
C 1 91 TYR 91 211 211 TYR TYR H . n
C 1 92 PHE 92 212 212 PHE PHE H . n
C 1 93 LEU 93 213 213 LEU LEU H . n
C 1 94 ARG 94 214 214 ARG ARG H . n
C 1 95 LEU 95 215 215 LEU LEU H . n
C 1 96 LEU 96 216 216 LEU LEU H . n
C 1 97 HIS 97 217 217 HIS HIS H . n
C 1 98 ASP 98 218 218 ASP ASP H . n
C 1 99 LYS 99 219 219 LYS LYS H . n
C 1 100 GLY 100 220 220 GLY GLY H . n
C 1 101 LEU 101 221 221 LEU LEU H . n
C 1 102 LEU 102 222 222 LEU LEU H . n
C 1 103 LEU 103 223 223 LEU LEU H . n
C 1 104 ARG 104 224 224 ARG ARG H . n
C 1 105 LEU 105 225 225 LEU LEU H . n
C 1 106 TYR 106 226 226 TYR TYR H . n
C 1 107 THR 107 227 227 THR THR H . n
C 1 108 GLN 108 228 228 GLN GLN H . n
C 1 109 ASN 109 229 229 ASN ASN H . n
C 1 110 ILE 110 230 230 ILE ILE H . n
C 1 111 ASP 111 231 231 ASP ASP H . n
C 1 112 GLY 112 232 232 GLY GLY H . n
C 1 113 LEU 113 233 233 LEU LEU H . n
C 1 114 GLU 114 234 234 GLU GLU H . n
C 1 115 ARG 115 235 235 ARG ARG H . n
C 1 116 VAL 116 236 236 VAL VAL H . n
C 1 117 SER 117 237 237 SER SER H . n
C 1 118 GLY 118 238 238 GLY GLY H . n
C 1 119 ILE 119 239 239 ILE ILE H . n
C 1 120 PRO 120 240 240 PRO PRO H . n
C 1 121 ALA 121 241 241 ALA ALA H . n
C 1 122 SER 122 242 242 SER SER H . n
C 1 123 LYS 123 243 243 LYS LYS H . n
C 1 124 LEU 124 244 244 LEU LEU H . n
C 1 125 VAL 125 245 245 VAL VAL H . n
C 1 126 GLU 126 246 246 GLU GLU H . n
C 1 127 ALA 127 247 247 ALA ALA H . n
C 1 128 HIS 128 248 248 HIS HIS H . n
C 1 129 GLY 129 249 249 GLY GLY H . n
C 1 130 THR 130 250 250 THR THR H . n
C 1 131 PHE 131 251 251 PHE PHE H . n
C 1 132 ALA 132 252 252 ALA ALA H . n
C 1 133 SER 133 253 253 SER SER H . n
C 1 134 ALA 134 254 254 ALA ALA H . n
C 1 135 THR 135 255 255 THR THR H . n
C 1 136 CYS 136 256 256 CYS CYS H . n
C 1 137 THR 137 257 257 THR THR H . n
C 1 138 VAL 138 258 258 VAL VAL H . n
C 1 139 CYS 139 259 259 CYS CYS H . n
C 1 140 GLN 140 260 260 GLN GLN H . n
C 1 141 ARG 141 261 261 ARG ARG H . n
C 1 142 PRO 142 262 262 PRO PRO H . n
C 1 143 PHE 143 263 263 PHE PHE H . n
C 1 144 PRO 144 264 264 PRO PRO H . n
C 1 145 GLY 145 265 265 GLY GLY H . n
C 1 146 GLU 146 266 266 GLU GLU H . n
C 1 147 ASP 147 267 267 ASP ASP H . n
C 1 148 ILE 148 268 268 ILE ILE H . n
C 1 149 ARG 149 269 269 ARG ARG H . n
C 1 150 ALA 150 270 270 ALA ALA H . n
C 1 151 ASP 151 271 271 ASP ASP H . n
C 1 152 VAL 152 272 272 VAL VAL H . n
