data_5H4J # _entry.id 5H4J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5H4J pdb_00005h4j 10.2210/pdb5h4j/pdb WWPDB D_1300001975 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5H4J _pdbx_database_status.recvd_initial_deposition_date 2016-11-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chong, K.T.' 1 'Miyahara, S.' 2 'Miyakoshi, H.' 3 'Fukuoka, M.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol. Cancer Ther.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1538-8514 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 17 _citation.language ? _citation.page_first 1683 _citation.page_last 1693 _citation.title ;TAS-114, a First-in-Class Dual dUTPase/DPD Inhibitor, Demonstrates Potential to Improve Therapeutic Efficacy of Fluoropyrimidine-Based Chemotherapy. ; _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1158/1535-7163.MCT-17-0911 _citation.pdbx_database_id_PubMed 29748212 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yano, W.' 1 ? primary 'Yokogawa, T.' 2 ? primary 'Wakasa, T.' 3 ? primary 'Yamamura, K.' 4 ? primary 'Fujioka, A.' 5 ? primary 'Yoshisue, K.' 6 ? primary 'Matsushima, E.' 7 ? primary 'Miyahara, S.' 8 ? primary 'Miyakoshi, H.' 9 ? primary 'Taguchi, J.' 10 ? primary 'Chong, K.T.' 11 ? primary 'Takao, Y.' 12 ? primary 'Fukuoka, M.' 13 ? primary 'Matsuo, K.' 14 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5H4J _cell.details ? _cell.formula_units_Z ? _cell.length_a 89.645 _cell.length_a_esd ? _cell.length_b 89.645 _cell.length_b_esd ? _cell.length_c 89.645 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5H4J _symmetry.cell_setting ? _symmetry.Int_Tables_number 198 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial ; 17771.068 1 3.6.1.23 ? ? ? 2 non-polymer syn 'N-[(1R)-1-[3-(Cyclopentyloxy)-phenyl]-ethyl]-3-[(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)methoxy]-1-propanesulfonamide' 451.536 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn IMIDAZOLE 69.085 1 ? ? ? ? 5 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 1 ? ? ? ? 6 water nat water 18.015 140 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'dUTPase,dUTP pyrophosphatase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYG RVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGS TGKN ; _entity_poly.pdbx_seq_one_letter_code_can ;MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYG RVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGS TGKN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 CYS n 1 4 SER n 1 5 GLU n 1 6 GLU n 1 7 THR n 1 8 PRO n 1 9 ALA n 1 10 ILE n 1 11 SER n 1 12 PRO n 1 13 SER n 1 14 LYS n 1 15 ARG n 1 16 ALA n 1 17 ARG n 1 18 PRO n 1 19 ALA n 1 20 GLU n 1 21 VAL n 1 22 GLY n 1 23 GLY n 1 24 MET n 1 25 GLN n 1 26 LEU n 1 27 ARG n 1 28 PHE n 1 29 ALA n 1 30 ARG n 1 31 LEU n 1 32 SER n 1 33 GLU n 1 34 HIS n 1 35 ALA n 1 36 THR n 1 37 ALA n 1 38 PRO n 1 39 THR n 1 40 ARG n 1 41 GLY n 1 42 SER n 1 43 ALA n 1 44 ARG n 1 45 ALA n 1 46 ALA n 1 47 GLY n 1 48 TYR n 1 49 ASP n 1 50 LEU n 1 51 TYR n 1 52 SER n 1 53 ALA n 1 54 TYR n 1 55 ASP n 1 56 TYR n 1 57 THR n 1 58 ILE n 1 59 PRO n 1 60 PRO n 1 61 MET n 1 62 GLU n 1 63 LYS n 1 64 ALA n 1 65 VAL n 1 66 VAL n 1 67 LYS n 1 68 THR n 1 69 ASP n 1 70 ILE n 1 71 GLN n 1 72 ILE n 1 73 ALA n 1 74 LEU n 1 75 PRO n 1 76 SER n 1 77 GLY n 1 78 CYS n 1 79 TYR n 1 80 GLY n 1 81 ARG n 1 82 VAL n 1 83 ALA n 1 84 PRO n 1 85 ARG n 1 86 SER n 1 87 GLY n 1 88 LEU n 1 89 ALA n 1 90 ALA n 1 91 LYS n 1 92 HIS n 1 93 PHE n 1 94 ILE n 1 95 ASP n 1 96 VAL n 1 97 GLY n 1 98 ALA n 1 99 GLY n 1 100 VAL n 1 101 ILE n 1 102 ASP n 1 103 GLU n 1 104 ASP n 1 105 TYR n 1 106 ARG n 1 107 GLY n 1 108 ASN n 1 109 VAL n 1 110 GLY n 1 111 VAL n 1 112 VAL n 1 113 LEU n 1 114 PHE n 1 115 ASN n 1 116 PHE n 1 117 GLY n 1 118 LYS n 1 119 GLU n 1 120 LYS n 1 121 PHE n 1 122 GLU n 1 123 VAL n 1 124 LYS n 1 125 LYS n 1 126 GLY n 1 127 ASP n 1 128 ARG n 1 129 ILE n 1 130 ALA n 1 131 GLN n 1 132 LEU n 1 133 ILE n 1 134 CYS n 1 135 GLU n 1 136 ARG n 1 137 ILE n 1 138 PHE n 1 139 TYR n 1 140 PRO n 1 141 GLU n 1 142 ILE n 1 143 GLU n 1 144 GLU n 1 145 VAL n 1 146 GLN n 1 147 ALA n 1 148 LEU n 1 149 ASP n 1 150 ASP n 1 151 THR n 1 152 GLU n 1 153 ARG n 1 154 GLY n 1 155 SER n 1 156 GLY n 1 157 GLY n 1 158 PHE n 1 159 GLY n 1 160 SER n 1 161 THR n 1 162 GLY n 1 163 LYS n 1 164 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 164 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene DUT _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DUT_HUMAN _struct_ref.pdbx_db_accession P33316 _struct_ref.pdbx_db_isoform P33316-2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYG RVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGS TGKN ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5H4J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 164 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P33316 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 164 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 FKM non-polymer . 