C 1 153 MET 153 273 273 MET MET H . n
C 1 154 ALA 154 274 274 ALA ALA H . n
C 1 155 ASP 155 275 275 ASP ASP H . n
C 1 156 ARG 156 276 276 ARG ARG H . n
C 1 157 VAL 157 277 277 VAL VAL H . n
C 1 158 PRO 158 278 278 PRO PRO H . n
C 1 159 ARG 159 279 279 ARG ARG H . n
C 1 160 CYS 160 280 280 CYS CYS H . n
C 1 161 PRO 161 281 281 PRO PRO H . n
C 1 162 VAL 162 282 282 VAL VAL H . n
C 1 163 CYS 163 283 283 CYS CYS H . n
C 1 164 THR 164 284 284 THR THR H . n
C 1 165 GLY 165 285 285 GLY GLY H . n
C 1 166 VAL 166 286 286 VAL VAL H . n
C 1 167 VAL 167 287 287 VAL VAL H . n
C 1 168 LYS 168 288 288 LYS LYS H . n
C 1 169 PRO 169 289 289 PRO PRO H . n
C 1 170 ASP 170 290 290 ASP ASP H . n
C 1 171 ILE 171 291 291 ILE ILE H . n
C 1 172 VAL 172 292 292 VAL VAL H . n
C 1 173 PHE 173 293 293 PHE PHE H . n
C 1 174 PHE 174 294 294 PHE PHE H . n
C 1 175 GLY 175 295 295 GLY GLY H . n
C 1 176 GLU 176 296 296 GLU GLU H . n
C 1 177 PRO 177 297 297 PRO PRO H . n
C 1 178 LEU 178 298 298 LEU LEU H . n
C 1 179 PRO 179 299 299 PRO PRO H . n
C 1 180 GLN 180 300 300 GLN GLN H . n
C 1 181 ARG 181 301 301 ARG ARG H . n
C 1 182 PHE 182 302 302 PHE PHE H . n
C 1 183 LEU 183 303 303 LEU LEU H . n
C 1 184 LEU 184 304 304 LEU LEU H . n
C 1 185 HIS 185 305 305 HIS HIS H . n
C 1 186 VAL 186 306 306 VAL VAL H . n
C 1 187 VAL 187 307 307 VAL VAL H . n
C 1 188 ASP 188 308 308 ASP ASP H . n
C 1 189 PHE 189 309 309 PHE PHE H . n
C 1 190 PRO 190 310 310 PRO PRO H . n
C 1 191 MET 191 311 311 MET MET H . n
C 1 192 ALA 192 312 312 ALA ALA H . n
C 1 193 ASP 193 313 313 ASP ASP H . n
C 1 194 LEU 194 314 314 LEU LEU H . n
C 1 195 LEU 195 315 315 LEU LEU H . n
C 1 196 LEU 196 316 316 LEU LEU H . n
C 1 197 ILE 197 317 317 ILE ILE H . n
C 1 198 LEU 198 318 318 LEU LEU H . n
C 1 199 GLY 199 319 319 GLY GLY H . n
C 1 200 THR 200 320 320 THR THR H . n
C 1 201 SER 201 321 321 SER SER H . n
C 1 202 LEU 202 322 322 LEU LEU H . n
C 1 203 GLU 203 323 323 GLU GLU H . n
C 1 204 VAL 204 324 324 VAL VAL H . n
C 1 205 GLU 205 325 325 GLU GLU H . n
C 1 206 PRO 206 326 326 PRO PRO H . n
C 1 207 PHE 207 327 327 PHE PHE H . n
C 1 208 ALA 208 328 328 ALA ALA H . n
C 1 209 SER 209 329 329 SER SER H . n
C 1 210 LEU 210 330 330 LEU LEU H . n
C 1 211 THR 211 331 331 THR THR H . n
C 1 212 GLU 212 332 332 GLU GLU H . n
C 1 213 ALA 213 333 333 ALA ALA H . n
C 1 214 VAL 214 334 334 VAL VAL H . n