'N-[(1R)-1-[3-(Cyclopentyloxy)-phenyl]-ethyl]-3-[(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)methoxy]-1-propanesulfonamide' ? 'C21 H29 N3 O6 S' 451.536 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IMD non-polymer . IMIDAZOLE ? 'C3 H5 N2 1' 69.085 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5H4J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.38 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '15~20% PEG 4000, 50mM Tris, 150mM Sodium Acetate, 5mM Zn Acetate' _exptl_crystal_grow.pdbx_pH_range 6.0~6.8 # _diffrn.ambient_environment ? _diffrn.ambient_temp 98 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-02-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-17A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-17A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5H4J _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.8 _reflns.d_resolution_low 51.76 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22554 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.86 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 10.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.237 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.00 _refine.B_iso_max ? _refine.B_iso_mean 25.020 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.961 _refine.correlation_coeff_Fo_to_Fc_free 0.963 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5H4J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 51.76 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21393 _refine.ls_number_reflns_R_free 1144 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.84 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.16961 _refine.ls_R_factor_R_free 0.17316 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.16942 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1Q5U _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.072 _refine.pdbx_overall_ESU_R_Free 0.074 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.002 _refine.overall_SU_ML 0.000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 982 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 41 _refine_hist.number_atoms_solvent 140 _refine_hist.number_atoms_total 1163 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 51.76 # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.799 _refine_ls_shell.d_res_low 1.846 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 89 _refine_ls_shell.number_reflns_R_work 1544 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.245 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.216 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5H4J _struct.title ;Crystal structure of Human dUTPase in complex with N-[(1R)-1-[3-(Cyclopentyloxy)-phenyl]-ethyl]-3-[(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)methoxy]-1-propanesulfonamide ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5H4J _struct_keywords.text 'Hydrolase, Hydrolase inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 85 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 93 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 85 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 93 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 33 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 33 A ZN 202 7_555 ? ? ? ? ? ? ? 1.997 ? ? metalc2 metalc ? ? A HIS 34 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 34 A ZN 202 1_555 ? ? ? ? ? ? ? 2.115 ? ? metalc3 metalc ? ? C ZN . ZN ? ? ? 1_555 D IMD . N1 ? ? A ZN 202 A IMD 203 1_555 ? ? ? ? ? ? ? 2.010 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 4 ? AA3 ? 