C 1 215 ARG 215 335 335 ARG ARG H . n
C 1 216 SER 216 336 336 SER SER H . n
C 1 217 SER 217 337 337 SER SER H . n
C 1 218 VAL 218 338 338 VAL VAL H . n
C 1 219 PRO 219 339 339 PRO PRO H . n
C 1 220 ARG 220 340 340 ARG ARG H . n
C 1 221 LEU 221 341 341 LEU LEU H . n
C 1 222 LEU 222 342 342 LEU LEU H . n
C 1 223 ILE 223 343 343 ILE ILE H . n
C 1 224 ASN 224 344 344 ASN ASN H . n
C 1 225 ARG 225 345 345 ARG ARG H . n
C 1 226 ASP 226 346 346 ASP ASP H . n
C 1 227 LEU 227 347 347 LEU LEU H . n
C 1 228 VAL 228 348 348 VAL VAL H . n
C 1 229 GLY 229 349 349 GLY GLY H . n
C 1 230 PRO 230 350 350 PRO PRO H . n
C 1 231 LEU 231 351 351 LEU LEU H . n
C 1 232 ALA 232 352 352 ALA ALA H . n
C 1 233 TRP 233 353 353 TRP TRP H . n
C 1 234 HIS 234 354 354 HIS HIS H . n
C 1 235 PRO 235 355 355 PRO PRO H . n
C 1 236 ARG 236 356 356 ARG ARG H . n
C 1 237 SER 237 357 357 SER SER H . n
C 1 238 ARG 238 358 358 ARG ARG H . n
C 1 239 ASP 239 359 359 ASP ASP H . n
C 1 240 VAL 240 360 360 VAL VAL H . n
C 1 241 ALA 241 361 361 ALA ALA H . n
C 1 242 GLN 242 362 362 GLN GLN H . n
C 1 243 LEU 243 363 363 LEU LEU H . n
C 1 244 GLY 244 364 364 GLY GLY H . n
C 1 245 ASP 245 365 365 ASP ASP H . n
C 1 246 VAL 246 366 366 VAL VAL H . n
C 1 247 VAL 247 367 367 VAL VAL H . n
C 1 248 HIS 248 368 368 HIS HIS H . n
C 1 249 GLY 249 369 369 GLY GLY H . n
C 1 250 VAL 250 370 370 VAL VAL H . n
C 1 251 GLU 251 371 371 GLU GLU H . n
C 1 252 SER 252 372 372 SER SER H . n
C 1 253 LEU 253 373 373 LEU LEU H . n
C 1 254 VAL 254 374 374 VAL VAL H . n
C 1 255 GLU 255 375 375 GLU GLU H . n
C 1 256 LEU 256 376 376 LEU LEU H . n
C 1 257 LEU 257 377 377 LEU LEU H . n
C 1 258 GLY 258 378 378 GLY GLY H . n
C 1 259 TRP 259 379 379 TRP TRP H . n
C 1 260 THR 260 380 380 THR THR H . n
C 1 261 GLU 261 381 381 GLU GLU H . n
C 1 262 GLU 262 382 382 GLU GLU H . n
C 1 263 MET 263 383 383 MET MET H . n
C 1 264 ARG 264 384 384 ARG ARG H . n
C 1 265 ASP 265 385 385 ASP ASP H . n
C 1 266 LEU 266 386 386 LEU LEU H . n
C 1 267 VAL 267 387 387 VAL VAL H . n
C 1 268 GLN 268 388 388 GLN GLN H . n
C 1 269 ARG 269 389 389 ARG ARG H . n
C 1 270 GLU 270 390 390 GLU GLU H . n
C 1 271 THR 271 391 391 THR THR H . n
D 2 1 ARG 1 1 1 ARG ARG C . n
D 2 2 HIS 2 2 2 HIS HIS C . n
D 2 3 LYS 3 3 3 LYS LYS C . n
D 2 4 ALY 4 4 4 ALY FDL C . n
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
E 3 ZN 1 401 401 ZN ZN A .
F 4 MG 1 402 405 MG MG A .
G 5 BBI 1 403 1 BBI LIG A .
H 6 NAD 1 404 702 NAD NAD A .
I 7 MCM 1 101 4 MCM FDL D .
J 8 PEG 1 401 403 PEG PEG H .
K 3 ZN 1 402 401 ZN ZN H .
L 8 PEG 1 403 404 PEG PEG H .
M 4 MG 1 404 405 MG MG H .
N 5 BBI 1 405 2 BBI LIG H .
O 6 NAD 1 406 703 NAD NAD H .
P 7 MCM 1 101 4 MCM FDL C .
#
loop_
_pdbx_struct_assembly.id
_pdbx_struct_assembly.details
_pdbx_struct_assembly.method_details
_pdbx_struct_assembly.oligomeric_details
_pdbx_struct_assembly.oligomeric_count
1 author_defined_assembly ? dimeric 2
2 author_defined_assembly ? dimeric 2
#
loop_
_pdbx_struct_assembly_gen.assembly_id
_pdbx_struct_assembly_gen.oper_expression
_pdbx_struct_assembly_gen.asym_id_list
1 1 A,D,E,F,G,H,P
2 1 B,C,I,J,K,L,M,N,O
#
_pdbx_struct_oper_list.id 1
_pdbx_struct_oper_list.type 'identity operation'
_pdbx_struct_oper_list.name 1_555
_pdbx_struct_oper_list.symmetry_operation x,y,z
_pdbx_struct_oper_list.matrix[1][1] 1.0000000000
_pdbx_struct_oper_list.matrix[1][2] 0.0000000000
_pdbx_struct_oper_list.matrix[1][3] 0.0000000000
_pdbx_struct_oper_list.vector[1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][2] 1.0000000000
_pdbx_struct_oper_list.matrix[2][3] 0.0000000000
_pdbx_struct_oper_list.vector[2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][1] 0.0000000000
_pdbx_struct_oper_list.matrix[3][2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][3] 1.0000000000