2 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 27 ? ARG A 30 ? ARG A 27 ARG A 30 AA1 2 ILE A 70 ? ALA A 73 ? ILE A 70 ALA A 73 AA2 1 GLY A 47 ? TYR A 51 ? GLY A 47 TYR A 51 AA2 2 ARG A 128 ? ARG A 136 ? ARG A 128 ARG A 136 AA2 3 CYS A 78 ? ALA A 83 ? CYS A 78 ALA A 83 AA2 4 VAL A 100 ? ILE A 101 ? VAL A 100 ILE A 101 AA3 1 TYR A 56 ? ILE A 58 ? TYR A 56 ILE A 58 AA3 2 PHE A 121 ? VAL A 123 ? PHE A 121 VAL A 123 AA4 1 GLU A 62 ? LYS A 67 ? GLU A 62 LYS A 67 AA4 2 GLY A 110 ? ASN A 115 ? GLY A 110 ASN A 115 AA4 3 ILE A 94 ? GLY A 97 ? ILE A 94 GLY A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 27 ? N ARG A 27 O ALA A 73 ? O ALA A 73 AA2 1 2 N TYR A 48 ? N TYR A 48 O LEU A 132 ? O LEU A 132 AA2 2 3 O GLN A 131 ? O GLN A 131 N ALA A 83 ? N ALA A 83 AA2 3 4 N GLY A 80 ? N GLY A 80 O ILE A 101 ? O ILE A 101 AA3 1 2 N TYR A 56 ? N TYR A 56 O VAL A 123 ? O VAL A 123 AA4 1 2 N VAL A 66 ? N VAL A 66 O VAL A 111 ? O VAL A 111 AA4 2 3 O VAL A 112 ? O VAL A 112 N GLY A 97 ? N GLY A 97 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FKM 201 ? 15 'binding site for residue FKM A 201' AC2 Software A ZN 202 ? 3 'binding site for residue ZN A 202' AC3 Software A IMD 203 ? 6 'binding site for residue IMD A 203' AC4 Software A DMS 204 ? 1 'binding site for residue DMS A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 VAL A 65 ? VAL A 65 . ? 1_555 ? 2 AC1 15 SER A 86 ? SER A 86 . ? 9_555 ? 3 AC1 15 GLY A 87 ? GLY A 87 . ? 9_555 ? 4 AC1 15 ALA A 90 ? ALA A 90 . ? 9_555 ? 5 AC1 15 ALA A 98 ? ALA A 98 . ? 1_555 ? 6 AC1 15 GLY A 99 ? GLY A 99 . ? 1_555 ? 7 AC1 15 VAL A 100 ? VAL A 100 . ? 1_555 ? 8 AC1 15 TYR A 105 ? TYR A 105 . ? 1_555 ? 9 AC1 15 ASN A 108 ? ASN A 108 . ? 1_555 ? 10 AC1 15 VAL A 109 ? VAL A 109 . ? 1_555 ? 11 AC1 15 GLY A 110 ? GLY A 110 . ? 1_555 ? 12 AC1 15 VAL A 112 ? VAL A 112 . ? 1_555 ? 13 AC1 15 HOH F . ? HOH A 354 . ? 1_555 ? 14 AC1 15 HOH F . ? HOH A 390 . ? 1_555 ? 15 AC1 15 HOH F . ? HOH A 401 . ? 1_555 ? 16 AC2 3 GLU A 33 ? GLU A 33 . ? 10_545 ? 17 AC2 3 HIS A 34 ? HIS A 34 . ? 1_555 ? 18 AC2 3 IMD D . ? IMD A 203 . ? 1_555 ? 19 AC3 6 GLU A 33 ? GLU A 33 . ? 10_545 ? 20 AC3 6 HIS A 34 ? HIS A 34 . ? 1_555 ? 21 AC3 6 TYR A 54 ? TYR A 54 . ? 1_555 ? 22 AC3 6 ZN C . ? ZN A 202 . ? 1_555 ? 23 AC3 6 HOH F . ? HOH A 347 . ? 10_545 ? 24 AC3 6 HOH F . ? HOH A 385 . ? 1_555 ? 25 AC4 1 HIS A 92 ? HIS A 92 . ? 1_555 ? # _atom_sites.entry_id 5H4J _atom_sites.fract_transf_matrix[1][1] 0.011155 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011155 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011155 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 CYS 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 PRO 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 ILE 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 PRO 12 12 ? ? ? A . n A 1 13 SER 13 13 ? ? ? A . n A 1 14 LYS 14 14 ? ? ? A . n A 1 15 ARG 15 15 ? ? ? A . n A 1 16 ALA 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 PRO 18 18 ? ? ? A . n A 1 19 ALA 19 19 ? ? ? A . n A 1 20 GLU 20 20 ? ? ? A . n A 1 21 VAL 21 21 ? ? ? A . n A 1 22 GLY 22 22 ? ? ? A . n A 1 23 GLY 23 23 ? ? ? A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 CYS 134 134 134 CYS CYS A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 ASP 150 150 ? ? ? A . n A 1 151 THR 151 151 ? ? ? A . n A 1 152 GLU 152 152 ? ? ? A . n A 1 153 ARG 153 153 ? ? ? A . n A 1 154 GLY 154 154 ? ? ? A . n A 1 155 SER 155 155 ? ? ? A . n A 1 156 GLY 156 156 ? ? ? A . n A 1 157 GLY 157 157 ? ? ? A . n A 1 158 PHE 158 158 ? ? ? A . n A 1 159 GLY 159 159 ? ? ? A . n A 1 160 SER 160 160 ? ? ? A . n A 1 161 THR 161 161 ? ? ? A . n A 1 162 GLY 162 162 ? ? ? A . n A 1 163 LYS 163 163 ? ? ? A . n A 1 164 ASN 164 164 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FKM 1 201 1 FKM fko A . C 3 ZN 1 202 1 ZN ZN A . D 4 IMD 1 203 1 IMD IMD A . E 5 DMS 1 204 1 DMS DMS A . F 6 HOH 1 301 48 HOH HOH A . F 6 HOH 2 302 72 HOH HOH A . F 6 HOH 3 303 91 HOH HOH A . F 6 HOH 4 304 96 HOH HOH A . F 6 HOH 5 305 16 HOH HOH A . F 6 HOH 6 306 26 HOH HOH A . F 6 HOH 7 307 84 HOH HOH A . F 6 HOH 8 308 129 HOH HOH A . F 6 HOH 9 309 65 HOH HOH A . F 6 HOH 10 310 15 HOH HOH A . F 6 HOH 11 311 95 HOH HOH A . F 6 HOH 12 312 29 HOH HOH A . F 6 HOH 13 313 128 HOH HOH A . F 6 HOH 14 314 126 HOH HOH A . F 6 HOH 15 315 113 HOH HOH A . F 6 HOH 16 316 90 HOH HOH A . F 6 HOH 17 317 47 HOH HOH A . F 6 HOH 18 318 67 HOH HOH A . F 6 HOH 19 319 54 HOH HOH A . F 6 HOH 20 320 6 HOH HOH A . F 6 HOH 21 321 19 HOH HOH A . F 6 HOH 22 322 5 HOH HOH A . F 6 HOH 23 323 77 HOH HOH A . F 6 HOH 24 324 106 HOH HOH A . F 6 HOH 25 325 1 HOH HOH A . F 6 HOH 26 326 10 HOH HOH A . F 6 HOH 27 327 32 HOH HOH A . F 6 HOH 28 328 73 HOH HOH A . F 6 HOH 29 329 3 HOH HOH A . F 6 HOH 30 330 37 HOH HOH A . F 6 HOH 31 331 13 HOH HOH A . F 6 HOH 32 332 58 HOH HOH A . F 6 HOH 33 333 20 HOH HOH A . F 6 HOH 34 334 14 HOH HOH A . F 6 HOH 35 335 38 HOH HOH A . F 6 HOH 36 336 27 HOH HOH A . F 6 HOH 37 337 93 HOH HOH A . F 6 HOH 38 338 40 HOH HOH A . F 6 HOH 39 339 34 HOH HOH A . F 6 HOH 40 340 8 HOH HOH A . F 6 HOH 41 341 60 HOH HOH A . F 6 HOH 42 342 49 HOH HOH A . F 6 HOH 43 343 43 HOH HOH A . F 6 HOH 44 344 50 HOH HOH A . F 6 HOH 45 345 122 HOH HOH A . F 6 HOH 46 346 46 HOH HOH A . F 6 HOH 47 347 89 HOH HOH A . F 6 HOH 48 348 59 HOH HOH A . F 6 HOH 49 349 56 HOH HOH A . F 6 HOH 50 350 22 HOH HOH A . F 6 HOH 51 351 63 HOH HOH A . F 6 HOH 52 352 85 HOH HOH A . F 6 HOH 53 353 127 HOH HOH A . F 6 HOH 54 354 4 HOH HOH A . F 6 HOH 55 355 24 HOH HOH A . F 6 HOH 56 356 109 HOH HOH A . F 6 HOH 57 357 30 HOH HOH A . F 6 HOH 58 358 82 HOH HOH A . F 6 HOH 59 359 23 HOH HOH A . F 6 HOH 60 360 108 HOH HOH A . F 6 HOH 61 361 130 HOH HOH A . F 6 HOH 62 362 123 HOH HOH A . F 6 HOH 63 363 66 HOH HOH A . F 6 HOH 64 364 86 HOH HOH A . F 6 HOH 65 365 112 HOH HOH A . F 6 HOH 66 366 17 HOH HOH A . F 6 HOH 67 367 18 HOH HOH A . F 6 HOH 68 368 70 HOH HOH A . F 6 HOH 69 369 12 HOH HOH A . F 6 HOH 70 370 41 HOH HOH A . F 6 HOH 71 371 9 HOH HOH A . F 6 HOH 72 372 44 HOH HOH A . F 6 HOH 73 373 92 HOH HOH A . F 6 HOH 74 374 116 HOH HOH A . F 6 HOH 75 375 134 HOH HOH A . F 6 HOH 76 376 33 HOH HOH A . F 6 HOH 77 377 52 HOH HOH A . F 6 HOH 78 378 55 HOH HOH A . F 6 HOH 79 379 36 HOH HOH A . F 6 HOH 80 380 7 HOH HOH A . F 6 HOH 81 381 114 HOH HOH A . F 6 HOH 82 382 51 HOH HOH A . F 6 HOH 83 383 2 HOH HOH A . F 6 HOH 84 384 25 HOH HOH A . F 6 HOH 85 385 124 HOH HOH A . F 6 HOH 86 386 94 HOH HOH A . F 6 HOH 87 387 133 HOH HOH A . F 6 HOH 88 388 117 HOH HOH A . F 6 HOH 89 389 64 HOH HOH A . F 6 HOH 90 390 87 HOH HOH A . F 6 HOH 91 391 115 HOH HOH A . F 6 HOH 92 392 80 HOH HOH A . F 6 HOH 93 393 101 HOH HOH A . F 6 HOH 94 394 131 HOH HOH A . F 6 HOH 95 395 76 HOH HOH A . F 6 HOH 96 396 11 HOH HOH A . F 6 HOH 97 397 68 HOH HOH A . F 6 HOH 98 398 35 HOH HOH A . F 6 HOH 99 399 21 HOH HOH A . F 6 HOH 100 400 107 HOH HOH A . F 6 HOH 101 401 98 HOH HOH A . F 6 HOH 102 402 83 HOH HOH A . F 6 HOH 103 403 74 HOH HOH A . F 6 HOH 104 404 111 HOH HOH A . F 6 HOH 105 405 31 HOH HOH A . F 6 HOH 106 406 110 HOH HOH A . F 6 HOH 107 407 45 HOH HOH A . F 6 HOH 108 408 61 HOH HOH A . F 6 HOH 109 409 138 HOH HOH A . F 6 HOH 110 410 136 HOH HOH A . F 6 HOH 111 411 100 HOH HOH A . F 6 HOH 112 412 118 HOH HOH A . F 6 HOH 113 413 139 HOH HOH A . F 6 HOH 114 414 97 HOH HOH A . F 6 HOH 115 415 137 HOH HOH A . F 6 HOH 116 416 140 HOH HOH A . F 6 HOH 117 417 42 HOH HOH A . F 6 HOH 118 418 79 HOH HOH A . F 6 HOH 119 419 125 HOH HOH A . F 6 HOH 120 420 28 HOH HOH A . F 6 HOH 121 421 75 HOH HOH A . F 6 HOH 122 422 103 HOH HOH A . F 6 HOH 123 423 53 HOH HOH A . F 6 HOH 124 424 78 HOH HOH A . F 6 HOH 125 425 119 HOH HOH A . F 6 HOH 126 426 99 HOH HOH A . F 6 HOH 127 427 71 HOH HOH A . F 6 HOH 128 428 102 HOH HOH A . F 6 HOH 129 429 69 HOH HOH A . F 6 HOH 130 430 104 HOH HOH A . F 6 HOH 131 431 120 HOH HOH A . F 6 HOH 132 432 121 HOH HOH A . F 6 HOH 133 433 81 HOH HOH A . F 6 HOH 134 434 62 HOH HOH A . F 6 HOH 135 435 135 HOH HOH A . F 6 HOH 136 436 39 HOH HOH A . F 6 HOH 137 437 57 HOH HOH A . F 6 HOH 138 438 132 HOH HOH A . F 6 HOH 139 439 88 HOH HOH A . F 6 HOH 140 440 105 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11670 ? 1 MORE -97 ? 1 'SSA (A^2)' 15200 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 391 ? F HOH . 2 1 A HOH 416 ? F HOH . 3 1 A HOH 417 ? F HOH . 4 1 A HOH 418 ? F HOH . 5 1 A HOH 424 ? F HOH . 6 1 A HOH 435 ? F HOH . 7 1 A HOH 440 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 7_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 62.5 ? 2 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 7_555 N1 ? D IMD . ? A IMD 203 ? 1_555 99.8 ? 3 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 7_555 N1 ? D IMD . ? A IMD 203 ? 1_555 43.