_pdbx_struct_oper_list.vector[3] 0.0000000000
#
loop_
_pdbx_struct_conn_angle.id
_pdbx_struct_conn_angle.ptnr1_label_atom_id
_pdbx_struct_conn_angle.ptnr1_label_alt_id
_pdbx_struct_conn_angle.ptnr1_label_asym_id
_pdbx_struct_conn_angle.ptnr1_label_comp_id
_pdbx_struct_conn_angle.ptnr1_label_seq_id
_pdbx_struct_conn_angle.ptnr1_auth_atom_id
_pdbx_struct_conn_angle.ptnr1_auth_asym_id
_pdbx_struct_conn_angle.ptnr1_auth_comp_id
_pdbx_struct_conn_angle.ptnr1_auth_seq_id
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code
_pdbx_struct_conn_angle.ptnr1_symmetry
_pdbx_struct_conn_angle.ptnr2_label_atom_id
_pdbx_struct_conn_angle.ptnr2_label_alt_id
_pdbx_struct_conn_angle.ptnr2_label_asym_id
_pdbx_struct_conn_angle.ptnr2_label_comp_id
_pdbx_struct_conn_angle.ptnr2_label_seq_id
_pdbx_struct_conn_angle.ptnr2_auth_atom_id
_pdbx_struct_conn_angle.ptnr2_auth_asym_id
_pdbx_struct_conn_angle.ptnr2_auth_comp_id
_pdbx_struct_conn_angle.ptnr2_auth_seq_id
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code
_pdbx_struct_conn_angle.ptnr2_symmetry
_pdbx_struct_conn_angle.ptnr3_label_atom_id
_pdbx_struct_conn_angle.ptnr3_label_alt_id
_pdbx_struct_conn_angle.ptnr3_label_asym_id
_pdbx_struct_conn_angle.ptnr3_label_comp_id
_pdbx_struct_conn_angle.ptnr3_label_seq_id
_pdbx_struct_conn_angle.ptnr3_auth_atom_id
_pdbx_struct_conn_angle.ptnr3_auth_asym_id
_pdbx_struct_conn_angle.ptnr3_auth_comp_id
_pdbx_struct_conn_angle.ptnr3_auth_seq_id
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code
_pdbx_struct_conn_angle.ptnr3_symmetry
_pdbx_struct_conn_angle.value
_pdbx_struct_conn_angle.value_esd
1 SG ? A CYS 136 ? A CYS 256 ? 1_555 ZN ? E ZN . ? A ZN 401 ? 1_555 SG ? A CYS 160 ? A CYS 280 ? 1_555 113.6 ?
2 SG ? A CYS 136 ? A CYS 256 ? 1_555 ZN ? E ZN . ? A ZN 401 ? 1_555 SG ? A CYS 163 ? A CYS 283 ? 1_555 102.6 ?
3 SG ? A CYS 160 ? A CYS 280 ? 1_555 ZN ? E ZN . ? A ZN 401 ? 1_555 SG ? A CYS 163 ? A CYS 283 ? 1_555 115.2 ?
4 SG ? C CYS 136 ? H CYS 256 ? 1_555 ZN ? K ZN . ? H ZN 402 ? 1_555 SG ? C CYS 139 ? H CYS 259 ? 1_555 93.2 ?
5 SG ? C CYS 136 ? H CYS 256 ? 1_555 ZN ? K ZN . ? H ZN 402 ? 1_555 SG ? C CYS 160 ? H CYS 280 ? 1_555 112.6 ?
6 SG ? C CYS 139 ? H CYS 259 ? 1_555 ZN ? K ZN . ? H ZN 402 ? 1_555 SG ? C CYS 160 ? H CYS 280 ? 1_555 91.3 ?
7 SG ? C CYS 136 ? H CYS 256 ? 1_555 ZN ? K ZN . ? H ZN 402 ? 1_555 SG ? C CYS 163 ? H CYS 283 ? 1_555 112.0 ?
8 SG ? C CYS 139 ? H CYS 259 ? 1_555 ZN ? K ZN . ? H ZN 402 ? 1_555 SG ? C CYS 163 ? H CYS 283 ? 1_555 106.4 ?
9 SG ? C CYS 160 ? H CYS 280 ? 1_555 ZN ? K ZN . ? H ZN 402 ? 1_555 SG ? C CYS 163 ? H CYS 283 ? 1_555 130.6 ?
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2017-11-08
2 'Structure model' 1 1 2017-11-22
3 'Structure model' 2 0 2023-04-05
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
loop_
_pdbx_audit_revision_group.ordinal
_pdbx_audit_revision_group.revision_ordinal
_pdbx_audit_revision_group.data_content_type
_pdbx_audit_revision_group.group
1 2 'Structure model' 'Data collection'
2 3 'Structure model' Advisory
3 3 'Structure model' 'Atomic model'
4 3 'Structure model' 'Data collection'
5 3 'Structure model' 'Database references'
6 3 'Structure model' 'Derived calculations'
7 3 'Structure model' 'Non-polymer description'
8 3 'Structure model' 'Polymer sequence'
9 3 'Structure model' 'Source and taxonomy'
10 3 'Structure model' 'Structure summary'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 2 'Structure model' diffrn_detector
2 2 'Structure model' diffrn_source
3 3 'Structure model' atom_site
4 3 'Structure model' chem_comp
5 3 'Structure model' database_2
6 3 'Structure model' entity
7 3 'Structure model' entity_poly
8 3 'Structure model' entity_poly_seq
9 3 'Structure model' entity_src_gen
10 3 'Structure model' pdbx_entity_nonpoly
11 3 'Structure model' pdbx_nonpoly_scheme
12 3 'Structure model' pdbx_poly_seq_scheme