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-01 2 'Structure model' 1 1 2018-09-05 3 'Structure model' 1 2 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.name' 13 3 'Structure model' '_database_2.pdbx_DOI' 14 3 'Structure model' '_database_2.pdbx_database_accession' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 24 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 25 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 26 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 27 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 28 3 'Structure model' '_pdbx_struct_conn_angle.value' 29 3 'Structure model' '_struct_conn.pdbx_dist_value' 30 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 31 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 32 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 33 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 34 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 35 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 36 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 37 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 38 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 39 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 40 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 41 3 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystalClear ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystalClear ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HIS _pdbx_validate_close_contact.auth_seq_id_1 92 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 S _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 DMS _pdbx_validate_close_contact.auth_seq_id_2 204 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.05 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 55 ? ? CG A ASP 55 ? ? OD1 A ASP 55 ? ? 125.66 118.30 7.36 0.90 N 2 1 CB A ASP 95 ? ? CG A ASP 95 ? ? OD2 A ASP 95 ? ? 112.09 118.30 -6.21 0.90 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ALA _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 98 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 53.02 _pdbx_validate_torsion.psi -120.99 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A CYS 3 ? A CYS 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A PRO 8 ? A PRO 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A ILE 10 ? A ILE 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A PRO 12 ? A PRO 12 13 1 Y 1 A SER 13 ? A SER 13 14 1 Y 1 A LYS 14 ? A LYS 14 15 1 Y 1 A ARG 15 ? A ARG 15 16 1 Y 1 A ALA 16 ? A ALA 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A PRO 18 ? A PRO 18 19 1 Y 1 A ALA 19 ? A ALA 19 20 1 Y 1 A GLU 20 ? A GLU 20 21 1 Y 1 A VAL 21 ? A VAL 21 22 1 Y 1 A GLY 22 ? A GLY 22 23 1 Y 1 A GLY 23 ? A GLY 23 24 1 Y 1 A ASP 150 ? A ASP 150 25 1 Y 1 A THR 151 ? A THR 151 26 1 Y 1 A GLU 152 ? A GLU 152 27 1 Y 1 A ARG 153 ? A ARG 153 28 1 Y 1 A GLY 154 ? A GLY 154 29 1 Y 1 A SER 155 ? A SER 155 30 1 Y 1 A GLY 156 ? A GLY 156 31 1 Y 1 A GLY 157 ? A GLY 157 32 1 Y 1 A PHE 158 ? A PHE 158 33 1 Y 1 A GLY 159 ? A GLY 159 34 1 Y 1 A SER 160 ? A SER 160 35 1 Y 1 A THR 161 ? A THR 161 36 1 Y 1 A GLY 162 ? A GLY 162 37 1 Y 1 A LYS 163 ? A LYS 163 38 1 Y 1 A ASN 164 ? A ASN 164 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DMS S S N N 88 DMS O O N N 89 DMS C1 C N N 90 DMS C2 C N N 91 DMS H11 H N N 92 DMS H12 H N N 93 DMS H13 H N N 94 DMS H21 H N N 95 DMS H22 H N N 96 DMS H23 H N N 97 FKM O16 O N N 98 FKM S14 S N N 99 FKM O15 O N N 100 FKM C13 C N N 101 FKM C12 C N N 102 FKM C11 C N N 103 FKM O10 O N N 104 FKM C9 C N N 105 FKM N4 N N N 106 FKM C3 C N N 107 FKM O8 O N N 108 FKM N2 N N N 109 FKM C5 C N N 110 FKM C6 C N N 111 FKM C1 C N N 112 FKM O7 O N N 113 FKM N17 N N N 114 FKM C18 C N R 115 FKM C19 C N N 116 FKM C20 C Y N 117 FKM C25 C Y N 118 FKM C24 C Y N 119 FKM C23 C Y N 120 FKM C22 C Y N 121 FKM C21 C Y N 122 FKM O26 O N N 123 FKM C27 C N N 124 FKM C31 C N N 125 FKM C30 C N N 126 FKM C29 C N N 127 FKM C28 C N N 128 FKM H1 H N N 129 FKM H2 H N N 130 FKM H3 H N N 131 FKM H4 H N N 132 FKM H5 H N N 133 FKM H6 H N N 134 FKM H7 H N N 135 FKM H8 H N N 136 FKM H9 H N N 137 FKM H10 H N N 138 FKM H11 H N N 139 FKM H12 H N N 140 FKM H13 H N N 141 FKM H14 H N N 142 FKM H15 H N N 143 FKM H16 H N N 144 FKM H17 H N N 145 FKM H18 H N N 146 FKM H19 H N N 147 FKM H20 H N N 148 FKM H21 H N N 149 FKM H22 H N N 150 FKM H23 H N N 151 FKM H24 H N N 152 FKM H25 H N N 153 FKM H26 H N N 154 FKM H27 H N N 155 FKM H28 H N N 156 FKM H29 H N N 157 GLN N N N N 158 GLN CA C N S 159 GLN C C N N 160 GLN O O N N 161 GLN CB C N N 162 GLN CG C N N 163 GLN CD C N N 164 GLN OE1 O N N 165 GLN NE2 N N N 166 GLN OXT O N N 167 GLN H H N N 168 GLN H2 H N N 169 GLN HA H N N 170 GLN HB2 H N N 171 GLN HB3 H N N 