13 3 'Structure model' pdbx_struct_sheet_hbond
14 3 'Structure model' pdbx_validate_close_contact
15 3 'Structure model' pdbx_validate_main_chain_plane
16 3 'Structure model' pdbx_validate_rmsd_angle
17 3 'Structure model' struct_conn
18 3 'Structure model' struct_conn_type
19 3 'Structure model' struct_ref_seq
20 3 'Structure model' struct_sheet
21 3 'Structure model' struct_sheet_order
22 3 'Structure model' struct_sheet_range
23 3 'Structure model' struct_site
24 3 'Structure model' struct_site_gen
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 2 'Structure model' '_diffrn_detector.detector'
2 2 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline'
3 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site'
4 2 'Structure model' '_diffrn_source.type'
5 3 'Structure model' '_atom_site.B_iso_or_equiv'
6 3 'Structure model' '_atom_site.Cartn_x'
7 3 'Structure model' '_atom_site.Cartn_y'
8 3 'Structure model' '_atom_site.Cartn_z'
9 3 'Structure model' '_atom_site.auth_asym_id'
10 3 'Structure model' '_atom_site.auth_atom_id'
11 3 'Structure model' '_atom_site.auth_comp_id'
12 3 'Structure model' '_atom_site.auth_seq_id'
13 3 'Structure model' '_atom_site.group_PDB'
14 3 'Structure model' '_atom_site.label_asym_id'
15 3 'Structure model' '_atom_site.label_atom_id'
16 3 'Structure model' '_atom_site.label_comp_id'
17 3 'Structure model' '_atom_site.label_entity_id'
18 3 'Structure model' '_atom_site.label_seq_id'
19 3 'Structure model' '_atom_site.pdbx_formal_charge'
20 3 'Structure model' '_atom_site.type_symbol'
21 3 'Structure model' '_chem_comp.formula'
22 3 'Structure model' '_chem_comp.formula_weight'
23 3 'Structure model' '_chem_comp.id'
24 3 'Structure model' '_chem_comp.mon_nstd_flag'
25 3 'Structure model' '_chem_comp.name'
26 3 'Structure model' '_chem_comp.pdbx_synonyms'
27 3 'Structure model' '_chem_comp.type'
28 3 'Structure model' '_database_2.pdbx_DOI'
29 3 'Structure model' '_database_2.pdbx_database_accession'
30 3 'Structure model' '_entity.formula_weight'
31 3 'Structure model' '_entity.pdbx_description'
32 3 'Structure model' '_entity_poly.nstd_monomer'
33 3 'Structure model' '_entity_poly.pdbx_seq_one_letter_code'
34 3 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can'
35 3 'Structure model' '_entity_src_gen.gene_src_common_name'
36 3 'Structure model' '_entity_src_gen.pdbx_end_seq_num'
37 3 'Structure model' '_entity_src_gen.pdbx_src_id'
38 3 'Structure model' '_pdbx_entity_nonpoly.comp_id'
39 3 'Structure model' '_pdbx_entity_nonpoly.name'
40 3 'Structure model' '_pdbx_nonpoly_scheme.mon_id'
41 3 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id'
42 3 'Structure model' '_struct_conn_type.id'
43 3 'Structure model' '_struct_ref_seq.db_align_end'
44 3 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_end'
45 3 'Structure model' '_struct_ref_seq.seq_align_end'
#
loop_
_software.citation_id
_software.classification
_software.compiler_name
_software.compiler_version
_software.contact_author
_software.contact_author_email
_software.date
_software.description
_software.dependencies
_software.hardware
_software.language
_software.location
_software.mods
_software.name
_software.os
_software.os_version
_software.type
_software.version
_software.pdbx_ordinal
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2
? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 3
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 4
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5
? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 6
#
_pdbx_validate_close_contact.id 1
_pdbx_validate_close_contact.PDB_model_num 1
_pdbx_validate_close_contact.auth_atom_id_1 O
_pdbx_validate_close_contact.auth_asym_id_1 H
_pdbx_validate_close_contact.auth_comp_id_1 GLN
_pdbx_validate_close_contact.auth_seq_id_1 228
_pdbx_validate_close_contact.PDB_ins_code_1 ?
_pdbx_validate_close_contact.label_alt_id_1 ?
_pdbx_validate_close_contact.auth_atom_id_2 O2D
_pdbx_validate_close_contact.auth_asym_id_2 H
_pdbx_validate_close_contact.auth_comp_id_2 NAD
_pdbx_validate_close_contact.auth_seq_id_2 406
_pdbx_validate_close_contact.PDB_ins_code_2 ?
_pdbx_validate_close_contact.label_alt_id_2 ?
_pdbx_validate_close_contact.dist 1.95
#
_pdbx_validate_symm_contact.id 1
_pdbx_validate_symm_contact.PDB_model_num 1
_pdbx_validate_symm_contact.auth_atom_id_1 NE
_pdbx_validate_symm_contact.auth_asym_id_1 D
_pdbx_validate_symm_contact.auth_comp_id_1 ARG
_pdbx_validate_symm_contact.auth_seq_id_1 1
_pdbx_validate_symm_contact.PDB_ins_code_1 ?
_pdbx_validate_symm_contact.label_alt_id_1 ?
_pdbx_validate_symm_contact.site_symmetry_1 1_555
_pdbx_validate_symm_contact.auth_atom_id_2 OAO
_pdbx_validate_symm_contact.auth_asym_id_2 A
_pdbx_validate_symm_contact.auth_comp_id_2 BBI
_pdbx_validate_symm_contact.auth_seq_id_2 403
_pdbx_validate_symm_contact.PDB_ins_code_2 ?
_pdbx_validate_symm_contact.label_alt_id_2 ?
_pdbx_validate_symm_contact.site_symmetry_2 5_555
_pdbx_validate_symm_contact.dist 2.15
#
loop_
_pdbx_validate_rmsd_angle.id
_pdbx_validate_rmsd_angle.PDB_model_num
_pdbx_validate_rmsd_angle.auth_atom_id_1
_pdbx_validate_rmsd_angle.auth_asym_id_1
_pdbx_validate_rmsd_angle.auth_comp_id_1
_pdbx_validate_rmsd_angle.auth_seq_id_1
_pdbx_validate_rmsd_angle.PDB_ins_code_1
_pdbx_validate_rmsd_angle.label_alt_id_1
_pdbx_validate_rmsd_angle.auth_atom_id_2
_pdbx_validate_rmsd_angle.auth_asym_id_2
_pdbx_validate_rmsd_angle.auth_comp_id_2
_pdbx_validate_rmsd_angle.auth_seq_id_2
_pdbx_validate_rmsd_angle.PDB_ins_code_2
_pdbx_validate_rmsd_angle.label_alt_id_2
_pdbx_validate_rmsd_angle.auth_atom_id_3
_pdbx_validate_rmsd_angle.auth_asym_id_3
_pdbx_validate_rmsd_angle.auth_comp_id_3
_pdbx_validate_rmsd_angle.auth_seq_id_3
_pdbx_validate_rmsd_angle.PDB_ins_code_3
_pdbx_validate_rmsd_angle.label_alt_id_3
_pdbx_validate_rmsd_angle.angle_value
_pdbx_validate_rmsd_angle.angle_target_value
_pdbx_validate_rmsd_angle.angle_deviation
_pdbx_validate_rmsd_angle.angle_standard_deviation
_pdbx_validate_rmsd_angle.linker_flag
1 1 CA D LYS 3 ? ? C D LYS 3 ? ? N D ALY 4 ? ? 131.71 117.20 14.51 2.20 Y
2 1 O D LYS 3 ? ? C D LYS 3 ? ? N D ALY 4 ? ? 106.30 122.70 -16.40 1.60 Y
3 1 O C LYS 3 ? ? C C LYS 3 ? ? N C ALY 4 ? ? 133.99 122.70 11.29 1.60 Y