172 GLN HG2 H N N 173 GLN HG3 H N N 174 GLN HE21 H N N 175 GLN HE22 H N N 176 GLN HXT H N N 177 GLU N N N N 178 GLU CA C N S 179 GLU C C N N 180 GLU O O N N 181 GLU CB C N N 182 GLU CG C N N 183 GLU CD C N N 184 GLU OE1 O N N 185 GLU OE2 O N N 186 GLU OXT O N N 187 GLU H H N N 188 GLU H2 H N N 189 GLU HA H N N 190 GLU HB2 H N N 191 GLU HB3 H N N 192 GLU HG2 H N N 193 GLU HG3 H N N 194 GLU HE2 H N N 195 GLU HXT H N N 196 GLY N N N N 197 GLY CA C N N 198 GLY C C N N 199 GLY O O N N 200 GLY OXT O N N 201 GLY H H N N 202 GLY H2 H N N 203 GLY HA2 H N N 204 GLY HA3 H N N 205 GLY HXT H N N 206 HIS N N N N 207 HIS CA C N S 208 HIS C C N N 209 HIS O O N N 210 HIS CB C N N 211 HIS CG C Y N 212 HIS ND1 N Y N 213 HIS CD2 C Y N 214 HIS CE1 C Y N 215 HIS NE2 N Y N 216 HIS OXT O N N 217 HIS H H N N 218 HIS H2 H N N 219 HIS HA H N N 220 HIS HB2 H N N 221 HIS HB3 H N N 222 HIS HD1 H N N 223 HIS HD2 H N N 224 HIS HE1 H N N 225 HIS HE2 H N N 226 HIS HXT H N N 227 HOH O O N N 228 HOH H1 H N N 229 HOH H2 H N N 230 ILE N N N N 231 ILE CA C N S 232 ILE C C N N 233 ILE O O N N 234 ILE CB C N S 235 ILE CG1 C N N 236 ILE CG2 C N N 237 ILE CD1 C N N 238 ILE OXT O N N 239 ILE H H N N 240 ILE H2 H N N 241 ILE HA H N N 242 ILE HB H N N 243 ILE HG12 H N N 244 ILE HG13 H N N 245 ILE HG21 H N N 246 ILE HG22 H N N 247 ILE HG23 H N N 248 ILE HD11 H N N 249 ILE HD12 H N N 250 ILE HD13 H N N 251 ILE HXT H N N 252 IMD N1 N Y N 253 IMD C2 C Y N 254 IMD N3 N Y N 255 IMD C4 C Y N 256 IMD C5 C Y N 257 IMD HN1 H N N 258 IMD H2 H N N 259 IMD HN3 H N N 260 IMD H4 H N N 261 IMD H5 H N N 262 LEU N N N N 263 LEU CA C N S 264 LEU C C N N 265 LEU O O N N 266 LEU CB C N N 267 LEU CG C N N 268 LEU CD1 C N N 269 LEU CD2 C N N 270 LEU OXT O N N 271 LEU H H N N 272 LEU H2 H N N 273 LEU HA H N N 274 LEU HB2 H N N 275 LEU HB3 H N N 276 LEU HG H N N 277 LEU HD11 H N N 278 LEU HD12 H N N 279 LEU HD13 H N N 280 LEU HD21 H N N 281 LEU HD22 H N N 282 LEU HD23 H N N 283 LEU HXT H N N 284 LYS N N N N 285 LYS CA C N S 286 LYS C C N N 287 LYS O O N N 288 LYS CB C N N 289 LYS CG C N N 290 LYS CD C N N 291 LYS CE C N N 292 LYS NZ N N N 293 LYS OXT O N N 294 LYS H H N N 295 LYS H2 H N N 296 LYS HA H N N 297 LYS HB2 H N N 298 LYS HB3 H N N 299 LYS HG2 H N N 300 LYS HG3 H N N 301 LYS HD2 H N N 302 LYS HD3 H N N 303 LYS HE2 H N N 304 LYS HE3 H N N 305 LYS HZ1 H N N 306 LYS HZ2 H N N 307 LYS HZ3 H N N 308 LYS HXT H N N 309 MET N N N N 310 MET CA C N S 311 MET C C N N 312 MET O O N N 313 MET CB C N N 314 MET CG C N N 315 MET SD S N N 316 MET CE C N N 317 MET OXT O N N 318 MET H H N N 319 MET H2 H N N 320 MET HA H N N 321 MET HB2 H N N 322 MET HB3 H N N 323 MET HG2 H N N 324 MET HG3 H N N 325 MET HE1 H N N 326 MET HE2 H N N 327 MET HE3 H N N 328 MET HXT H N N 329 PHE N N N N 330 PHE CA C N S 331 PHE C C N N 332 PHE O O N N 333 PHE CB C N N 334 PHE CG C Y N 335 PHE CD1 C Y N 336 PHE CD2 C Y N 337 PHE CE1 C Y N 338 PHE CE2 C Y N 339 PHE CZ C Y N 340 PHE OXT O N N 341 PHE H H N N 342 PHE H2 H N N 343 PHE HA H N N 344 PHE HB2 H N N 345 PHE HB3 H N N 346 PHE HD1 H N N 347 PHE HD2 H N N 348 PHE HE1 H N N 349 PHE HE2 H N N 350 PHE HZ H N N 351 PHE HXT H N N 352 PRO N N N N 353 PRO CA C N S 354 PRO C C N N 355 PRO O O N N 356 PRO CB C N N 357 PRO CG C N N 358 PRO CD C N N 359 PRO OXT O N N 360 PRO H H N N 361 PRO HA H N N 362 PRO HB2 H N N 363 PRO HB3 H N N 364 PRO HG2 H N N 365 PRO HG3 H N N 366 PRO HD2 H N N 367 PRO HD3 H N N 368 PRO HXT H N N 369 SER N N N N 370 SER CA C N S 371 SER C C N N 372 SER O O N N 373 SER CB C N N 374 SER OG O N N 375 SER OXT O N N 376 SER H H N N 377 SER H2 H N N 378 SER HA H N N 379 SER HB2 H N N 380 SER HB3 H N N 381 SER HG H N N 382 SER HXT H N N 383 THR N N N N 384 THR CA C N S 385 THR C C N N 386 THR O O N N 387 THR CB C N R 388 THR OG1 O N N 389 THR CG2 C N N 390 THR OXT O N N 391 THR H H N N 392 THR H2 H N N 393 THR HA H N N 394 THR HB H N N 395 THR HG1 H N N 396 THR HG21 H N N 397 THR HG22 H N N 398 THR HG23 H N N 399 THR HXT H N N 400 TYR N N N N 401 TYR CA C N S 402 TYR C C N N 403 TYR O O N N 404 TYR CB C N N 405 TYR CG C Y N 406 TYR CD1 C Y N 407 TYR CD2 C Y N 408 TYR CE1 C Y N 409 TYR CE2 C Y N 410 TYR CZ C Y N 411 TYR OH O N N 412 TYR OXT O N N 413 TYR H H N N 414 TYR H2 H N N 415 TYR HA H N N 416 TYR HB2 H N N 417 TYR HB3 H N N 418 TYR HD1 H N N 419 TYR HD2 H N N 420 TYR HE1 H N N 421 TYR HE2 H N N 422 TYR HH H N N 423 TYR HXT H N N 424 VAL N N N N 425 VAL CA C N S 426 VAL C C N N 