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 SER A 124 ? ? -94.93 -156.02
2 1 ARG A 135 ? ? 74.44 38.70
3 1 PHE A 157 ? ? -26.12 -42.11
4 1 SER A 159 ? ? -37.29 109.32
5 1 PRO A 160 ? ? -66.16 75.43
6 1 PRO A 201 ? ? -35.09 111.54
7 1 GLU A 246 ? ? -66.61 89.35
8 1 PHE A 251 ? ? -93.89 51.40
9 1 THR A 257 ? ? -79.06 20.46
10 1 VAL A 258 ? ? -128.24 -67.57
11 1 VAL A 282 ? ? -82.76 -75.93
12 1 ASP A 290 ? ? -88.45 42.71
13 1 PHE A 294 ? ? -55.40 109.67
14 1 LEU A 314 ? ? -173.09 122.92
15 1 PHE A 327 ? ? -34.95 -39.23
16 1 PRO A 350 ? ? -69.46 2.03
17 1 SER H 124 ? ? -80.12 -148.23
18 1 ARG H 135 ? ? -4.51 48.35
19 1 PRO H 155 ? ? -77.84 -145.14
20 1 ASP H 172 ? ? -55.71 71.20
21 1 ALA H 178 ? ? -38.85 -32.26
22 1 PHE H 180 ? ? -95.16 35.97
23 1 PRO H 183 ? ? -61.95 6.29
24 1 ASN H 207 ? ? -100.97 -168.05
25 1 ASP H 218 ? ? -39.69 -38.23
26 1 SER H 242 ? ? -57.24 -8.23
27 1 GLN H 260 ? ? 59.81 18.66
28 1 ALA H 274 ? ? -108.38 53.45
29 1 ASP H 275 ? ? 14.82 74.83
30 1 LEU H 314 ? ? -164.00 107.85
31 1 ALA H 328 ? ? -65.71 -84.34
#
_pdbx_validate_main_chain_plane.id 1
_pdbx_validate_main_chain_plane.PDB_model_num 1
_pdbx_validate_main_chain_plane.auth_comp_id LYS
_pdbx_validate_main_chain_plane.auth_asym_id D
_pdbx_validate_main_chain_plane.auth_seq_id 3
_pdbx_validate_main_chain_plane.PDB_ins_code ?
_pdbx_validate_main_chain_plane.label_alt_id ?
_pdbx_validate_main_chain_plane.improper_torsion_angle -11.48
#
loop_
_pdbx_unobs_or_zero_occ_atoms.id
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num
_pdbx_unobs_or_zero_occ_atoms.polymer_flag
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id
_pdbx_unobs_or_zero_occ_atoms.label_alt_id
_pdbx_unobs_or_zero_occ_atoms.label_asym_id
_pdbx_unobs_or_zero_occ_atoms.label_comp_id
_pdbx_unobs_or_zero_occ_atoms.label_seq_id
_pdbx_unobs_or_zero_occ_atoms.label_atom_id
1 1 Y 1 H PHE 157 ? CG ? C PHE 37 CG
2 1 Y 1 H PHE 157 ? CD1 ? C PHE 37 CD1
3 1 Y 1 H PHE 157 ? CD2 ? C PHE 37 CD2
4 1 Y 1 H PHE 157 ? CE1 ? C PHE 37 CE1
5 1 Y 1 H PHE 157 ? CE2 ? C PHE 37 CE2
6 1 Y 1 H PHE 157 ? CZ ? C PHE 37 CZ
#
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
3 'ZINC ION' ZN
4 'MAGNESIUM ION' MG
5 '(2-butyl-1-benzofuran-3-yl){4-[2-(diethylamino)ethoxy]-3,5-diiodophenyl}methanone' BBI
6 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD
7 7-AMINO-4-METHYL-CHROMEN-2-ONE MCM
8 'DI(HYDROXYETHYL)ETHER' PEG
#