427 VAL O O N N 428 VAL CB C N N 429 VAL CG1 C N N 430 VAL CG2 C N N 431 VAL OXT O N N 432 VAL H H N N 433 VAL H2 H N N 434 VAL HA H N N 435 VAL HB H N N 436 VAL HG11 H N N 437 VAL HG12 H N N 438 VAL HG13 H N N 439 VAL HG21 H N N 440 VAL HG22 H N N 441 VAL HG23 H N N 442 VAL HXT H N N 443 ZN ZN ZN N N 444 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DMS S O doub N N 83 DMS S C1 sing N N 84 DMS S C2 sing N N 85 DMS C1 H11 sing N N 86 DMS C1 H12 sing N N 87 DMS C1 H13 sing N N 88 DMS C2 H21 sing N N 89 DMS C2 H22 sing N N 90 DMS C2 H23 sing N N 91 FKM O7 C1 doub N N 92 FKM C24 C25 doub Y N 93 FKM C24 C23 sing Y N 94 FKM C1 C6 sing N N 95 FKM C1 N2 sing N N 96 FKM C25 C20 sing Y N 97 FKM C23 C22 doub Y N 98 FKM C6 C5 doub N N 99 FKM N2 C3 sing N N 100 FKM C20 C18 sing N N 101 FKM C20 C21 doub Y N 102 FKM C22 C21 sing Y N 103 FKM C22 O26 sing N N 104 FKM C19 C18 sing N N 105 FKM C18 N17 sing N N 106 FKM O26 C27 sing N N 107 FKM C5 N4 sing N N 108 FKM C3 O8 doub N N 109 FKM C3 N4 sing N N 110 FKM C27 C31 sing N N 111 FKM C27 C28 sing N N 112 FKM C31 C30 sing N N 113 FKM N4 C9 sing N N 114 FKM O15 S14 doub N N 115 FKM N17 S14 sing N N 116 FKM S14 C13 sing N N 117 FKM S14 O16 doub N N 118 FKM C13 C12 sing N N 119 FKM C28 C29 sing N N 120 FKM C30 C29 sing N N 121 FKM C9 O10 sing N N 122 FKM C11 O10 sing N N 123 FKM C11 C12 sing N N 124 FKM C13 H1 sing N N 125 FKM C13 H2 sing N N 126 FKM C12 H3 sing N N 127 FKM C12 H4 sing N N 128 FKM C11 H5 sing N N 129 FKM C11 H6 sing N N 130 FKM C9 H7 sing N N 131 FKM C9 H8 sing N N 132 FKM N2 H9 sing N N 133 FKM C5 H10 sing N N 134 FKM C6 H11 sing N N 135 FKM N17 H12 sing N N 136 FKM C18 H13 sing N N 137 FKM C19 H14 sing N N 138 FKM C19 H15 sing N N 139 FKM C19 H16 sing N N 140 FKM C25 H17 sing N N 141 FKM C24 H18 sing N N 142 FKM C23 H19 sing N N 143 FKM C21 H20 sing N N 144 FKM C27 H21 sing N N 145 FKM C31 H22 sing N N 146 FKM C31 H23 sing N N 147 FKM C30 H24 sing N N 148 FKM C30 H25 sing N N 149 FKM C29 H26 sing N N 150 FKM C29 H27 sing N N 151 FKM C28 H28 sing N N 152 FKM C28 H29 sing N N 153 GLN N CA sing N N 154 GLN N H sing N N 155 GLN N H2 sing N N 156 GLN CA C sing N N 157 GLN CA CB sing N N 158 GLN CA HA sing N N 159 GLN C O doub N N 160 GLN C OXT sing N N 161 GLN CB CG sing N N 162 GLN CB HB2 sing N N 163 GLN CB HB3 sing N N 164 GLN CG CD sing N N 165 GLN CG HG2 sing N N 166 GLN CG HG3 sing N N 167 GLN CD OE1 doub N N 168 GLN CD NE2 sing N N 169 GLN NE2 HE21 sing N N 170 GLN NE2 HE22 sing N N 171 GLN OXT HXT sing N N 172 GLU N CA sing N N 173 GLU N H sing N N 174 GLU N H2 sing N N 175 GLU CA C sing N N 176 GLU CA CB sing N N 177 GLU CA HA sing N N 178 GLU C O doub N N 179 GLU C OXT sing N N 180 GLU CB CG sing N N 181 GLU CB HB2 sing N N 182 GLU CB HB3 sing N N 183 GLU CG CD sing N N 184 GLU CG HG2 sing N N 185 GLU CG HG3 sing N N 186 GLU CD OE1 doub N N 187 GLU CD OE2 sing N N 188 GLU OE2 HE2 sing N N 189 GLU OXT HXT sing N N 190 GLY N CA sing N N 191 GLY N H sing N N 192 GLY N H2 sing N N 193 GLY CA C sing N N 194 GLY CA HA2 sing N N 195 GLY CA HA3 sing N N 196 GLY C O doub N N 197 GLY C OXT sing N N 198 GLY OXT HXT sing N N 199 HIS N CA sing N N 200 HIS N H sing N N 201 HIS N H2 sing N N 202 HIS CA C sing N N 203 HIS CA CB sing N N 204 HIS CA HA sing N N 205 HIS C O doub N N 206 HIS C OXT sing N N 207 HIS CB CG sing N N 208 HIS CB HB2 sing N N 209 HIS CB HB3 sing N N 210 HIS CG ND1 sing Y N 211 HIS CG CD2 doub Y N 212 HIS ND1 CE1 doub Y N 213 HIS ND1 HD1 sing N N 214 HIS CD2 NE2 sing Y N 215 HIS CD2 HD2 sing N N 216 HIS CE1 NE2 sing Y N 217 HIS CE1 HE1 sing N N 218 HIS NE2 HE2 sing N N 219 HIS OXT HXT sing N N 220 HOH O H1 sing N N 221 HOH O H2 sing N N 222 ILE N CA sing N N 223 ILE N H sing N N 224 ILE N H2 sing N N 225 ILE CA C sing N N 226 ILE CA CB sing N N 227 ILE CA HA sing N N 228 ILE C O doub N N 229 ILE C OXT sing N N 230 ILE CB CG1 sing N N 231 ILE CB CG2 sing N N 232 ILE CB HB sing N N 233 ILE CG1 CD1 sing N N 234 ILE CG1 HG12 sing N N 235 ILE CG1 HG13 sing N N 236 ILE CG2 HG21 sing N N 237 ILE CG2 HG22 sing N N 238 ILE CG2 HG23 sing N N 239 ILE CD1 HD11 sing N N 240 ILE CD1 HD12 sing N N 241 ILE CD1 HD13 sing N N 242 ILE OXT HXT sing N N 243 IMD N1 C2 sing Y N 244 IMD N1 C5 sing Y N 245 IMD N1 HN1 sing N N 246 IMD C2 N3 doub Y N 247 IMD C2 H2 sing N N 248 IMD N3 C4 sing Y N 249 IMD N3 HN3 sing N N 250 IMD C4 C5 doub Y N 251 IMD C4 H4 sing N N 252 IMD C5 H5 sing N N 253 LEU N CA sing N N 254 LEU N H sing N N 255 LEU N H2 sing N N 256 LEU CA C sing N N 257 LEU CA CB sing N N 258 LEU CA HA sing N N 259 LEU C O doub N N 260 LEU C OXT sing N N 261 LEU CB CG sing N N 262 LEU CB HB2 sing N N 263 LEU CB HB3 sing N N 264 LEU CG CD1 sing N N 265 LEU CG CD2 sing N N 266 LEU CG HG sing N N 267 LEU CD1 HD11 sing N N 268 LEU CD1 HD12 sing N N 269 LEU CD1 HD13 sing N N 270 LEU CD2 HD21 sing N N 271 LEU CD2 HD22 sing N N 272 LEU CD2 HD23 sing N N 273 LEU OXT HXT sing N N 274 LYS N CA sing N N 275 LYS N H sing N N 276 LYS N H2 sing N N 277 LYS CA C sing N N 278 LYS CA CB sing N N 279 LYS CA HA sing N N 280 LYS C O doub N N 281 LYS C OXT sing N N 282 LYS CB CG sing N N 283 LYS CB HB2 sing N N 284 LYS CB HB3 sing N N 285 LYS CG CD sing N N 286 LYS CG HG2 sing N N 287 LYS CG HG3 sing N N 288 LYS CD CE sing N N 289 LYS CD HD2 sing N N 290 LYS CD HD3 sing N N 291 LYS CE NZ sing N N 292 LYS CE HE2 sing N N 293 LYS CE HE3 sing N N 294 LYS NZ HZ1 sing N N 295 LYS NZ HZ2 sing N N 296 LYS NZ HZ3 sing N N 297 LYS OXT HXT sing N N 298 MET N CA sing N N 299 MET N H sing N N 300 MET N H2 sing N N 301 MET CA C sing N N 302 MET CA CB sing N N 303 MET CA HA sing N N 304 MET C O doub N N 305 MET C OXT sing N N 306 MET CB CG sing N N 307 MET CB HB2 sing N N 308 MET CB HB3 sing N N 309 MET CG SD sing N N 310 MET CG HG2 sing N N 311 MET CG HG3 sing N N 312 MET SD CE sing N N 313 MET CE HE1 sing N N 314 MET CE HE2 sing N N 315 MET CE HE3 sing N N 316 MET OXT HXT sing N N 317 PHE N CA sing N N 318 PHE N H sing N N 319 PHE N H2 sing N N 320 PHE CA C sing N N 321 PHE CA CB sing N N 322 PHE CA HA sing N N 323 PHE C O doub N N 324 PHE C OXT sing N N 325 PHE CB CG sing N N 326 PHE CB HB2 sing N N 327 PHE CB HB3 sing N N 328 PHE CG CD1 doub Y N 329 PHE CG CD2 sing Y N 330 PHE CD1 CE1 sing Y N 331 PHE CD1 HD1 sing N N 332 PHE CD2 CE2 doub Y N 333 PHE CD2 HD2 sing N N 334 PHE CE1 CZ doub Y N 335 PHE CE1 HE1 sing N N 336 PHE CE2 CZ sing Y N 337 PHE CE2 HE2 sing N N 338 PHE CZ HZ sing N N 339 PHE OXT HXT sing N N 340 PRO N CA sing N N 341 PRO N CD sing N N 342 PRO N H sing N N 343 PRO CA C sing N N 344 PRO CA CB sing N N 345 PRO CA HA sing N N 346 PRO C O doub N N 347 PRO C OXT sing N N 348 PRO CB CG sing N N 349 PRO CB HB2 sing N N 350 PRO CB HB3 sing N N 351 PRO CG CD sing N N 352 PRO CG HG2 sing N N 353 PRO CG HG3 sing N N 354 PRO CD HD2 sing N N 355 PRO CD HD3 sing N N 356 PRO OXT HXT sing N N 357 SER N CA sing N N 358 SER N H sing N N 359 SER N H2 sing N N 360 SER CA C sing N N 361 SER CA CB sing N N 362 SER CA HA sing N N 363 SER C O doub N N 364 SER C OXT sing N N 365 SER CB OG sing N N 366 SER CB HB2 sing N N 367 SER CB HB3 sing N N 368 SER OG HG sing N N 369 SER OXT HXT sing N N 370 THR N CA sing N N 371 THR N H sing N N 372 THR N H2 sing N N 373 THR CA C sing N N 374 THR CA CB sing N N 375 THR CA HA sing N N 376 THR C O doub N N 377 THR C OXT sing N N 378 THR CB OG1 sing N N 379 THR CB CG2 sing N N 380 THR CB HB sing N N 381 THR OG1 HG1 sing N N 382 THR CG2 HG21 sing N N 383 THR CG2 HG22 sing N N 384 THR CG2 HG23 sing N N 385 THR OXT HXT sing N N 386 TYR N CA sing N N 387 TYR N H sing N N 388 TYR N H2 sing N N 389 TYR CA C sing N N 390 TYR CA CB sing N N 391 TYR CA HA sing N N 392 TYR C O doub N N 393 TYR C OXT sing N N 394 TYR CB CG sing N N 395 TYR CB HB2 sing N N 396 TYR CB HB3 sing N N 397 TYR CG CD1 doub Y N 398 TYR CG CD2 sing Y N 399 TYR CD1 CE1 sing Y N 400 TYR CD1 HD1 sing N N 401 TYR CD2 CE2 doub Y N 402 TYR CD2 HD2 sing N N 403 TYR CE1 CZ doub Y N 404 TYR CE1 HE1 sing N N 405 TYR CE2 CZ sing Y N 406 TYR CE2 HE2 sing N N 407 TYR CZ OH sing N N 408 TYR OH HH sing N N 409 TYR OXT HXT sing N N 410 VAL N CA sing N N 411 VAL N H sing N N 412 VAL N H2 sing N N 413 VAL CA C sing N N 414 VAL CA CB sing N N 415 VAL CA HA sing N N 416 VAL C O doub N N 417 VAL C OXT sing N N 418 VAL CB CG1 sing N N 419 VAL CB CG2 sing N N 420 VAL CB HB sing N N 421 VAL CG1 HG11 sing N N 422 VAL CG1 HG12 sing N N 423 VAL CG1 HG13 sing N N 424 VAL CG2 HG21 sing N N 425 VAL CG2 HG22 sing N N 426 VAL CG2 HG23 sing N N 427 VAL OXT HXT sing N N 428 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-[(1R)-1-[3-(Cyclopentyloxy)-phenyl]-ethyl]-3-[(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)methoxy]-1-propanesulfonamide' FKM 3 'ZINC ION' ZN 4 IMIDAZOLE IMD 5 'DIMETHYL SULFOXIDE' DMS 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1Q5U _pdbx_initial_refinement_model.details ? #